F448350

General Info

Members Datasets Scaffolds Average Seq Length
459 176 918 393

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10027715|Ga0105242_100277153
Length 437
Sequence MVHWDHAVPITLFAAALELQAITGVSRRVIMRAVQATIFLALAACGAATASSDPPFTMTEVTTFDSPWAMDFLPGSGVPMTTISLVTEKLGRIWLIDVTSGQKRRVAGAPTVVVSSQGGLLDIVAAPSFAGDQMVYLTYSEPSRNGGSGLALARARLVDMASAPRLEGFTVLWHDPEGGEGGQFGAKIAFAPDGQSLFLSSGERQRFTPAQDPSQPLGKILHLTLDGKPAPGNPFAGRTGAATVEITDPPRDTEAAKRTSGRRFTWPGPNLTPAETWTTGHRNPYGLVFAPDGRLWEHEMGPRGGDEVNLILPGRNYGWPNASNGDNYDGVNIPDHRPGDGYEPPKLWWNPSVSPAGMIIYTGDLFPQWKGDALLGALSGEAFIHVRIRGDQASKADQWDMGHRIREVAQGPRGEVYLLEDGPGARLLRLEPVQARR

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
136 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
153 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
154 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
170 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
171 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
172 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
173 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 5.23
Rhizosphere 94.12
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10027715 3300009176 Bacteria 4502
2 JGI24739J22299_10000896 3300001989 Bacteria 11013
3 JGI24739J22299_10002192 3300001989 Bacteria 7504
4 JGI24737J22298_10000355 3300001990 Bacteria 15479
5 JGI24737J22298_10002452 3300001990 Bacteria 6605
6 JGI24743J22301_10009821 3300001991 Bacteria 1701
7 JGI24738J21930_10001455 3300002075 Bacteria 6579
8 Ga0065715_10017383 3300005293 Bacteria 2762
9 Ga0070658_10018716 3300005327 Bacteria 5548
10 Ga0070658_10044717 3300005327 Bacteria 3579
11 Ga0070658_10054025 3300005327 Bacteria 3261
12 Ga0070658_10173855 3300005327 Bacteria 1810
13 Ga0070676_10003754 3300005328 Bacteria 7960
14 Ga0070676_10050538 3300005328 Bacteria 2438
15 Ga0070683_100014682 3300005329 Bacteria 6860
16 Ga0070670_100001163 3300005331 Bacteria 20894
17 Ga0070670_100001372 3300005331 Bacteria 19498
18 Ga0070670_100005924 3300005331 Bacteria 10336
19 Ga0070670_100014519 3300005331 Bacteria 6763
20 Ga0068869_100000230 3300005334 Bacteria 29349
21 Ga0070666_10000415 3300005335 Bacteria 26514
22 Ga0070666_10047270 3300005335 Bacteria 2889
23 Ga0070680_100000964 3300005336 Bacteria 20348
24 Ga0070682_100041747 3300005337 Bacteria 2829
25 Ga0068868_100000422 3300005338 Bacteria 28550
26 Ga0068868_100013097 3300005338 Bacteria 6073
27 Ga0068868_100108376 3300005338 Bacteria 2254
28 Ga0070660_100006471 3300005339 Bacteria 8120
29 Ga0070660_100013529 3300005339 Bacteria 5855
30 Ga0070660_100016326 3300005339 Bacteria 5387
31 Ga0070660_100071303 3300005339 Bacteria 2712
32 Ga0070660_100102815 3300005339 Bacteria 2265
33 Ga0070661_100007469 3300005344 Bacteria 7538
34 Ga0070661_100007888 3300005344 Bacteria 7352
35 Ga0070661_100043299 3300005344 Bacteria 3288
36 Ga0070661_100049439 3300005344 Bacteria 3078
37 Ga0070661_100063287 3300005344 Bacteria 2717
38 Ga0070661_100063987 3300005344 Bacteria 2703
39 Ga0070661_100079889 3300005344 Bacteria 2414
40 Ga0070661_100131556 3300005344 Bacteria 1880
41 Ga0070661_100139394 3300005344 Bacteria 1827
42 Ga0070668_100026740 3300005347 Bacteria 4380
43 Ga0070668_100057450 3300005347 Bacteria 3007
44 Ga0070669_100005470 3300005353 Bacteria 9167
45 Ga0070669_100029950 3300005353 Bacteria 3925
46 Ga0070675_100076235 3300005354 Bacteria 2789
47 Ga0070675_100080125 3300005354 Bacteria 2722
48 Ga0070671_100003153 3300005355 Bacteria 12853
49 Ga0070671_100014587 3300005355 Bacteria 6355
50 Ga0070671_100088519 3300005355 Bacteria 2592
51 Ga0070674_100012671 3300005356 Bacteria 5184
52 Ga0070674_100113780 3300005356 Bacteria 1991
53 Ga0070673_100000535 3300005364 Bacteria 20475
54 Ga0070673_100013114 3300005364 Bacteria 5721
55 Ga0070673_100025088 3300005364 Bacteria 4382
56 Ga0070673_100088671 3300005364 Bacteria 2523
57 Ga0070673_100130008 3300005364 Bacteria 2111
58 Ga0070659_100001166 3300005366 Bacteria 19212
59 Ga0070659_100003728 3300005366 Bacteria 10871
60 Ga0070659_100005162 3300005366 Bacteria 9365
61 Ga0070659_100008765 3300005366 Bacteria 7403
62 Ga0070659_100015528 3300005366 Bacteria 5703
63 Ga0070659_100029792 3300005366 Bacteria 4219
64 Ga0070659_100033708 3300005366 Bacteria 3980
65 Ga0070659_100064318 3300005366 Bacteria 2903
66 Ga0070659_100077010 3300005366 Bacteria 2659
67 Ga0070659_100179504 3300005366 Unclassified 1737
68 Ga0070659_100219087 3300005366 Bacteria 1570
69 Ga0070659_100260939 3300005366 Bacteria 1437
70 Ga0070667_100000839 3300005367 Bacteria 28510
71 Ga0070667_100003869 3300005367 Bacteria 12711
72 Ga0070667_100008232 3300005367 Bacteria 8643
73 Ga0070667_100030466 3300005367 Bacteria 4500
74 Ga0070667_100031435 3300005367 Bacteria 4427
75 Ga0070667_100186331 3300005367 Bacteria 1837
76 Ga0070694_100056002 3300005444 Bacteria 2676
77 Ga0070663_100003687 3300005455 Bacteria 8884
78 Ga0070663_100016332 3300005455 Bacteria 4819
79 Ga0070663_100042839 3300005455 Bacteria 3183
80 Ga0070663_100057628 3300005455 Bacteria 2787
81 Ga0070663_100207181 3300005455 Bacteria 1533
82 Ga0070663_100291200 3300005455 Bacteria 1304
83 Ga0070678_100017109 3300005456 Bacteria 4658
84 Ga0070662_100000390 3300005457 Bacteria 26178
85 Ga0070662_100005999 3300005457 Bacteria 7794
86 Ga0070662_100019823 3300005457 Bacteria 4573
87 Ga0070662_100065050 3300005457 Bacteria 2672
88 Ga0070662_100098553 3300005457 Bacteria 2208
89 Ga0070681_10057986 3300005458 Bacteria 3852
90 Ga0068867_100046052 3300005459 Bacteria 3202
91 Ga0068867_100060922 3300005459 Bacteria 2801
92 Ga0070685_10038850 3300005466 Bacteria 2701
93 Ga0070706_100099671 3300005467 Bacteria 2699
94 Ga0070679_100183622 3300005530 Bacteria 2063
95 Ga0068853_100003747 3300005539 Bacteria 11661
96 Ga0068853_100011441 3300005539 Bacteria 7210
97 Ga0068853_100015106 3300005539 Bacteria 6348
98 Ga0070672_100001092 3300005543 Bacteria 16526
99 Ga0070672_100010946 3300005543 Bacteria 6311
100 Ga0070672_100035450 3300005543 Bacteria 3793
101 Ga0070696_100010477 3300005546 Bacteria 6214
102 Ga0070696_100020847 3300005546 Bacteria 4441
103 Ga0070665_100006029 3300005548 Bacteria 12385
104 Ga0070665_100008990 3300005548 Bacteria 10117
105 Ga0070665_100012284 3300005548 Bacteria 8633
106 Ga0070665_100130088 3300005548 Bacteria 2519
107 Ga0068855_100009251 3300005563 Bacteria 11904
108 Ga0068855_100099761 3300005563 Bacteria 3344
109 Ga0068855_100169163 3300005563 Bacteria 2476
110 Ga0068855_100282565 3300005563 Bacteria 1842
111 Ga0068855_100371137 3300005563 Bacteria 1573
112 Ga0070664_100010263 3300005564 Bacteria 7595
113 Ga0070664_100011056 3300005564 Bacteria 7319
114 Ga0070664_100041416 3300005564 Bacteria 3886
115 Ga0068857_100001454 3300005577 Bacteria 18809
116 Ga0068857_100077436 3300005577 Bacteria 2967
117 Ga0068854_100003625 3300005578 Bacteria 9661
118 Ga0068854_100008826 3300005578 Bacteria 6487
119 Ga0068854_100036659 3300005578 Bacteria 3439
120 Ga0068854_100101270 3300005578 Bacteria 2160
121 Ga0068856_100110440 3300005614 Bacteria 2746
122 Ga0068852_100006131 3300005616 Bacteria 8670
123 Ga0068852_100006390 3300005616 Bacteria 8512
124 Ga0068852_100025197 3300005616 Bacteria 4816
125 Ga0068852_100256609 3300005616 Bacteria 1677
126 Ga0068859_100009159 3300005617 Bacteria 9999
127 Ga0068859_100106230 3300005617 Bacteria 2867
128 Ga0068864_100000897 3300005618 Bacteria 25075
129 Ga0068864_100003357 3300005618 Bacteria 13232
130 Ga0068864_100119354 3300005618 Bacteria 2356
131 Ga0068866_10022734 3300005718 Bacteria 2906
132 Ga0068851_10002108 3300005834 Bacteria 8754
133 Ga0068851_10003322 3300005834 Bacteria 7151
134 Ga0068851_10094846 3300005834 Bacteria 1576
135 Ga0068863_100003418 3300005841 Bacteria 15652
136 Ga0068863_100093054 3300005841 Bacteria 2861
137 Ga0068863_100156568 3300005841 Bacteria 2181
138 Ga0068863_100199124 3300005841 Bacteria 1926
139 Ga0068858_100002839 3300005842 Bacteria 17420
140 Ga0068858_100013259 3300005842 Bacteria 7768
141 Ga0068858_100051155 3300005842 Bacteria 3822
142 Ga0068860_100017848 3300005843 Bacteria 6911
143 Ga0068862_100009190 3300005844 Bacteria 8185
144 Ga0068862_100010807 3300005844 Bacteria 7539
145 Ga0068862_100115736 3300005844 Bacteria 2358
146 Ga0068871_100038507 3300006358 Bacteria 3820
147 Ga0075433_10008969 3300006852 Bacteria 7985
148 Ga0068865_100020097 3300006881 Bacteria 4330
149 Ga0068865_100056468 3300006881 Bacteria 2735
150 Ga0097620_100009159 3300006931 Bacteria 9999
151 Ga0097620_100106217 3300006931 Bacteria 2867
152 Ga0111539_10182574 3300009094 Bacteria 2450
153 Ga0105245_10001947 3300009098 Bacteria 18731
154 Ga0105245_10023257 3300009098 Bacteria 5441
155 Ga0105241_10050349 3300009174 Bacteria 3174
156 Ga0105241_10332538 3300009174 Bacteria 1314
157 Ga0105248_10005736 3300009177 Bacteria 13632
158 Ga0105248_10006665 3300009177 Bacteria 12669
159 Ga0105248_10010146 3300009177 Bacteria 10375
160 Ga0105248_10023950 3300009177 Bacteria 6787
161 Ga0105248_10054079 3300009177 Bacteria 4503
162 Ga0105238_10334968 3300009551 Bacteria 1501
163 Ga0157373_10012534 3300013100 Bacteria 6233
164 Ga0157373_10030622 3300013100 Bacteria 3872
165 Ga0157371_10004528 3300013102 Bacteria 12107
166 Ga0157371_10015387 3300013102 Bacteria 5741
167 Ga0157371_10017377 3300013102 Bacteria 5346
168 Ga0157371_10058416 3300013102 Bacteria 2736
169 Ga0157371_10091710 3300013102 Bacteria 2152
170 Ga0157370_10014813 3300013104 Bacteria 7959
171 Ga0157370_10014824 3300013104 Bacteria 7955
172 Ga0157370_10164964 3300013104 Bacteria 2060
173 Ga0157369_10063379 3300013105 Bacteria 3983
174 Ga0157369_10199275 3300013105 Bacteria 2102
175 Ga0157374_10234051 3300013296 Bacteria 1805
176 Ga0163162_10047320 3300013306 Bacteria 4311
177 Ga0163162_10102055 3300013306 Bacteria 2961
178 Ga0163162_10119575 3300013306 Bacteria 2737
179 Ga0157372_10017067 3300013307 Bacteria 7793
180 Ga0157372_10053960 3300013307 Bacteria 4481
181 Ga0157372_10060124 3300013307 Bacteria 4251
182 Ga0157375_10009605 3300013308 Bacteria 8498
183 Ga0157375_10015975 3300013308 Bacteria 6734
184 Ga0157375_10066674 3300013308 Bacteria 3595
185 Ga0163163_10016002 3300014325 Bacteria 6953
186 Ga0182008_10047749 3300014497 Bacteria 2127
187 Ga0157377_10019876 3300014745 Bacteria 3512
188 Ga0157379_10006760 3300014968 Bacteria 9912
189 Ga0163161_10018076 3300017792 Bacteria 4942
190 Ga0163161_10194802 3300017792 Bacteria 1559
191 Ga0206353_10979833 3300020082 Bacteria 6831
192 Ga0206353_12000926 3300020082 Bacteria 1514
193 Ga0213876_10001602 3300021384 Bacteria 13897
194 Ga0207697_10000082 3300025315 Bacteria 41919
195 Ga0207656_10002169 3300025321 Bacteria 6561
196 Ga0207656_10005490 3300025321 Bacteria 4485
197 Ga0207656_10056869 3300025321 Bacteria 1706
198 Ga0207682_10008546 3300025893 Bacteria 4047
199 Ga0207688_10010330 3300025901 Bacteria 5083
200 Ga0207688_10026523 3300025901 Bacteria 3187
201 Ga0207680_10003929 3300025903 Bacteria 7013
202 Ga0207647_10000259 3300025904 Bacteria 43433
203 Ga0207647_10001197 3300025904 Bacteria 19985
204 Ga0207647_10006343 3300025904 Bacteria 8599
205 Ga0207647_10024034 3300025904 Bacteria 4021
206 Ga0207647_10024665 3300025904 Bacteria 3964
207 Ga0207647_10078381 3300025904 Bacteria 1984
208 Ga0207645_10004794 3300025907 Bacteria 9945
209 Ga0207645_10005506 3300025907 Bacteria 9171
210 Ga0207645_10012333 3300025907 Bacteria 5800
211 Ga0207705_10001757 3300025909 Bacteria 17137
212 Ga0207705_10003507 3300025909 Bacteria 11945
213 Ga0207705_10004492 3300025909 Bacteria 10547
214 Ga0207705_10013036 3300025909 Bacteria 5999
215 Ga0207705_10014119 3300025909 Bacteria 5754
216 Ga0207705_10097109 3300025909 Bacteria 2163
217 Ga0207654_10045277 3300025911 Bacteria 2503
218 Ga0207660_10005206 3300025917 Bacteria 8449
219 Ga0207660_10081688 3300025917 Bacteria 2376
220 Ga0207657_10004090 3300025919 Bacteria 15484
221 Ga0207657_10005407 3300025919 Bacteria 13349
222 Ga0207657_10007346 3300025919 Bacteria 11302
223 Ga0207657_10009532 3300025919 Bacteria 9747
224 Ga0207657_10022656 3300025919 Bacteria 5870
225 Ga0207657_10023441 3300025919 Bacteria 5746
226 Ga0207657_10026457 3300025919 Bacteria 5332
227 Ga0207657_10048167 3300025919 Bacteria 3722
228 Ga0207657_10063109 3300025919 Bacteria 3169
229 Ga0207657_10238220 3300025919 Bacteria 1453
230 Ga0207649_10008031 3300025920 Bacteria 5744
231 Ga0207649_10020644 3300025920 Bacteria 3780
232 Ga0207649_10039258 3300025920 Bacteria 2869
233 Ga0207649_10098787 3300025920 Bacteria 1927
234 Ga0207652_10037726 3300025921 Bacteria 4091
235 Ga0207652_10053540 3300025921 Bacteria 3466
236 Ga0207652_10172858 3300025921 Bacteria 1939
237 Ga0207681_10036194 3300025923 Bacteria 3255
238 Ga0207694_10166385 3300025924 Bacteria 1784
239 Ga0207650_10006173 3300025925 Bacteria 8167
240 Ga0207650_10013303 3300025925 Bacteria 5695
241 Ga0207650_10070129 3300025925 Bacteria 2634
242 Ga0207650_10210257 3300025925 Bacteria 1562
243 Ga0207659_10008343 3300025926 Bacteria 6425
244 Ga0207659_10012771 3300025926 Bacteria 5362
245 Ga0207659_10186659 3300025926 Bacteria 1647
246 Ga0207687_10004833 3300025927 Bacteria 8958
247 Ga0207644_10021843 3300025931 Bacteria 4364
248 Ga0207644_10146045 3300025931 Bacteria 1826
249 Ga0207644_10163551 3300025931 Bacteria 1732
250 Ga0207644_10280132 3300025931 Bacteria 1338
251 Ga0207690_10002779 3300025932 Bacteria 10573
252 Ga0207690_10005828 3300025932 Bacteria 7288
253 Ga0207690_10017238 3300025932 Bacteria 4406
254 Ga0207690_10019258 3300025932 Bacteria 4199
255 Ga0207690_10166565 3300025932 Bacteria 1647
256 Ga0207690_10197928 3300025932 Bacteria 1524
257 Ga0207706_10001125 3300025933 Bacteria 27208
258 Ga0207706_10001143 3300025933 Bacteria 27029
259 Ga0207706_10009502 3300025933 Bacteria 8930
260 Ga0207706_10012300 3300025933 Bacteria 7798
261 Ga0207706_10033985 3300025933 Bacteria 4538
262 Ga0207706_10063239 3300025933 Bacteria 3258
263 Ga0207706_10084961 3300025933 Bacteria 2782
264 Ga0207706_10154243 3300025933 Bacteria 2020
265 Ga0207706_10252564 3300025933 Bacteria 1540
266 Ga0207704_10051062 3300025938 Bacteria 2498
267 Ga0207691_10002508 3300025940 Bacteria 17963
268 Ga0207691_10012489 3300025940 Bacteria 8144
269 Ga0207691_10020214 3300025940 Bacteria 6297
270 Ga0207691_10091590 3300025940 Bacteria 2724
271 Ga0207711_10000372 3300025941 Bacteria 47656
272 Ga0207711_10003496 3300025941 Bacteria 13599
273 Ga0207711_10022438 3300025941 Bacteria 5278
274 Ga0207711_10138639 3300025941 Bacteria 2187
275 Ga0207711_10327764 3300025941 Bacteria 1416
276 Ga0207689_10000561 3300025942 Bacteria 35545
277 Ga0207689_10014133 3300025942 Bacteria 6794
278 Ga0207689_10063521 3300025942 Bacteria 3038
279 Ga0207661_10068763 3300025944 Bacteria 2885
280 Ga0207679_10028285 3300025945 Bacteria 3887
281 Ga0207679_10034202 3300025945 Bacteria 3583
282 Ga0207679_10039982 3300025945 Bacteria 3353
283 Ga0207679_10072053 3300025945 Bacteria 2609
284 Ga0207679_10091640 3300025945 Bacteria 2352
285 Ga0207667_10024070 3300025949 Bacteria 6696
286 Ga0207667_10026875 3300025949 Bacteria 6279
287 Ga0207667_10031787 3300025949 Bacteria 5695
288 Ga0207651_10001237 3300025960 Bacteria 11474
289 Ga0207651_10067087 3300025960 Bacteria 2523
290 Ga0207712_10001096 3300025961 Bacteria 18922
291 Ga0207668_10000173 3300025972 Bacteria 44042
292 Ga0207668_10032287 3300025972 Bacteria 3458
293 Ga0207668_10138031 3300025972 Bacteria 1871
294 Ga0207640_10001178 3300025981 Bacteria 14315
295 Ga0207640_10017236 3300025981 Bacteria 4221
296 Ga0207658_10004516 3300025986 Bacteria 9669
297 Ga0207658_10004820 3300025986 Bacteria 9331
298 Ga0207658_10007832 3300025986 Bacteria 7276
299 Ga0207658_10028679 3300025986 Bacteria 3922
300 Ga0207658_10269720 3300025986 Bacteria 1454
301 Ga0207677_10000701 3300026023 Bacteria 19894
302 Ga0207677_10014000 3300026023 Bacteria 4668
303 Ga0207677_10139729 3300026023 Bacteria 1852
304 Ga0207703_10002334 3300026035 Bacteria 16550
305 Ga0207703_10005468 3300026035 Bacteria 10214
306 Ga0207703_10013406 3300026035 Bacteria 6388
307 Ga0207639_10058930 3300026041 Bacteria 2956
308 Ga0207639_10093416 3300026041 Bacteria 2412
309 Ga0207639_10172263 3300026041 Bacteria 1834
310 Ga0207678_10000918 3300026067 Bacteria 26949
311 Ga0207678_10008666 3300026067 Bacteria 8957
312 Ga0207678_10011162 3300026067 Bacteria 7890
313 Ga0207678_10184399 3300026067 Bacteria 1782
314 Ga0207702_10005348 3300026078 Bacteria 11256
315 Ga0207702_10102485 3300026078 Bacteria 2529
316 Ga0207702_10130619 3300026078 Bacteria 2260
317 Ga0207641_10023867 3300026088 Bacteria 5041
318 Ga0207641_10035574 3300026088 Bacteria 4150
319 Ga0207648_10006008 3300026089 Bacteria 12124
320 Ga0207648_10007119 3300026089 Bacteria 11033
321 Ga0207648_10018823 3300026089 Bacteria 6242
322 Ga0207676_10005455 3300026095 Bacteria 9002
323 Ga0207676_10046743 3300026095 Bacteria 3351
324 Ga0207676_10099267 3300026095 Bacteria 2409
325 Ga0207674_10002348 3300026116 Bacteria 23924
326 Ga0207674_10002685 3300026116 Bacteria 22206
327 Ga0207674_10003442 3300026116 Bacteria 19365
328 Ga0207674_10007396 3300026116 Bacteria 12796
329 Ga0207674_10025349 3300026116 Bacteria 6326
330 Ga0207698_10002330 3300026142 Bacteria 11245
331 Ga0207698_10020110 3300026142 Bacteria 4589
332 Ga0207698_10026263 3300026142 Bacteria 4117
333 Ga0207698_10042045 3300026142 Bacteria 3411
334 Ga0207698_10203649 3300026142 Bacteria 1774
335 Ga0207698_10319800 3300026142 Bacteria 1453
336 Ga0268266_10000458 3300028379 Bacteria 59553
337 Ga0268266_10031622 3300028379 Bacteria 4495
338 Ga0268265_10005889 3300028380 Bacteria 8352
339 Ga0268265_10008593 3300028380 Bacteria 6903
340 Ga0268265_10016311 3300028380 Bacteria 5100
341 Ga0268265_10073944 3300028380 Bacteria 2663
342 Ga0268265_10149402 3300028380 Bacteria 1968
343 Ga0268265_10250882 3300028380 Bacteria 1567
344 Ga0268264_10007507 3300028381 Bacteria 9098
345 Ga0268264_10009772 3300028381 Bacteria 7941
346 Ga0307408_100090338 3300031548 Bacteria 2311
347 Ga0307408_100180051 3300031548 Bacteria 1694
348 Ga0307405_10034583 3300031731 Bacteria 3008
349 Ga0307405_10068529 3300031731 Bacteria 2270
350 Ga0307405_10092202 3300031731 Bacteria 2009
351 Ga0307405_10295666 3300031731 Bacteria 1226
352 Ga0307413_10173119 3300031824 Bacteria 1530
353 Ga0307410_10006140 3300031852 Bacteria 6447
354 Ga0307410_10008279 3300031852 Bacteria 5758
355 Ga0307410_10018490 3300031852 Bacteria 4212
356 Ga0307410_10059899 3300031852 Bacteria 2600
357 Ga0307410_10071971 3300031852 Bacteria 2399
358 Ga0307406_10016682 3300031901 Bacteria 4274
359 Ga0307406_10033944 3300031901 Bacteria 3127
360 Ga0307406_10040825 3300031901 Bacteria 2888
361 Ga0307406_10069102 3300031901 Bacteria 2308
362 Ga0307406_10109044 3300031901 Bacteria 1902
363 Ga0307406_10117915 3300031901 Bacteria 1840
364 Ga0307406_10138428 3300031901 Bacteria 1719
365 Ga0307407_10003352 3300031903 Bacteria 6551
366 Ga0307407_10012720 3300031903 Bacteria 4057
367 Ga0307407_10066135 3300031903 Bacteria 2131
368 Ga0307407_10133150 3300031903 Bacteria 1593
369 Ga0307412_10021894 3300031911 Bacteria 3910
370 Ga0307412_10034320 3300031911 Bacteria 3233
371 Ga0307412_10043303 3300031911 Bacteria 2930
372 Ga0307409_100012874 3300031995 Bacteria 5352
373 Ga0307409_100018009 3300031995 Bacteria 4729
374 Ga0307409_100024765 3300031995 Bacteria 4193
375 Ga0307409_100170871 3300031995 Bacteria 1913
376 Ga0307409_100241628 3300031995 Bacteria 1644
377 Ga0307409_100300250 3300031995 Bacteria 1493
378 Ga0307416_100017755 3300032002 Bacteria 4989
379 Ga0307416_100026509 3300032002 Bacteria 4272
380 Ga0307416_100046811 3300032002 Bacteria 3417
381 Ga0307416_100457480 3300032002 Bacteria 1330
382 Ga0307414_10005643 3300032004 Bacteria 6906
383 Ga0307414_10120590 3300032004 Bacteria 2015
384 Ga0307411_10003870 3300032005 Bacteria 7051
385 Ga0307411_10008092 3300032005 Bacteria 5419
386 Ga0307411_10140771 3300032005 Bacteria 1779
387 Ga0307411_10192750 3300032005 Bacteria 1557
388 Ga0307411_10203357 3300032005 Bacteria 1523
389 Ga0307415_100026146 3300032126 Bacteria 3677
390 Ga0307415_100265170 3300032126 Bacteria 1404
391 Ga0373956_0049587 3300035119 Bacteria 1883
392 Ga0373957_0014278 3300035120 Bacteria 2712
393 Ga0373955_0049101 3300035172 Bacteria 2290
394 Ga0373937_0069731 3300036401 Bacteria 3241
395 Ga0395899_0187529 3300037312 Bacteria 1448
396 Ga0395900_0078211 3300037418 Bacteria 3399
397 Ga0395900_0141799 3300037418 Bacteria 2460
398 Ga0395900_0306881 3300037418 Bacteria 1571
399 Ga0395900_0336621 3300037418 Bacteria 1486
400 Ga0395898_0054987 3300037466 Bacteria 3883
401 Ga0395905_0012839 3300037471 Bacteria 8051
402 Ga0395905_0014010 3300037471 Bacteria 7669
403 Ga0395905_0018295 3300037471 Bacteria 6651
404 Ga0395905_0052332 3300037471 Bacteria 3822
405 Ga0395905_0127109 3300037471 Bacteria 2397
406 Ga0395905_0237208 3300037471 Bacteria 1705
407 Ga0395905_0257704 3300037471 Bacteria 1629
408 Ga0395901_0023308 3300038443 Bacteria 6344
409 Ga0395901_0060208 3300038443 Bacteria 3951
410 Ga0395901_0149146 3300038443 Bacteria 2457
411 Ga0436365_1595987 3300039437 Bacteria 26536
412 Ga0450889_000681 3300042144 Bacteria 3732
413 Ga0495585_0109549 3300046492 Unclassified 1470
414 Ga0495621_0011252 3300046539 Bacteria 2762
415 Ga0495621_0013166 3300046539 Bacteria 2594
416 Ga0495633_0021952 3300046558 Bacteria 3185
417 Ga0495668_0014558 3300046616 Bacteria 4607
418 Ga0495661_0034543 3300046665 Bacteria 3181
419 Ga0495623_0070556 3300046679 Bacteria 2176
420 Ga0495669_0001085 3300046684 Bacteria 11270
421 Ga0495669_0002396 3300046684 Bacteria 7693
422 Ga0495669_0007261 3300046684 Bacteria 4641
423 Ga0495669_0012749 3300046684 Bacteria 3578
424 Ga0495669_0066874 3300046684 Bacteria 1633
425 Ga0495670_0076696 3300046691 Bacteria 1698
426 Ga0495677_0030656 3300047445 Bacteria 1957
427 Ga0495602_0018640 3300048088 Bacteria 6922
428 Ga0496101_0091809 3300048904 Bacteria 2260
429 Ga0496101_0120868 3300048904 Bacteria 1980
430 Ga0496101_0168776 3300048904 Bacteria 1681
431 Ga0496102_0029725 3300048905 Bacteria 4890
432 Ga0496102_0042910 3300048905 Bacteria 4099
433 Ga0496104_0046407 3300048907 Bacteria 4092
434 Ga0496105_0106281 3300048908 Bacteria 2317
435 Ga0496106_0236999 3300048909 Bacteria 1458
436 Ga0496107_0131105 3300048910 Bacteria 1851
437 Ga0496108_0002625 3300048911 Bacteria 14400
438 Ga0496108_0018888 3300048911 Bacteria 5652
439 Ga0496108_0022850 3300048911 Bacteria 5146
440 Ga0496109_0006273 3300048912 Bacteria 10003
441 Ga0496109_0029672 3300048912 Bacteria 4900
442 Ga0496109_0142424 3300048912 Bacteria 2242
443 Ga0496110_0003604 3300048913 Bacteria 11911
444 Ga0496110_0004039 3300048913 Bacteria 11323
445 Ga0496110_0092851 3300048913 Bacteria 2701
446 Ga0496111_0000244 3300048914 Bacteria 26061
447 Ga0496111_0135458 3300048914 Bacteria 1824
448 Ga0496112_0071593 3300048915 Bacteria 3426
449 Ga0496112_0346020 3300048915 Bacteria 1429
450 Ga0496113_0000515 3300048916 Bacteria 19121
451 Ga0496115_0009364 3300048918 Bacteria 7275
452 Ga0501207_010280 3300049654 Bacteria 1378
453 Ga0501223_031851 3300049663 Bacteria 1026
454 Ga0501224_006763 3300049664 Bacteria 1665
455 Ga0501235_013329 3300049669 Bacteria 1810
456 nmdc:mga03683_69094_c1 3300050489 Bacteria 1506
457 nmdc:mga0rr50_412834_c1 3300050513 Bacteria 1141
458 nmdc:mga0a205_10273_c1 3300050515 Bacteria 8600
459 Ga0495655_0002522 3300053083 Bacteria 2919
460 Ga0105242_10027715
461 JGI24739J22299_10000896
462 JGI24739J22299_10002192
463 JGI24737J22298_10000355
464 JGI24737J22298_10002452
465 JGI24743J22301_10009821
466 JGI24738J21930_10001455
467 Ga0065715_10017383
468 Ga0070658_10018716
469 Ga0070658_10044717
470 Ga0070658_10054025
471 Ga0070658_10173855
472 Ga0070676_10003754
473 Ga0070676_10050538
474 Ga0070683_100014682
475 Ga0070670_100001163
476 Ga0070670_100001372
477 Ga0070670_100005924
478 Ga0070670_100014519
479 Ga0068869_100000230
480 Ga0070666_10000415
481 Ga0070666_10047270
482 Ga0070680_100000964
483 Ga0070682_100041747
484 Ga0068868_100000422
485 Ga0068868_100013097
486 Ga0068868_100108376
487 Ga0070660_100006471
488 Ga0070660_100013529
489 Ga0070660_100016326
490 Ga0070660_100071303
491 Ga0070660_100102815
492 Ga0070661_100007469
493 Ga0070661_100007888
494 Ga0070661_100043299
495 Ga0070661_100049439
496 Ga0070661_100063287
497 Ga0070661_100063987
498 Ga0070661_100079889
499 Ga0070661_100131556
500 Ga0070661_100139394
501 Ga0070668_100026740
502 Ga0070668_100057450
503 Ga0070669_100005470
504 Ga0070669_100029950
505 Ga0070675_100076235
506 Ga0070675_100080125
507 Ga0070671_100003153
508 Ga0070671_100014587
509 Ga0070671_100088519
510 Ga0070674_100012671
511 Ga0070674_100113780
512 Ga0070673_100000535
513 Ga0070673_100013114
514 Ga0070673_100025088
515 Ga0070673_100088671
516 Ga0070673_100130008
517 Ga0070659_100001166
518 Ga0070659_100003728
519 Ga0070659_100005162
520 Ga0070659_100008765
521 Ga0070659_100015528
522 Ga0070659_100029792
523 Ga0070659_100033708
524 Ga0070659_100064318
525 Ga0070659_100077010
526 Ga0070659_100179504
527 Ga0070659_100219087
528 Ga0070659_100260939
529 Ga0070667_100000839
530 Ga0070667_100003869
531 Ga0070667_100008232
532 Ga0070667_100030466
533 Ga0070667_100031435
534 Ga0070667_100186331
535 Ga0070694_100056002
536 Ga0070663_100003687
537 Ga0070663_100016332
538 Ga0070663_100042839
539 Ga0070663_100057628
540 Ga0070663_100207181
541 Ga0070663_100291200
542 Ga0070678_100017109
543 Ga0070662_100000390
544 Ga0070662_100005999
545 Ga0070662_100019823
546 Ga0070662_100065050
547 Ga0070662_100098553
548 Ga0070681_10057986
549 Ga0068867_100046052
550 Ga0068867_100060922
551 Ga0070685_10038850
552 Ga0070706_100099671
553 Ga0070679_100183622
554 Ga0068853_100003747
555 Ga0068853_100011441
556 Ga0068853_100015106
557 Ga0070672_100001092
558 Ga0070672_100010946
559 Ga0070672_100035450
560 Ga0070696_100010477
561 Ga0070696_100020847
562 Ga0070665_100006029
563 Ga0070665_100008990
564 Ga0070665_100012284
565 Ga0070665_100130088
566 Ga0068855_100009251
567 Ga0068855_100099761
568 Ga0068855_100169163
569 Ga0068855_100282565
570 Ga0068855_100371137
571 Ga0070664_100010263
572 Ga0070664_100011056
573 Ga0070664_100041416
574 Ga0068857_100001454
575 Ga0068857_100077436
576 Ga0068854_100003625
577 Ga0068854_100008826
578 Ga0068854_100036659
579 Ga0068854_100101270
580 Ga0068856_100110440
581 Ga0068852_100006131
582 Ga0068852_100006390
583 Ga0068852_100025197
584 Ga0068852_100256609
585 Ga0068859_100009159
586 Ga0068859_100106230
587 Ga0068864_100000897
588 Ga0068864_100003357
589 Ga0068864_100119354
590 Ga0068866_10022734
591 Ga0068851_10002108
592 Ga0068851_10003322
593 Ga0068851_10094846
594 Ga0068863_100003418
595 Ga0068863_100093054
596 Ga0068863_100156568
597 Ga0068863_100199124
598 Ga0068858_100002839
599 Ga0068858_100013259
600 Ga0068858_100051155
601 Ga0068860_100017848
602 Ga0068862_100009190
603 Ga0068862_100010807
604 Ga0068862_100115736
605 Ga0068871_100038507
606 Ga0075433_10008969
607 Ga0068865_100020097
608 Ga0068865_100056468
609 Ga0097620_100009159
610 Ga0097620_100106217
611 Ga0111539_10182574
612 Ga0105245_10001947
613 Ga0105245_10023257
614 Ga0105241_10050349
615 Ga0105241_10332538
616 Ga0105248_10005736
617 Ga0105248_10006665
618 Ga0105248_10010146
619 Ga0105248_10023950
620 Ga0105248_10054079
621 Ga0105238_10334968
622 Ga0157373_10012534
623 Ga0157373_10030622
624 Ga0157371_10004528
625 Ga0157371_10015387
626 Ga0157371_10017377
627 Ga0157371_10058416
628 Ga0157371_10091710
629 Ga0157370_10014813
630 Ga0157370_10014824
631 Ga0157370_10164964
632 Ga0157369_10063379
633 Ga0157369_10199275
634 Ga0157374_10234051
635 Ga0163162_10047320
636 Ga0163162_10102055
637 Ga0163162_10119575
638 Ga0157372_10017067
639 Ga0157372_10053960
640 Ga0157372_10060124
641 Ga0157375_10009605
642 Ga0157375_10015975
643 Ga0157375_10066674
644 Ga0163163_10016002
645 Ga0182008_10047749
646 Ga0157377_10019876
647 Ga0157379_10006760
648 Ga0163161_10018076
649 Ga0163161_10194802
650 Ga0206353_10979833
651 Ga0206353_12000926
652 Ga0213876_10001602
653 Ga0207697_10000082
654 Ga0207656_10002169
655 Ga0207656_10005490
656 Ga0207656_10056869
657 Ga0207682_10008546
658 Ga0207688_10010330
659 Ga0207688_10026523
660 Ga0207680_10003929
661 Ga0207647_10000259
662 Ga0207647_10001197
663 Ga0207647_10006343
664 Ga0207647_10024034
665 Ga0207647_10024665
666 Ga0207647_10078381
667 Ga0207645_10004794
668 Ga0207645_10005506
669 Ga0207645_10012333
670 Ga0207705_10001757
671 Ga0207705_10003507
672 Ga0207705_10004492
673 Ga0207705_10013036
674 Ga0207705_10014119
675 Ga0207705_10097109
676 Ga0207654_10045277
677 Ga0207660_10005206
678 Ga0207660_10081688
679 Ga0207657_10004090
680 Ga0207657_10005407
681 Ga0207657_10007346
682 Ga0207657_10009532
683 Ga0207657_10022656
684 Ga0207657_10023441
685 Ga0207657_10026457
686 Ga0207657_10048167
687 Ga0207657_10063109
688 Ga0207657_10238220
689 Ga0207649_10008031
690 Ga0207649_10020644
691 Ga0207649_10039258
692 Ga0207649_10098787
693 Ga0207652_10037726
694 Ga0207652_10053540
695 Ga0207652_10172858
696 Ga0207681_10036194
697 Ga0207694_10166385
698 Ga0207650_10006173
699 Ga0207650_10013303
700 Ga0207650_10070129
701 Ga0207650_10210257
702 Ga0207659_10008343
703 Ga0207659_10012771
704 Ga0207659_10186659
705 Ga0207687_10004833
706 Ga0207644_10021843
707 Ga0207644_10146045
708 Ga0207644_10163551
709 Ga0207644_10280132
710 Ga0207690_10002779
711 Ga0207690_10005828
712 Ga0207690_10017238
713 Ga0207690_10019258
714 Ga0207690_10166565
715 Ga0207690_10197928
716 Ga0207706_10001125
717 Ga0207706_10001143
718 Ga0207706_10009502
719 Ga0207706_10012300
720 Ga0207706_10033985
721 Ga0207706_10063239
722 Ga0207706_10084961
723 Ga0207706_10154243
724 Ga0207706_10252564
725 Ga0207704_10051062
726 Ga0207691_10002508
727 Ga0207691_10012489
728 Ga0207691_10020214
729 Ga0207691_10091590
730 Ga0207711_10000372
731 Ga0207711_10003496
732 Ga0207711_10022438
733 Ga0207711_10138639
734 Ga0207711_10327764
735 Ga0207689_10000561
736 Ga0207689_10014133
737 Ga0207689_10063521
738 Ga0207661_10068763
739 Ga0207679_10028285
740 Ga0207679_10034202
741 Ga0207679_10039982
742 Ga0207679_10072053
743 Ga0207679_10091640
744 Ga0207667_10024070
745 Ga0207667_10026875
746 Ga0207667_10031787
747 Ga0207651_10001237
748 Ga0207651_10067087
749 Ga0207712_10001096
750 Ga0207668_10000173
751 Ga0207668_10032287
752 Ga0207668_10138031
753 Ga0207640_10001178
754 Ga0207640_10017236
755 Ga0207658_10004516
756 Ga0207658_10004820
757 Ga0207658_10007832
758 Ga0207658_10028679
759 Ga0207658_10269720
760 Ga0207677_10000701
761 Ga0207677_10014000
762 Ga0207677_10139729
763 Ga0207703_10002334
764 Ga0207703_10005468
765 Ga0207703_10013406
766 Ga0207639_10058930
767 Ga0207639_10093416
768 Ga0207639_10172263
769 Ga0207678_10000918
770 Ga0207678_10008666
771 Ga0207678_10011162
772 Ga0207678_10184399
773 Ga0207702_10005348
774 Ga0207702_10102485
775 Ga0207702_10130619
776 Ga0207641_10023867
777 Ga0207641_10035574
778 Ga0207648_10006008
779 Ga0207648_10007119
780 Ga0207648_10018823
781 Ga0207676_10005455
782 Ga0207676_10046743
783 Ga0207676_10099267
784 Ga0207674_10002348
785 Ga0207674_10002685
786 Ga0207674_10003442
787 Ga0207674_10007396
788 Ga0207674_10025349
789 Ga0207698_10002330
790 Ga0207698_10020110
791 Ga0207698_10026263
792 Ga0207698_10042045
793 Ga0207698_10203649
794 Ga0207698_10319800
795 Ga0268266_10000458
796 Ga0268266_10031622
797 Ga0268265_10005889
798 Ga0268265_10008593
799 Ga0268265_10016311
800 Ga0268265_10073944
801 Ga0268265_10149402
802 Ga0268265_10250882
803 Ga0268264_10007507
804 Ga0268264_10009772
805 Ga0307408_100090338
806 Ga0307408_100180051
807 Ga0307405_10034583
808 Ga0307405_10068529
809 Ga0307405_10092202
810 Ga0307405_10295666
811 Ga0307413_10173119
812 Ga0307410_10006140
813 Ga0307410_10008279
814 Ga0307410_10018490
815 Ga0307410_10059899
816 Ga0307410_10071971
817 Ga0307406_10016682
818 Ga0307406_10033944
819 Ga0307406_10040825
820 Ga0307406_10069102
821 Ga0307406_10109044
822 Ga0307406_10117915
823 Ga0307406_10138428
824 Ga0307407_10003352
825 Ga0307407_10012720
826 Ga0307407_10066135
827 Ga0307407_10133150
828 Ga0307412_10021894
829 Ga0307412_10034320
830 Ga0307412_10043303
831 Ga0307409_100012874
832 Ga0307409_100018009
833 Ga0307409_100024765
834 Ga0307409_100170871
835 Ga0307409_100241628
836 Ga0307409_100300250
837 Ga0307416_100017755
838 Ga0307416_100026509
839 Ga0307416_100046811
840 Ga0307416_100457480
841 Ga0307414_10005643
842 Ga0307414_10120590
843 Ga0307411_10003870
844 Ga0307411_10008092
845 Ga0307411_10140771
846 Ga0307411_10192750
847 Ga0307411_10203357
848 Ga0307415_100026146
849 Ga0307415_100265170
850 Ga0373956_0049587
851 Ga0373957_0014278
852 Ga0373955_0049101
853 Ga0373937_0069731
854 Ga0395899_0187529
855 Ga0395900_0078211
856 Ga0395900_0141799
857 Ga0395900_0306881
858 Ga0395900_0336621
859 Ga0395898_0054987
860 Ga0395905_0012839
861 Ga0395905_0014010
862 Ga0395905_0018295
863 Ga0395905_0052332
864 Ga0395905_0127109
865 Ga0395905_0237208
866 Ga0395905_0257704
867 Ga0395901_0023308
868 Ga0395901_0060208
869 Ga0395901_0149146
870 Ga0436365_1595987
871 Ga0450889_000681
872 Ga0495585_0109549
873 Ga0495621_0011252
874 Ga0495621_0013166
875 Ga0495633_0021952
876 Ga0495668_0014558
877 Ga0495661_0034543
878 Ga0495623_0070556
879 Ga0495669_0001085
880 Ga0495669_0002396
881 Ga0495669_0007261
882 Ga0495669_0012749
883 Ga0495669_0066874
884 Ga0495670_0076696
885 Ga0495677_0030656
886 Ga0495602_0018640
887 Ga0496101_0091809
888 Ga0496101_0120868
889 Ga0496101_0168776
890 Ga0496102_0029725
891 Ga0496102_0042910
892 Ga0496104_0046407
893 Ga0496105_0106281
894 Ga0496106_0236999
895 Ga0496107_0131105
896 Ga0496108_0002625
897 Ga0496108_0018888
898 Ga0496108_0022850
899 Ga0496109_0006273
900 Ga0496109_0029672
901 Ga0496109_0142424
902 Ga0496110_0003604
903 Ga0496110_0004039
904 Ga0496110_0092851
905 Ga0496111_0000244
906 Ga0496111_0135458
907 Ga0496112_0071593
908 Ga0496112_0346020
909 Ga0496113_0000515
910 Ga0496115_0009364
911 Ga0501207_010280
912 Ga0501223_031851
913 Ga0501224_006763
914 Ga0501235_013329
915 nmdc:mga03683_69094_c1
916 nmdc:mga0rr50_412834_c1
917 nmdc:mga0a205_10273_c1
918 Ga0495655_0002522

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07995

GSDH

Glucose / Sorbosone dehydrogenase

268

429

0.97

PF07995

GSDH

Glucose / Sorbosone dehydrogenase

64

247

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cgz-assembly1.cif.gz_B glucose dehydrogenase 0.9305 27 399
7cdy-assembly1.cif.gz_A crystal structure of glucose dehydrogenase 0.9237 27 399
2g8s-assembly2.cif.gz_B crystal structure of the soluble aldose sugar dehydrogenase (asd) from escherichia coli in the apo-form 0.9189 26 402
7cdy-assembly2.cif.gz_B crystal structure of glucose dehydrogenase 0.914 27 399
7cgz-assembly1.cif.gz_B glucose dehydrogenase 0.912 27 399
ID Description Score Start End Superfamily
af_P75804_19_370_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9152 26 402 2.120.10.30
af_P75804_19_370_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8952 26 402 2.120.10.30
3a9gA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8776 23 404 2.120.10.30
3a9gA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8726 23 404 2.120.10.30
3dasA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8356 26 401 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A653XSF3-F1-model_v4 Dehydrogenase 0.9712 16 405
AF-A0A031I3X8-F1-model_v4 Putative glucose/sorbosone dehydrogenase 0.9682 29 407
AF-A0A2W5HDA5-F1-model_v4 deleted 0.9676 323 404
AF-A0A2R7PUP7-F1-model_v4 deleted 0.9665 29 402
AF-A0A4Q5QF34-F1-model_v4 PQQ-dependent sugar dehydrogenase 0.9662 16 362

Map