F448355

General Info

Members Datasets Scaffolds Average Seq Length
459 236 918 105

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10277735|Ga0105239_102777353
Length 128
Sequence MLSRPVLSVGPNFYSGIHTKDNIMPTIIVTTRAGEVRPILAQEGISLMEAIRDAGIDEMLALCGGCCSCATCHVVVDPAFAIFVLPISEDESDLLDSSQFRAVTSRLSCQIPLTPNLEGLRITIAQED

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
102 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
103 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
167 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
168 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
169 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
170 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
171 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
172 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
173 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
174 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
175 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
184 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
192 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
212 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
226 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
227 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
228 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
229 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
230 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
231 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
232 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
233 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
234 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
235 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
236 643692032 Sinorhizobium fredii NGR234 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.88
Nodule 0.22
Rhizoplane 4.14
Rhizosphere 80.61
Stem 0
Stem Tuber 0
Unclassified 3.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10277735 3300010375 Bacteria 1885
2 SwRhRL2b_contig_2454134 2162886007 Bacteria 5586
3 JGI24741J21665_1000267 3300001915 Bacteria 15619
4 JGI24741J21665_1026730 3300001915 Bacteria 878
5 JGI24752J21851_1000059 3300001976 Bacteria 13802
6 JGI24740J21852_10000586 3300001979 Bacteria 15698
7 JGI24739J22299_10109370 3300001989 Bacteria 830
8 JGI24737J22298_10003792 3300001990 Bacteria 5315
9 JGI24737J22298_10025800 3300001990 Bacteria 1857
10 JGI24737J22298_10089138 3300001990 Bacteria 915
11 JGI24743J22301_10005225 3300001991 Bacteria 2158
12 JGI24735J21928_10004991 3300002067 Bacteria 4420
13 JGI24735J21928_10008436 3300002067 Bacteria 3330
14 JGI24735J21928_10010916 3300002067 Bacteria 2886
15 JGI24735J21928_10010972 3300002067 Bacteria 2879
16 JGI24750J21931_1000553 3300002070 Bacteria 5734
17 JGI24748J21848_1000043 3300002074 Bacteria 61255
18 JGI24738J21930_10005678 3300002075 Bacteria 2970
19 JGI24738J21930_10011349 3300002075 Bacteria 1961
20 JGI24738J21930_10098574 3300002075 Bacteria 623
21 JGI24744J21845_10021094 3300002077 Bacteria 1283
22 JGI24034J26672_10000031 3300002239 Bacteria 93812
23 JGI24034J26672_10000059 3300002239 Bacteria 41224
24 JGI24742J22300_10006927 3300002244 Bacteria 1869
25 JGI24742J22300_10072288 3300002244 Bacteria 644
26 JGI24751J29686_10020622 3300002459 Bacteria 1365
27 JGI25164J39214_1010195 3300002772 Bacteria 915
28 JGI25165J46597_1000012 3300003214 Bacteria 421074
29 JGI25165J46597_1000023 3300003214 Bacteria 338873
30 rootH1_10160319 3300003316 Bacteria 1109
31 rootL2_10083037 3300003322 Bacteria 8215
32 Ga0055542_1003824 3300003762 Bacteria 3900
33 Ga0055529_1019820 3300003763 Bacteria 840
34 Ga0065704_10000654 3300005289 Bacteria 26374
35 Ga0070658_10000272 3300005327 Bacteria 45374
36 Ga0070658_10000524 3300005327 Bacteria 33242
37 Ga0070658_10003118 3300005327 Bacteria 13680
38 Ga0070658_10013539 3300005327 Bacteria 6545
39 Ga0070658_10069204 3300005327 Bacteria 2887
40 Ga0070658_10415368 3300005327 Bacteria 1157
41 Ga0070676_10000446 3300005328 Bacteria 19687
42 Ga0070676_10143321 3300005328 Bacteria 1523
43 Ga0070690_100000010 3300005330 Bacteria 103492
44 Ga0070670_100029770 3300005331 Bacteria 4703
45 Ga0070670_100052921 3300005331 Bacteria 3487
46 Ga0068869_100000060 3300005334 Bacteria 48712
47 Ga0070666_10000006 3300005335 Bacteria 319173
48 Ga0068868_100000278 3300005338 Bacteria 34336
49 Ga0068868_100701728 3300005338 Bacteria 905
50 Ga0070660_100000402 3300005339 Bacteria 28811
51 Ga0070660_100006975 3300005339 Bacteria 7840
52 Ga0070660_100008095 3300005339 Bacteria 7346
53 Ga0070660_100112912 3300005339 Bacteria 2163
54 Ga0070660_100352665 3300005339 Bacteria 1212
55 Ga0070660_100430919 3300005339 Bacteria 1092
56 Ga0070689_100014697 3300005340 Bacteria 5693
57 Ga0070661_100001942 3300005344 Bacteria 14311
58 Ga0070661_100111810 3300005344 Bacteria 2040
59 Ga0070661_100219187 3300005344 Bacteria 1459
60 Ga0070661_101266843 3300005344 Bacteria 618
61 Ga0070668_100014736 3300005347 Bacteria 5843
62 Ga0070668_100074166 3300005347 Bacteria 2654
63 Ga0070668_100545862 3300005347 Bacteria 1008
64 Ga0070669_100000273 3300005353 Bacteria 41766
65 Ga0070675_100213051 3300005354 Bacteria 1680
66 Ga0070671_100000082 3300005355 Bacteria 60649
67 Ga0070671_100014479 3300005355 Bacteria 6375
68 Ga0070671_100054193 3300005355 Bacteria 3334
69 Ga0070674_100043810 3300005356 Bacteria 3046
70 Ga0070673_100000019 3300005364 Bacteria 107024
71 Ga0070688_100003320 3300005365 Bacteria 8250
72 Ga0070659_100019046 3300005366 Bacteria 5190
73 Ga0070659_100338162 3300005366 Bacteria 1261
74 Ga0070659_100730612 3300005366 Bacteria 858
75 Ga0070667_100156228 3300005367 Bacteria 2006
76 Ga0070663_100009064 3300005455 Bacteria 6147
77 Ga0070663_100103441 3300005455 Bacteria 2129
78 Ga0070678_100003533 3300005456 Bacteria 8721
79 Ga0070662_100240937 3300005457 Bacteria 1450
80 Ga0068867_100000014 3300005459 Bacteria 112097
81 Ga0070685_10000331 3300005466 Bacteria 29097
82 Ga0070684_100067395 3300005535 Bacteria 3144
83 Ga0068853_100001032 3300005539 Bacteria 19645
84 Ga0068853_100017648 3300005539 Bacteria 5891
85 Ga0068853_100048991 3300005539 Bacteria 3629
86 Ga0068853_100072275 3300005539 Bacteria 3005
87 Ga0068853_102074639 3300005539 Bacteria 551
88 Ga0070672_100006841 3300005543 Bacteria 7700
89 Ga0070672_100496715 3300005543 Bacteria 1055
90 Ga0070686_100000042 3300005544 Bacteria 103828
91 Ga0070693_100009262 3300005547 Bacteria 4892
92 Ga0070665_100000019 3300005548 Bacteria 413972
93 Ga0070665_100000398 3300005548 Bacteria 64092
94 Ga0068855_100000538 3300005563 Bacteria 46347
95 Ga0068855_100565963 3300005563 Bacteria 1229
96 Ga0068855_100582356 3300005563 Unclassified 1208
97 Ga0068855_100633765 3300005563 Bacteria 1150
98 Ga0070664_100008763 3300005564 Bacteria 8194
99 Ga0068857_100054422 3300005577 Bacteria 3551
100 Ga0068857_100395268 3300005577 Unclassified 1286
101 Ga0068854_100000616 3300005578 Bacteria 21024
102 Ga0068854_100000895 3300005578 Bacteria 17906
103 Ga0068854_100030750 3300005578 Bacteria 3727
104 Ga0068854_100081634 3300005578 Bacteria 2388
105 Ga0068854_100517931 3300005578 Bacteria 1007
106 Ga0068856_100008562 3300005614 Bacteria 9944
107 Ga0068856_100166636 3300005614 Bacteria 2214
108 Ga0068856_101902851 3300005614 Bacteria 606
109 Ga0068856_102206782 3300005614 Unclassified 559
110 Ga0068852_100014782 3300005616 Bacteria 6027
111 Ga0068852_101511041 3300005616 Bacteria 694
112 Ga0068852_102420672 3300005616 Unclassified 545
113 Ga0068859_100032563 3300005617 Bacteria 5236
114 Ga0068864_100011860 3300005618 Bacteria 7197
115 Ga0068861_100009040 3300005719 Bacteria 6868
116 Ga0068851_10007144 3300005834 Bacteria 5117
117 Ga0068851_10111784 3300005834 Bacteria 1459
118 Ga0068851_10796755 3300005834 Bacteria 587
119 Ga0068863_100000113 3300005841 Bacteria 85761
120 Ga0068863_100023461 3300005841 Bacteria 5891
121 Ga0068858_100006303 3300005842 Bacteria 11551
122 Ga0068858_100006703 3300005842 Bacteria 11205
123 Ga0068860_100000014 3300005843 Bacteria 319437
124 Ga0068860_100034887 3300005843 Bacteria 4826
125 Ga0068860_100379922 3300005843 Bacteria 1394
126 Ga0068862_100002032 3300005844 Bacteria 18326
127 Ga0068862_100023919 3300005844 Bacteria 5120
128 Ga0097621_100003779 3300006237 Bacteria 10486
129 Ga0097621_100281800 3300006237 Bacteria 1463
130 Ga0068871_100024007 3300006358 Bacteria 4725
131 Ga0068871_101188931 3300006358 Bacteria 715
132 Ga0068865_100000018 3300006881 Bacteria 106975
133 Ga0097620_100032563 3300006931 Bacteria 5236
134 Ga0105251_10000499 3300009011 Bacteria 37180
135 Ga0105250_10237897 3300009092 Bacteria 776
136 Ga0105250_10408107 3300009092 Bacteria 603
137 Ga0105240_10119662 3300009093 Bacteria 3172
138 Ga0105240_10314927 3300009093 Bacteria 1785
139 Ga0105240_10482766 3300009093 Bacteria 1381
140 Ga0105240_11135622 3300009093 Bacteria 830
141 Ga0105245_10000635 3300009098 Bacteria 31928
142 Ga0105247_10017807 3300009101 Bacteria 4260
143 Ga0105247_10134015 3300009101 Bacteria 1617
144 Ga0105243_10000076 3300009148 Bacteria 110445
145 Ga0105241_10002069 3300009174 Bacteria 15160
146 Ga0105241_10097902 3300009174 Bacteria 2327
147 Ga0105242_10001075 3300009176 Bacteria 21449
148 Ga0105248_10001484 3300009177 Bacteria 26121
149 Ga0105248_10002408 3300009177 Bacteria 20772
150 Ga0105237_10009887 3300009545 Bacteria 10186
151 Ga0105237_10273490 3300009545 Bacteria 1692
152 Ga0105249_10000035 3300009553 Bacteria 201325
153 Ga0105249_10006954 3300009553 Bacteria 9866
154 Ga0105249_12714005 3300009553 Unclassified 567
155 Ga0099796_10167156 3300010159 Unclassified 875
156 Ga0105239_10044176 3300010375 Bacteria 4885
157 Ga0105246_10009475 3300011119 Bacteria 5999
158 Ga0157373_10005221 3300013100 Bacteria 9752
159 Ga0157373_10010592 3300013100 Bacteria 6784
160 Ga0157373_10099631 3300013100 Bacteria 2045
161 Ga0157373_11441387 3300013100 Bacteria 524
162 Ga0157371_10000111 3300013102 Bacteria 123977
163 Ga0157371_10539035 3300013102 Bacteria 864
164 Ga0157371_11157289 3300013102 Bacteria 595
165 Ga0157370_10000201 3300013104 Bacteria 75437
166 Ga0157370_10010738 3300013104 Bacteria 9630
167 Ga0157369_10058947 3300013105 Bacteria 4141
168 Ga0157369_10136699 3300013105 Bacteria 2595
169 Ga0157369_10277916 3300013105 Bacteria 1744
170 Ga0157374_10002212 3300013296 Bacteria 16392
171 Ga0157374_10002884 3300013296 Bacteria 14419
172 Ga0157374_10093824 3300013296 Bacteria 2866
173 Ga0157378_10005235 3300013297 Bacteria 11390
174 Ga0163162_10256856 3300013306 Bacteria 1879
175 Ga0157372_10010868 3300013307 Bacteria 9691
176 Ga0157372_10059330 3300013307 Bacteria 4279
177 Ga0157372_10222030 3300013307 Bacteria 2190
178 Ga0157375_10003652 3300013308 Bacteria 13343
179 Ga0163163_10076144 3300014325 Bacteria 3350
180 Ga0163163_11548136 3300014325 Bacteria 724
181 Ga0157380_10002994 3300014326 Bacteria 11507
182 Ga0157379_10015425 3300014968 Bacteria 6703
183 Ga0157379_10359625 3300014968 Bacteria 1334
184 Ga0157379_10946101 3300014968 Unclassified 819
185 Ga0157376_10000091 3300014969 Bacteria 68377
186 Ga0163161_10041725 3300017792 Bacteria 3298
187 Ga0163161_10277230 3300017792 Bacteria 1314
188 Ga0163161_10577302 3300017792 Bacteria 924
189 Ga0207672_1000378 3300025223 Bacteria 5803
190 Ga0207427_101016 3300025231 Bacteria 11731
191 Ga0207427_111643 3300025231 Bacteria 890
192 Ga0207427_119324 3300025231 Bacteria 620
193 Ga0209437_114931 3300025233 Bacteria 1072
194 Ga0209026_1002447 3300025250 Bacteria 6976
195 Ga0209148_1000301 3300025254 Bacteria 71452
196 Ga0209148_1000863 3300025254 Bacteria 21228
197 Ga0209233_1000003 3300025261 Bacteria 1607366
198 Ga0209233_1000042 3300025261 Bacteria 510519
199 Ga0209233_1000058 3300025261 Bacteria 421872
200 Ga0209565_1042603 3300025263 Bacteria 840
201 Ga0209455_1002118 3300025272 Bacteria 7876
202 Ga0207656_10006709 3300025321 Bacteria 4158
203 Ga0207656_10086057 3300025321 Bacteria 1420
204 Ga0207713_1002079 3300025735 Bacteria 14959
205 Ga0207682_10095704 3300025893 Bacteria 1293
206 Ga0207710_10035735 3300025900 Bacteria 2187
207 Ga0207680_10000011 3300025903 Bacteria 391225
208 Ga0207680_10413185 3300025903 Bacteria 955
209 Ga0207647_10007086 3300025904 Bacteria 8131
210 Ga0207647_10013389 3300025904 Bacteria 5688
211 Ga0207647_10066802 3300025904 Bacteria 2180
212 Ga0207647_10248239 3300025904 Bacteria 1021
213 Ga0207645_10001519 3300025907 Bacteria 18956
214 Ga0207705_10000084 3300025909 Bacteria 116809
215 Ga0207705_10000162 3300025909 Bacteria 71983
216 Ga0207705_10000315 3300025909 Bacteria 44169
217 Ga0207705_10012060 3300025909 Bacteria 6244
218 Ga0207705_10018866 3300025909 Bacteria 4932
219 Ga0207705_11531235 3300025909 Bacteria 504
220 Ga0207654_10000338 3300025911 Bacteria 28052
221 Ga0207654_10039494 3300025911 Bacteria 2655
222 Ga0207695_10004015 3300025913 Bacteria 20253
223 Ga0207695_10182425 3300025913 Bacteria 2019
224 Ga0207695_11555816 3300025913 Bacteria 542
225 Ga0207671_10005890 3300025914 Bacteria 11124
226 Ga0207671_10082298 3300025914 Bacteria 2415
227 Ga0207671_10664493 3300025914 Bacteria 829
228 Ga0207657_10000414 3300025919 Bacteria 45279
229 Ga0207657_10002387 3300025919 Bacteria 20320
230 Ga0207657_10018595 3300025919 Bacteria 6624
231 Ga0207657_10062943 3300025919 Bacteria 3174
232 Ga0207657_10113951 3300025919 Bacteria 2230
233 Ga0207657_10124387 3300025919 Bacteria 2119
234 Ga0207657_10200376 3300025919 Bacteria 1606
235 Ga0207649_10000590 3300025920 Bacteria 24648
236 Ga0207649_10060760 3300025920 Bacteria 2376
237 Ga0207649_10182778 3300025920 Bacteria 1469
238 Ga0207649_11107158 3300025920 Bacteria 625
239 Ga0207649_11297165 3300025920 Bacteria 576
240 Ga0207681_10001623 3300025923 Bacteria 14500
241 Ga0207694_10009186 3300025924 Bacteria 7459
242 Ga0207650_10073019 3300025925 Bacteria 2583
243 Ga0207650_10420232 3300025925 Bacteria 1109
244 Ga0207659_10110577 3300025926 Bacteria 2088
245 Ga0207687_10003369 3300025927 Bacteria 10795
246 Ga0207644_10006954 3300025931 Bacteria 7367
247 Ga0207644_10045131 3300025931 Bacteria 3134
248 Ga0207644_10510237 3300025931 Bacteria 992
249 Ga0207690_10000853 3300025932 Bacteria 19537
250 Ga0207706_10122750 3300025933 Bacteria 2285
251 Ga0207706_10641949 3300025933 Bacteria 910
252 Ga0207686_10000915 3300025934 Bacteria 17667
253 Ga0207709_10000114 3300025935 Bacteria 124672
254 Ga0207669_10147650 3300025937 Bacteria 1642
255 Ga0207704_10000008 3300025938 Bacteria 204682
256 Ga0207704_10977752 3300025938 Bacteria 715
257 Ga0207691_10026499 3300025940 Bacteria 5438
258 Ga0207691_10692714 3300025940 Bacteria 859
259 Ga0207711_10000346 3300025941 Bacteria 49286
260 Ga0207711_10010168 3300025941 Bacteria 7812
261 Ga0207689_10000086 3300025942 Bacteria 75369
262 Ga0207661_10236970 3300025944 Bacteria 1618
263 Ga0207679_10447438 3300025945 Unclassified 1145
264 Ga0207667_10000004 3300025949 Bacteria 737718
265 Ga0207667_10000024 3300025949 Bacteria 355874
266 Ga0207667_10237007 3300025949 Bacteria 1868
267 Ga0207667_10601301 3300025949 Bacteria 1109
268 Ga0207651_10000008 3300025960 Bacteria 204538
269 Ga0207712_10000013 3300025961 Bacteria 391208
270 Ga0207712_10005429 3300025961 Bacteria 8044
271 Ga0207712_10304544 3300025961 Bacteria 1309
272 Ga0207668_10003123 3300025972 Bacteria 9702
273 Ga0207668_10054672 3300025972 Bacteria 2772
274 Ga0207668_10282480 3300025972 Bacteria 1362
275 Ga0207640_10000031 3300025981 Bacteria 120815
276 Ga0207640_10000109 3300025981 Bacteria 62407
277 Ga0207640_10001468 3300025981 Bacteria 12731
278 Ga0207640_10104297 3300025981 Bacteria 1995
279 Ga0207640_10531063 3300025981 Bacteria 985
280 Ga0207658_10000308 3300025986 Bacteria 50124
281 Ga0207658_10080317 3300025986 Bacteria 2497
282 Ga0207677_10000854 3300026023 Bacteria 17450
283 Ga0207677_10456370 3300026023 Bacteria 1096
284 Ga0207703_10002775 3300026035 Bacteria 14990
285 Ga0207703_10008912 3300026035 Bacteria 7902
286 Ga0207639_10000642 3300026041 Bacteria 24089
287 Ga0207639_10007962 3300026041 Bacteria 7237
288 Ga0207639_10054254 3300026041 Bacteria 3063
289 Ga0207639_10057836 3300026041 Bacteria 2980
290 Ga0207639_10063562 3300026041 Bacteria 2859
291 Ga0207678_10002266 3300026067 Bacteria 17415
292 Ga0207678_10036772 3300026067 Bacteria 4263
293 Ga0207702_10000087 3300026078 Bacteria 105856
294 Ga0207702_10007068 3300026078 Bacteria 9600
295 Ga0207702_10055523 3300026078 Bacteria 3359
296 Ga0207641_10000161 3300026088 Bacteria 94555
297 Ga0207641_10003741 3300026088 Bacteria 13374
298 Ga0207648_10000009 3300026089 Bacteria 204229
299 Ga0207676_10000543 3300026095 Bacteria 31456
300 Ga0207674_10007563 3300026116 Bacteria 12656
301 Ga0207674_10051922 3300026116 Bacteria 4182
302 Ga0207674_10288219 3300026116 Unclassified 1590
303 Ga0207674_10883461 3300026116 Bacteria 862
304 Ga0207675_100000269 3300026118 Bacteria 49352
305 Ga0207683_10010449 3300026121 Bacteria 7920
306 Ga0207698_10000214 3300026142 Bacteria 36073
307 Ga0207698_10000517 3300026142 Bacteria 22420
308 Ga0207698_11838078 3300026142 Bacteria 621
309 Ga0268266_10000025 3300028379 Bacteria 477143
310 Ga0268266_10000786 3300028379 Bacteria 42381
311 Ga0268266_10563811 3300028379 Bacteria 1092
312 Ga0268266_11997772 3300028379 Bacteria 553
313 Ga0268265_10000857 3300028380 Bacteria 28514
314 Ga0268265_10011964 3300028380 Bacteria 5871
315 Ga0268264_10000037 3300028381 Bacteria 391116
316 Ga0268264_10026356 3300028381 Bacteria 4749
317 Ga0268264_10339623 3300028381 Bacteria 1426
318 Ga0307515_10022792 3300028794 Bacteria 11019
319 Ga0307515_10097015 3300028794 Bacteria 3608
320 Ga0307515_10484154 3300028794 Bacteria 849
321 Ga0307408_100553105 3300031548 Bacteria 1016
322 Ga0395900_1041023 3300037418 Bacteria 737
323 Ga0395898_0493518 3300037466 Bacteria 1165
324 Ga0395905_0021618 3300037471 Bacteria 6085
325 Ga0395905_0033281 3300037471 Bacteria 4843
326 Ga0395905_0073682 3300037471 Bacteria 3201
327 Ga0395905_0869849 3300037471 Bacteria 804
328 Ga0395905_1023390 3300037471 Bacteria 729
329 Ga0395901_0732031 3300038443 Bacteria 983
330 Ga0436360_0368092 3300039438 Bacteria 763
331 Ga0436363_0375573 3300039450 Bacteria 1038
332 Ga0436363_0767973 3300039450 Bacteria 548
333 Ga0451793_0148664 3300041452 Bacteria 1071
334 Ga0451795_1346752 3300041456 Unclassified 1462
335 Ga0451800_0059754 3300041459 Bacteria 641
336 Ga0451800_0921903 3300041459 Bacteria 502
337 Ga0451802_1033503 3300041460 Bacteria 2332
338 Ga0451806_638530 3300041462 Bacteria 3298
339 Ga0451807_2656061 3300041486 Bacteria 1471
340 Ga0451807_2727727 3300041486 Unclassified 699
341 Ga0451835_0321962 3300041492 Bacteria 619
342 Ga0439448_0040601 3300042005 Bacteria 1503
343 Ga0439458_0000511 3300042157 Bacteria 9959
344 Ga0466969_0096795 3300044656 Bacteria 1393
345 Ga0466972_0003556 3300044658 Bacteria 7742
346 Ga0466972_0006929 3300044658 Bacteria 5684
347 Ga0466972_0164235 3300044658 Bacteria 1043
348 Ga0466972_0524614 3300044658 Bacteria 558
349 Ga0466965_0073588 3300044683 Bacteria 1721
350 Ga0466965_0167154 3300044683 Bacteria 1155
351 Ga0466966_0135432 3300044684 Bacteria 1506
352 Ga0466966_0651385 3300044684 Bacteria 634
353 Ga0466961_0024942 3300044693 Bacteria 3847
354 Ga0466961_0054582 3300044693 Bacteria 2548
355 Ga0466961_0092604 3300044693 Bacteria 1907
356 Ga0466963_0002708 3300044694 Bacteria 9985
357 Ga0466964_0009890 3300044706 Bacteria 3594
358 Ga0466964_0127541 3300044706 Bacteria 1154
359 Ga0466971_0459672 3300044719 Bacteria 625
360 Ga0466968_0008225 3300044735 Bacteria 3990
361 Ga0466970_0002986 3300044765 Bacteria 8199
362 Ga0466970_0442842 3300044765 Bacteria 744
363 Ga0466970_0571185 3300044765 Bacteria 654
364 Ga0466957_0024106 3300044842 Bacteria 3601
365 Ga0466957_0600483 3300044842 Bacteria 770
366 Ga0466957_0852558 3300044842 Bacteria 649
367 Ga0466960_0000882 3300044901 Bacteria 10600
368 Ga0466960_0043444 3300044901 Bacteria 2137
369 Ga0466959_0002648 3300045049 Bacteria 11490
370 Ga0466959_0234089 3300045049 Bacteria 1270
371 Ga0466958_0051617 3300045836 Bacteria 2490
372 Ga0466958_0145865 3300045836 Bacteria 1491
373 Ga0466958_0173934 3300045836 Bacteria 1364
374 Ga0466958_0496544 3300045836 Bacteria 792
375 Ga0466967_0028322 3300045976 Bacteria 4676
376 Ga0466967_0491158 3300045976 Bacteria 1204
377 Ga0495638_0000079 3300046460 Bacteria 157488
378 Ga0495650_0320613 3300046471 Bacteria 516
379 Ga0495637_0194148 3300046520 Bacteria 748
380 Ga0495625_0000011 3300046660 Bacteria 377120
381 Ga0495625_0000540 3300046660 Bacteria 55675
382 Ga0495670_0733968 3300046691 Bacteria 539
383 Ga0495686_0000063 3300047472 Bacteria 228575
384 Ga0495686_0002693 3300047472 Bacteria 16300
385 Ga0495686_0035608 3300047472 Bacteria 3198
386 Ga0495686_0257493 3300047472 Bacteria 978
387 Ga0495686_0644647 3300047472 Bacteria 545
388 Ga0496100_0207865 3300048903 Bacteria 1430
389 Ga0496102_0016435 3300048905 Bacteria 6464
390 Ga0496103_0001592 3300048906 Bacteria 14949
391 Ga0496104_0092957 3300048907 Bacteria 2884
392 Ga0496104_1587655 3300048907 Bacteria 557
393 Ga0496105_0519234 3300048908 Bacteria 933
394 Ga0496106_1039410 3300048909 Bacteria 643
395 Ga0496107_0079643 3300048910 Bacteria 2388
396 Ga0496111_0049630 3300048914 Bacteria 3026
397 Ga0496111_0123926 3300048914 Bacteria 1910
398 Ga0496113_1330030 3300048916 Bacteria 558
399 Ga0496116_0045208 3300048919 Bacteria 2983
400 Ga0496116_0054785 3300048919 Bacteria 2624
401 Ga0496117_0006506 3300048920 Bacteria 11783
402 Ga0496117_0016292 3300048920 Bacteria 6280
403 Ga0496117_0125542 3300048920 Bacteria 1567
404 Ga0496118_0005131 3300048921 Bacteria 15033
405 Ga0496118_0023725 3300048921 Bacteria 5316
406 Ga0496118_0052053 3300048921 Bacteria 3127
407 Ga0496118_0071366 3300048921 Bacteria 2500
408 Ga0496118_0491249 3300048921 Unclassified 613
409 Ga0496118_0583197 3300048921 Bacteria 538
410 Ga0496119_0048614 3300048922 Bacteria 2629
411 Ga0496119_0189633 3300048922 Bacteria 1072
412 Ga0496120_0174141 3300048923 Bacteria 1062
413 Ga0496120_0241137 3300048923 Bacteria 853
414 Ga0496121_0009254 3300048924 Bacteria 11374
415 Ga0496121_0022230 3300048924 Bacteria 6168
416 Ga0496121_0108220 3300048924 Bacteria 2127
417 Ga0496121_0532940 3300048924 Bacteria 738
418 Ga0496122_0009724 3300048925 Bacteria 10052
419 Ga0496122_0184187 3300048925 Bacteria 1241
420 Ga0496122_0399401 3300048925 Bacteria 698
421 Ga0496123_0004885 3300048926 Bacteria 13779
422 Ga0496123_0014406 3300048926 Bacteria 6556
423 Ga0496123_0070838 3300048926 Bacteria 2179
424 Ga0496124_0010035 3300048927 Bacteria 9664
425 Ga0496124_0032741 3300048927 Bacteria 4584
426 Ga0496124_0194849 3300048927 Bacteria 1547
427 Ga0496125_0086672 3300048928 Bacteria 2367
428 Ga0496125_0133202 3300048928 Bacteria 1745
429 Ga0496125_0158520 3300048928 Bacteria 1541
430 Ga0496126_0299937 3300048929 Bacteria 1326
431 Ga0496126_0843752 3300048929 Bacteria 699
432 Ga0501032_0247862 3300049569 Bacteria 1156
433 Ga0501034_1323052 3300049571 Unclassified 597
434 Ga0501036_1443366 3300049572 Unclassified 557
435 Ga0501043_0027205 3300049579 Bacteria 4490
436 Ga0501047_0051984 3300049581 Bacteria 3960
437 Ga0501047_0340033 3300049581 Bacteria 1338
438 Ga0501048_0208455 3300049582 Bacteria 1386
439 Ga0501080_0270008 3300049742 Bacteria 1548
440 Ga0501035_0015019 3300049822 Bacteria 7147
441 Ga0501035_0111523 3300049822 Bacteria 2397
442 Ga0501035_0810321 3300049822 Bacteria 747
443 Ga0501044_0080145 3300049823 Bacteria 3307
444 Ga0501044_0415910 3300049823 Bacteria 1255
445 nmdc:mga03683_305617_c1 3300050489 Bacteria 747
446 Ga0500643_000004 3300053087 Bacteria 857484
447 Ga0500562_080707 3300053108 Bacteria 880
448 Ga0500608_275492 3300053122 Bacteria 640
449 Ga0500618_101575 3300053125 Bacteria 648
450 Ga0500559_0056852 3300053136 Bacteria 1737
451 Ga0500588_0074973 3300053146 Bacteria 1118
452 Ga0500616_0402483 3300053153 Bacteria 547
453 Ga0500622_0015836 3300053156 Bacteria 4037
454 Ga0500622_0183944 3300053156 Bacteria 963
455 Ga0500645_081888 3300053730 Bacteria 920
456 Ga0466962_0020400 3300061719 Bacteria 3184
457 Ga0466962_0061594 3300061719 Bacteria 1791
458 Ga0466962_0262681 3300061719 Bacteria 850
459 643823332 643692032 Bacteria 6891900
460 Ga0105239_10277735
461 SwRhRL2b_contig_2454134
462 JGI24741J21665_1000267
463 JGI24741J21665_1026730
464 JGI24752J21851_1000059
465 JGI24740J21852_10000586
466 JGI24739J22299_10109370
467 JGI24737J22298_10003792
468 JGI24737J22298_10025800
469 JGI24737J22298_10089138
470 JGI24743J22301_10005225
471 JGI24735J21928_10004991
472 JGI24735J21928_10008436
473 JGI24735J21928_10010916
474 JGI24735J21928_10010972
475 JGI24750J21931_1000553
476 JGI24748J21848_1000043
477 JGI24738J21930_10005678
478 JGI24738J21930_10011349
479 JGI24738J21930_10098574
480 JGI24744J21845_10021094
481 JGI24034J26672_10000031
482 JGI24034J26672_10000059
483 JGI24742J22300_10006927
484 JGI24742J22300_10072288
485 JGI24751J29686_10020622
486 JGI25164J39214_1010195
487 JGI25165J46597_1000012
488 JGI25165J46597_1000023
489 rootH1_10160319
490 rootL2_10083037
491 Ga0055542_1003824
492 Ga0055529_1019820
493 Ga0065704_10000654
494 Ga0070658_10000272
495 Ga0070658_10000524
496 Ga0070658_10003118
497 Ga0070658_10013539
498 Ga0070658_10069204
499 Ga0070658_10415368
500 Ga0070676_10000446
501 Ga0070676_10143321
502 Ga0070690_100000010
503 Ga0070670_100029770
504 Ga0070670_100052921
505 Ga0068869_100000060
506 Ga0070666_10000006
507 Ga0068868_100000278
508 Ga0068868_100701728
509 Ga0070660_100000402
510 Ga0070660_100006975
511 Ga0070660_100008095
512 Ga0070660_100112912
513 Ga0070660_100352665
514 Ga0070660_100430919
515 Ga0070689_100014697
516 Ga0070661_100001942
517 Ga0070661_100111810
518 Ga0070661_100219187
519 Ga0070661_101266843
520 Ga0070668_100014736
521 Ga0070668_100074166
522 Ga0070668_100545862
523 Ga0070669_100000273
524 Ga0070675_100213051
525 Ga0070671_100000082
526 Ga0070671_100014479
527 Ga0070671_100054193
528 Ga0070674_100043810
529 Ga0070673_100000019
530 Ga0070688_100003320
531 Ga0070659_100019046
532 Ga0070659_100338162
533 Ga0070659_100730612
534 Ga0070667_100156228
535 Ga0070663_100009064
536 Ga0070663_100103441
537 Ga0070678_100003533
538 Ga0070662_100240937
539 Ga0068867_100000014
540 Ga0070685_10000331
541 Ga0070684_100067395
542 Ga0068853_100001032
543 Ga0068853_100017648
544 Ga0068853_100048991
545 Ga0068853_100072275
546 Ga0068853_102074639
547 Ga0070672_100006841
548 Ga0070672_100496715
549 Ga0070686_100000042
550 Ga0070693_100009262
551 Ga0070665_100000019
552 Ga0070665_100000398
553 Ga0068855_100000538
554 Ga0068855_100565963
555 Ga0068855_100582356
556 Ga0068855_100633765
557 Ga0070664_100008763
558 Ga0068857_100054422
559 Ga0068857_100395268
560 Ga0068854_100000616
561 Ga0068854_100000895
562 Ga0068854_100030750
563 Ga0068854_100081634
564 Ga0068854_100517931
565 Ga0068856_100008562
566 Ga0068856_100166636
567 Ga0068856_101902851
568 Ga0068856_102206782
569 Ga0068852_100014782
570 Ga0068852_101511041
571 Ga0068852_102420672
572 Ga0068859_100032563
573 Ga0068864_100011860
574 Ga0068861_100009040
575 Ga0068851_10007144
576 Ga0068851_10111784
577 Ga0068851_10796755
578 Ga0068863_100000113
579 Ga0068863_100023461
580 Ga0068858_100006303
581 Ga0068858_100006703
582 Ga0068860_100000014
583 Ga0068860_100034887
584 Ga0068860_100379922
585 Ga0068862_100002032
586 Ga0068862_100023919
587 Ga0097621_100003779
588 Ga0097621_100281800
589 Ga0068871_100024007
590 Ga0068871_101188931
591 Ga0068865_100000018
592 Ga0097620_100032563
593 Ga0105251_10000499
594 Ga0105250_10237897
595 Ga0105250_10408107
596 Ga0105240_10119662
597 Ga0105240_10314927
598 Ga0105240_10482766
599 Ga0105240_11135622
600 Ga0105245_10000635
601 Ga0105247_10017807
602 Ga0105247_10134015
603 Ga0105243_10000076
604 Ga0105241_10002069
605 Ga0105241_10097902
606 Ga0105242_10001075
607 Ga0105248_10001484
608 Ga0105248_10002408
609 Ga0105237_10009887
610 Ga0105237_10273490
611 Ga0105249_10000035
612 Ga0105249_10006954
613 Ga0105249_12714005
614 Ga0099796_10167156
615 Ga0105239_10044176
616 Ga0105246_10009475
617 Ga0157373_10005221
618 Ga0157373_10010592
619 Ga0157373_10099631
620 Ga0157373_11441387
621 Ga0157371_10000111
622 Ga0157371_10539035
623 Ga0157371_11157289
624 Ga0157370_10000201
625 Ga0157370_10010738
626 Ga0157369_10058947
627 Ga0157369_10136699
628 Ga0157369_10277916
629 Ga0157374_10002212
630 Ga0157374_10002884
631 Ga0157374_10093824
632 Ga0157378_10005235
633 Ga0163162_10256856
634 Ga0157372_10010868
635 Ga0157372_10059330
636 Ga0157372_10222030
637 Ga0157375_10003652
638 Ga0163163_10076144
639 Ga0163163_11548136
640 Ga0157380_10002994
641 Ga0157379_10015425
642 Ga0157379_10359625
643 Ga0157379_10946101
644 Ga0157376_10000091
645 Ga0163161_10041725
646 Ga0163161_10277230
647 Ga0163161_10577302
648 Ga0207672_1000378
649 Ga0207427_101016
650 Ga0207427_111643
651 Ga0207427_119324
652 Ga0209437_114931
653 Ga0209026_1002447
654 Ga0209148_1000301
655 Ga0209148_1000863
656 Ga0209233_1000003
657 Ga0209233_1000042
658 Ga0209233_1000058
659 Ga0209565_1042603
660 Ga0209455_1002118
661 Ga0207656_10006709
662 Ga0207656_10086057
663 Ga0207713_1002079
664 Ga0207682_10095704
665 Ga0207710_10035735
666 Ga0207680_10000011
667 Ga0207680_10413185
668 Ga0207647_10007086
669 Ga0207647_10013389
670 Ga0207647_10066802
671 Ga0207647_10248239
672 Ga0207645_10001519
673 Ga0207705_10000084
674 Ga0207705_10000162
675 Ga0207705_10000315
676 Ga0207705_10012060
677 Ga0207705_10018866
678 Ga0207705_11531235
679 Ga0207654_10000338
680 Ga0207654_10039494
681 Ga0207695_10004015
682 Ga0207695_10182425
683 Ga0207695_11555816
684 Ga0207671_10005890
685 Ga0207671_10082298
686 Ga0207671_10664493
687 Ga0207657_10000414
688 Ga0207657_10002387
689 Ga0207657_10018595
690 Ga0207657_10062943
691 Ga0207657_10113951
692 Ga0207657_10124387
693 Ga0207657_10200376
694 Ga0207649_10000590
695 Ga0207649_10060760
696 Ga0207649_10182778
697 Ga0207649_11107158
698 Ga0207649_11297165
699 Ga0207681_10001623
700 Ga0207694_10009186
701 Ga0207650_10073019
702 Ga0207650_10420232
703 Ga0207659_10110577
704 Ga0207687_10003369
705 Ga0207644_10006954
706 Ga0207644_10045131
707 Ga0207644_10510237
708 Ga0207690_10000853
709 Ga0207706_10122750
710 Ga0207706_10641949
711 Ga0207686_10000915
712 Ga0207709_10000114
713 Ga0207669_10147650
714 Ga0207704_10000008
715 Ga0207704_10977752
716 Ga0207691_10026499
717 Ga0207691_10692714
718 Ga0207711_10000346
719 Ga0207711_10010168
720 Ga0207689_10000086
721 Ga0207661_10236970
722 Ga0207679_10447438
723 Ga0207667_10000004
724 Ga0207667_10000024
725 Ga0207667_10237007
726 Ga0207667_10601301
727 Ga0207651_10000008
728 Ga0207712_10000013
729 Ga0207712_10005429
730 Ga0207712_10304544
731 Ga0207668_10003123
732 Ga0207668_10054672
733 Ga0207668_10282480
734 Ga0207640_10000031
735 Ga0207640_10000109
736 Ga0207640_10001468
737 Ga0207640_10104297
738 Ga0207640_10531063
739 Ga0207658_10000308
740 Ga0207658_10080317
741 Ga0207677_10000854
742 Ga0207677_10456370
743 Ga0207703_10002775
744 Ga0207703_10008912
745 Ga0207639_10000642
746 Ga0207639_10007962
747 Ga0207639_10054254
748 Ga0207639_10057836
749 Ga0207639_10063562
750 Ga0207678_10002266
751 Ga0207678_10036772
752 Ga0207702_10000087
753 Ga0207702_10007068
754 Ga0207702_10055523
755 Ga0207641_10000161
756 Ga0207641_10003741
757 Ga0207648_10000009
758 Ga0207676_10000543
759 Ga0207674_10007563
760 Ga0207674_10051922
761 Ga0207674_10288219
762 Ga0207674_10883461
763 Ga0207675_100000269
764 Ga0207683_10010449
765 Ga0207698_10000214
766 Ga0207698_10000517
767 Ga0207698_11838078
768 Ga0268266_10000025
769 Ga0268266_10000786
770 Ga0268266_10563811
771 Ga0268266_11997772
772 Ga0268265_10000857
773 Ga0268265_10011964
774 Ga0268264_10000037
775 Ga0268264_10026356
776 Ga0268264_10339623
777 Ga0307515_10022792
778 Ga0307515_10097015
779 Ga0307515_10484154
780 Ga0307408_100553105
781 Ga0395900_1041023
782 Ga0395898_0493518
783 Ga0395905_0021618
784 Ga0395905_0033281
785 Ga0395905_0073682
786 Ga0395905_0869849
787 Ga0395905_1023390
788 Ga0395901_0732031
789 Ga0436360_0368092
790 Ga0436363_0375573
791 Ga0436363_0767973
792 Ga0451793_0148664
793 Ga0451795_1346752
794 Ga0451800_0059754
795 Ga0451800_0921903
796 Ga0451802_1033503
797 Ga0451806_638530
798 Ga0451807_2656061
799 Ga0451807_2727727
800 Ga0451835_0321962
801 Ga0439448_0040601
802 Ga0439458_0000511
803 Ga0466969_0096795
804 Ga0466972_0003556
805 Ga0466972_0006929
806 Ga0466972_0164235
807 Ga0466972_0524614
808 Ga0466965_0073588
809 Ga0466965_0167154
810 Ga0466966_0135432
811 Ga0466966_0651385
812 Ga0466961_0024942
813 Ga0466961_0054582
814 Ga0466961_0092604
815 Ga0466963_0002708
816 Ga0466964_0009890
817 Ga0466964_0127541
818 Ga0466971_0459672
819 Ga0466968_0008225
820 Ga0466970_0002986
821 Ga0466970_0442842
822 Ga0466970_0571185
823 Ga0466957_0024106
824 Ga0466957_0600483
825 Ga0466957_0852558
826 Ga0466960_0000882
827 Ga0466960_0043444
828 Ga0466959_0002648
829 Ga0466959_0234089
830 Ga0466958_0051617
831 Ga0466958_0145865
832 Ga0466958_0173934
833 Ga0466958_0496544
834 Ga0466967_0028322
835 Ga0466967_0491158
836 Ga0495638_0000079
837 Ga0495650_0320613
838 Ga0495637_0194148
839 Ga0495625_0000011
840 Ga0495625_0000540
841 Ga0495670_0733968
842 Ga0495686_0000063
843 Ga0495686_0002693
844 Ga0495686_0035608
845 Ga0495686_0257493
846 Ga0495686_0644647
847 Ga0496100_0207865
848 Ga0496102_0016435
849 Ga0496103_0001592
850 Ga0496104_0092957
851 Ga0496104_1587655
852 Ga0496105_0519234
853 Ga0496106_1039410
854 Ga0496107_0079643
855 Ga0496111_0049630
856 Ga0496111_0123926
857 Ga0496113_1330030
858 Ga0496116_0045208
859 Ga0496116_0054785
860 Ga0496117_0006506
861 Ga0496117_0016292
862 Ga0496117_0125542
863 Ga0496118_0005131
864 Ga0496118_0023725
865 Ga0496118_0052053
866 Ga0496118_0071366
867 Ga0496118_0491249
868 Ga0496118_0583197
869 Ga0496119_0048614
870 Ga0496119_0189633
871 Ga0496120_0174141
872 Ga0496120_0241137
873 Ga0496121_0009254
874 Ga0496121_0022230
875 Ga0496121_0108220
876 Ga0496121_0532940
877 Ga0496122_0009724
878 Ga0496122_0184187
879 Ga0496122_0399401
880 Ga0496123_0004885
881 Ga0496123_0014406
882 Ga0496123_0070838
883 Ga0496124_0010035
884 Ga0496124_0032741
885 Ga0496124_0194849
886 Ga0496125_0086672
887 Ga0496125_0133202
888 Ga0496125_0158520
889 Ga0496126_0299937
890 Ga0496126_0843752
891 Ga0501032_0247862
892 Ga0501034_1323052
893 Ga0501036_1443366
894 Ga0501043_0027205
895 Ga0501047_0051984
896 Ga0501047_0340033
897 Ga0501048_0208455
898 Ga0501080_0270008
899 Ga0501035_0015019
900 Ga0501035_0111523
901 Ga0501035_0810321
902 Ga0501044_0080145
903 Ga0501044_0415910
904 nmdc:mga03683_305617_c1
905 Ga0500643_000004
906 Ga0500562_080707
907 Ga0500608_275492
908 Ga0500618_101575
909 Ga0500559_0056852
910 Ga0500588_0074973
911 Ga0500616_0402483
912 Ga0500622_0015836
913 Ga0500622_0183944
914 Ga0500645_081888
915 Ga0466962_0020400
916 Ga0466962_0061594
917 Ga0466962_0262681
918 643823332

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

31

114

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lxf-assembly1.cif.gz_A crystal structure of [2fe-2s] ferredoxin arx from novosphingobium aromaticivorans 0.9897 3 105
3lxf-assembly1.cif.gz_A crystal structure of [2fe-2s] ferredoxin arx from novosphingobium aromaticivorans 0.971 3 105
2y5c-assembly2.cif.gz_B structure of human ferredoxin 2 (fdx2)in complex with 2fe2s cluster 0.963 2 101
4ltu-assembly2.cif.gz_B crystal structure of ferredoxin from rhodopseudomonas palustris haa2 0.9401 2 105
6nbl-assembly2.cif.gz_D cytochrome p450cam-putidaredoxin complex bound to camphor and cyanide 0.9387 1 101
ID Description Score Start End Superfamily
3lxfB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9887 3 105 3.10.20.30
3lxfB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.97 3 105 3.10.20.30
af_Q9CPW2_55_168_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9592 2 101 3.10.20.30
af_F1Q9K0_294_407_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.9591 3 15 3.30.1050.10
af_A4I234_54_172_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9483 2 101 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A7W9AQJ6-F1-model_v4 2Fe-2S ferredoxin 0.9898 1 105 GO:0009055
GO:0051537
GO:0140647
AF-Q2G8A3-F1-model_v4 Ferredoxin 0.989 1 105 GO:0009055
GO:0046872
GO:0051537
GO:0140647
AF-A0A419TFV9-F1-model_v4 deleted 0.9889 2 105
AF-A0A0H0XV86-F1-model_v4 Ferredoxin 0.9886 1 105 GO:0009055
GO:0051537
GO:0140647
AF-X5CWH9-F1-model_v4 Chloroacetanilide N-alkylformylase 2, ferredoxin component (Ferredoxin CndB2) 0.9863 1 105 GO:0009055
GO:0046872
GO:0051537
GO:0140647

Map