F448319

General Info

Members Datasets Scaffolds Average Seq Length
459 215 918 155

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100316092|Ga0070678_1003160922
Length 154
Sequence MAVISLTVNGRTHSVDVDPTTPLLYVLSDDLQLNGPKFGCGLGQCGCCTVIAAGQAVRSCVTAVSAVTGEITTLEGLGTLEQPHPIQQAFIDEQAVQCGFCLSGVIMTAKALLDRNPRASEPEIRQALSNVLCRCAAHSRMIKAISRYANGGKA

Samples

Sample ID Description Type Environment
1 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
141 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
142 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
158 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 0.87
Rhizosphere 97.82
Stem 0
Stem Tuber 0
Unclassified 17.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070678_100316092 3300005456 Bacteria 1332
2 JGI25406J46586_10009242 3300003203 Bacteria 4420
3 JGI25406J46586_10139157 3300003203 Bacteria 710
4 Ga0065714_10139113 3300005288 Bacteria 1185
5 Ga0065712_10098838 3300005290 Bacteria 2091
6 Ga0065715_10428521 3300005293 Bacteria 850
7 Ga0065715_10626481 3300005293 Bacteria 692
8 Ga0065707_10042537 3300005295 Bacteria 1201
9 Ga0065707_10118413 3300005295 Bacteria 2186
10 Ga0065707_10331690 3300005295 Unclassified 948
11 Ga0070676_10315178 3300005328 Bacteria 1065
12 Ga0070690_100325539 3300005330 Unclassified 1109
13 Ga0070690_100653758 3300005330 Unclassified 803
14 Ga0070670_100010727 3300005331 Bacteria 7827
15 Ga0070670_100141093 3300005331 Bacteria 2084
16 Ga0070670_100193361 3300005331 Unclassified 1767
17 Ga0070670_100443771 3300005331 Bacteria 1149
18 Ga0068869_100004415 3300005334 Bacteria 8741
19 Ga0068869_100234197 3300005334 Bacteria 1460
20 Ga0070666_10002685 3300005335 Bacteria 10731
21 Ga0070666_10541639 3300005335 Bacteria 846
22 Ga0068868_100001145 3300005338 Bacteria 18145
23 Ga0068868_100805086 3300005338 Bacteria 848
24 Ga0070689_100022268 3300005340 Bacteria 4731
25 Ga0070689_100058669 3300005340 Bacteria 2989
26 Ga0070689_100133958 3300005340 Bacteria 1989
27 Ga0070689_100317054 3300005340 Bacteria 1301
28 Ga0070689_100321878 3300005340 Bacteria 1291
29 Ga0070689_100405020 3300005340 Bacteria 1154
30 Ga0070689_100495147 3300005340 Unclassified 1046
31 Ga0070689_101161198 3300005340 Unclassified 692
32 Ga0070687_100201016 3300005343 Bacteria 1207
33 Ga0070687_100249641 3300005343 Bacteria 1102
34 Ga0070687_100351671 3300005343 Bacteria 951
35 Ga0070687_100395885 3300005343 Bacteria 904
36 Ga0070661_100011363 3300005344 Bacteria 6204
37 Ga0070669_100021481 3300005353 Bacteria 4613
38 Ga0070675_100001347 3300005354 Bacteria 17992
39 Ga0070675_100002154 3300005354 Bacteria 14568
40 Ga0070675_100004677 3300005354 Bacteria 10448
41 Ga0070675_100026423 3300005354 Bacteria 4659
42 Ga0070675_100036098 3300005354 Bacteria 4020
43 Ga0070675_100072534 3300005354 Bacteria 2859
44 Ga0070675_100722316 3300005354 Unclassified 908
45 Ga0070671_100004806 3300005355 Bacteria 10741
46 Ga0070674_100097888 3300005356 Bacteria 2131
47 Ga0070674_100763623 3300005356 Unclassified 832
48 Ga0070673_100006359 3300005364 Bacteria 7676
49 Ga0070673_100020905 3300005364 Bacteria 4731
50 Ga0070673_100118454 3300005364 Bacteria 2205
51 Ga0070673_100217411 3300005364 Bacteria 1652
52 Ga0070673_100330178 3300005364 Bacteria 1349
53 Ga0070688_100004115 3300005365 Bacteria 7549
54 Ga0070688_100367735 3300005365 Bacteria 1057
55 Ga0070688_100841819 3300005365 Unclassified 720
56 Ga0070667_100003626 3300005367 Bacteria 13133
57 Ga0070703_10288281 3300005406 Bacteria 680
58 Ga0070713_100213985 3300005436 Bacteria 1746
59 Ga0070713_100360223 3300005436 Bacteria 1351
60 Ga0070701_10007060 3300005438 Bacteria 4767
61 Ga0070701_10935593 3300005438 Bacteria 600
62 Ga0070711_100147193 3300005439 Bacteria 1772
63 Ga0070705_100253797 3300005440 Bacteria 1236
64 Ga0070678_100102627 3300005456 Bacteria 2220
65 Ga0070662_100291715 3300005457 Bacteria 1323
66 Ga0070662_100381898 3300005457 Bacteria 1160
67 Ga0068867_101092630 3300005459 Bacteria 728
68 Ga0070685_10026785 3300005466 Bacteria 3180
69 Ga0070685_10028826 3300005466 Bacteria 3080
70 Ga0070685_10285216 3300005466 Bacteria 1107
71 Ga0070685_10299399 3300005466 Unclassified 1083
72 Ga0070685_10590244 3300005466 Bacteria 798
73 Ga0070706_100358903 3300005467 Bacteria 1358
74 Ga0070707_100035755 3300005468 Bacteria 4740
75 Ga0070707_100871549 3300005468 Bacteria 865
76 Ga0070698_100097497 3300005471 Bacteria 2916
77 Ga0070698_100334709 3300005471 Unclassified 1445
78 Ga0070699_100024273 3300005518 Bacteria 5224
79 Ga0070699_100651542 3300005518 Bacteria 961
80 Ga0070684_100029268 3300005535 Bacteria 4666
81 Ga0070672_100018805 3300005543 Bacteria 5003
82 Ga0070672_100116272 3300005543 Bacteria 2185
83 Ga0070672_100143395 3300005543 Bacteria 1972
84 Ga0070672_100251152 3300005543 Bacteria 1490
85 Ga0070672_100291119 3300005543 Bacteria 1382
86 Ga0070686_101048350 3300005544 Unclassified 671
87 Ga0070686_101134185 3300005544 Unclassified 647
88 Ga0070695_100142906 3300005545 Bacteria 1662
89 Ga0070695_101431683 3300005545 Bacteria 574
90 Ga0070693_100032168 3300005547 Bacteria 2882
91 Ga0070693_100888966 3300005547 Bacteria 667
92 Ga0070704_100985381 3300005549 Bacteria 762
93 Ga0070664_100000890 3300005564 Bacteria 23214
94 Ga0070664_100058519 3300005564 Bacteria 3278
95 Ga0068854_100106749 3300005578 Bacteria 2107
96 Ga0068854_100142590 3300005578 Bacteria 1840
97 Ga0068859_100005927 3300005617 Bacteria 12400
98 Ga0068859_100011972 3300005617 Bacteria 8713
99 Ga0068859_100100995 3300005617 Bacteria 2941
100 Ga0068859_100247298 3300005617 Bacteria 1873
101 Ga0068859_100887334 3300005617 Bacteria 977
102 Ga0068864_100001136 3300005618 Bacteria 22169
103 Ga0068864_100071026 3300005618 Bacteria 3031
104 Ga0068864_100326214 3300005618 Bacteria 1443
105 Ga0068864_100461764 3300005618 Bacteria 1216
106 Ga0068864_100854629 3300005618 Bacteria 897
107 Ga0068864_101965879 3300005618 Bacteria 591
108 Ga0068866_10022789 3300005718 Bacteria 2903
109 Ga0068861_100004809 3300005719 Bacteria 9081
110 Ga0068861_100138475 3300005719 Bacteria 1983
111 Ga0068861_100627098 3300005719 Unclassified 990
112 Ga0068870_10408657 3300005840 Bacteria 885
113 Ga0068870_10475662 3300005840 Bacteria 828
114 Ga0068863_100017928 3300005841 Bacteria 6776
115 Ga0068863_100038129 3300005841 Bacteria 4574
116 Ga0068863_100156803 3300005841 Unclassified 2180
117 Ga0068863_100207353 3300005841 Bacteria 1887
118 Ga0068858_100018943 3300005842 Bacteria 6441
119 Ga0068858_100020064 3300005842 Bacteria 6251
120 Ga0068858_100103207 3300005842 Bacteria 2660
121 Ga0068858_100159902 3300005842 Bacteria 2121
122 Ga0068860_100013848 3300005843 Bacteria 7909
123 Ga0068860_100501181 3300005843 Bacteria 1212
124 Ga0068860_100767270 3300005843 Bacteria 977
125 Ga0068862_100143414 3300005844 Bacteria 2121
126 Ga0081455_10098899 3300005937 Bacteria 2347
127 Ga0081455_10375260 3300005937 Bacteria 995
128 Ga0081539_10000122 3300005985 Bacteria 183393
129 Ga0081539_10001218 3300005985 Bacteria 45966
130 Ga0097621_100019326 3300006237 Bacteria 5227
131 Ga0097621_100065184 3300006237 Bacteria 2997
132 Ga0097621_100069685 3300006237 Bacteria 2904
133 Ga0068871_100022130 3300006358 Bacteria 4899
134 Ga0068871_100424359 3300006358 Unclassified 1188
135 Ga0075428_100016149 3300006844 Bacteria 8254
136 Ga0075428_100070395 3300006844 Plasmid 3824
137 Ga0075428_100657899 3300006844 Unclassified 1117
138 Ga0075428_101500620 3300006844 Bacteria 706
139 Ga0075430_100038590 3300006846 Bacteria 4045
140 Ga0075431_100017844 3300006847 Bacteria 7216
141 Ga0075431_100308415 3300006847 Bacteria 1598
142 Ga0075431_100605233 3300006847 Unclassified 1079
143 Ga0075433_10022388 3300006852 Bacteria 5304
144 Ga0075433_10099671 3300006852 Unclassified 2572
145 Ga0075433_10154957 3300006852 Bacteria 2038
146 Ga0075433_11139985 3300006852 Bacteria 678
147 Ga0075434_100026012 3300006871 Bacteria 5730
148 Ga0075434_100092403 3300006871 Unclassified 3028
149 Ga0075434_100311077 3300006871 Unclassified 1596
150 Ga0075434_100384264 3300006871 Unclassified 1425
151 Ga0075434_101153599 3300006871 Unclassified 787
152 Ga0075429_100005009 3300006880 Bacteria 11404
153 Ga0075429_100023300 3300006880 Bacteria 5370
154 Ga0075429_100357006 3300006880 Unclassified 1280
155 Ga0075429_100688365 3300006880 Bacteria 896
156 Ga0068865_100013660 3300006881 Bacteria 5140
157 Ga0068865_100667441 3300006881 Unclassified 885
158 Ga0075436_100767260 3300006914 Bacteria 717
159 Ga0097620_100005927 3300006931 Bacteria 12400
160 Ga0097620_100011972 3300006931 Bacteria 8713
161 Ga0097620_100100994 3300006931 Bacteria 2941
162 Ga0097620_100247294 3300006931 Bacteria 1873
163 Ga0097620_100887422 3300006931 Bacteria 977
164 Ga0075435_100090721 3300007076 Unclassified 2521
165 Ga0075435_100317028 3300007076 Unclassified 1334
166 Ga0075435_100490683 3300007076 Bacteria 1061
167 Ga0075435_100540115 3300007076 Bacteria 1009
168 Ga0099794_10119789 3300007265 Bacteria 1323
169 Ga0099795_10201591 3300007788 Unclassified 839
170 Ga0111539_10014420 3300009094 Bacteria 9864
171 Ga0111539_10035061 3300009094 Bacteria 6077
172 Ga0111539_10117956 3300009094 Bacteria 3110
173 Ga0111539_11018991 3300009094 Bacteria 962
174 Ga0111539_12590223 3300009094 Bacteria 588
175 Ga0105245_10146502 3300009098 Bacteria 2228
176 Ga0105245_10207451 3300009098 Unclassified 1884
177 Ga0105245_12520922 3300009098 Bacteria 567
178 Ga0105247_10206989 3300009101 Bacteria 1321
179 Ga0114129_10025762 3300009147 Bacteria 8331
180 Ga0114129_10124769 3300009147 Bacteria 3541
181 Ga0114129_10265107 3300009147 Unclassified 2300
182 Ga0114129_10468149 3300009147 Unclassified 1651
183 Ga0114129_10884984 3300009147 Bacteria 1133
184 Ga0105243_10009108 3300009148 Bacteria 7581
185 Ga0105243_11525165 3300009148 Bacteria 693
186 Ga0105242_10008742 3300009176 Bacteria 7772
187 Ga0105242_10685241 3300009176 Bacteria 1001
188 Ga0105242_11035318 3300009176 Bacteria 831
189 Ga0105242_11441821 3300009176 Bacteria 717
190 Ga0105248_10001450 3300009177 Bacteria 26400
191 Ga0105248_10037094 3300009177 Bacteria 5452
192 Ga0105248_10071208 3300009177 Unclassified 3905
193 Ga0105248_10173379 3300009177 Bacteria 2431
194 Ga0105248_10229529 3300009177 Bacteria 2089
195 Ga0105248_10472754 3300009177 Bacteria 1413
196 Ga0105248_11187500 3300009177 Bacteria 863
197 Ga0105248_11305763 3300009177 Bacteria 821
198 Ga0105248_11512045 3300009177 Bacteria 760
199 Ga0105249_12798662 3300009553 Unclassified 559
200 Ga0105246_10076855 3300011119 Bacteria 2367
201 Ga0157374_10907187 3300013296 Bacteria 899
202 Ga0157378_10007688 3300013297 Bacteria 9402
203 Ga0163162_10006345 3300013306 Bacteria 11449
204 Ga0163162_10018228 3300013306 Bacteria 6875
205 Ga0157375_10000288 3300013308 Bacteria 45939
206 Ga0157375_10006273 3300013308 Bacteria 10355
207 Ga0157375_10219668 3300013308 Bacteria 2059
208 Ga0157375_10495021 3300013308 Bacteria 1387
209 Ga0157375_11453181 3300013308 Bacteria 808
210 Ga0163163_10017731 3300014325 Bacteria 6646
211 Ga0163163_10036808 3300014325 Bacteria 4756
212 Ga0163163_10635050 3300014325 Bacteria 1131
213 Ga0157380_10050918 3300014326 Bacteria 3272
214 Ga0157380_10511381 3300014326 Unclassified 1169
215 Ga0157380_10699162 3300014326 Bacteria 1018
216 Ga0157377_10037494 3300014745 Bacteria 2671
217 Ga0157379_11165822 3300014968 Bacteria 740
218 Ga0157376_10037060 3300014969 Bacteria 3955
219 Ga0157376_10090932 3300014969 Bacteria 2643
220 Ga0157376_10135424 3300014969 Bacteria 2204
221 Ga0157376_10174736 3300014969 Bacteria 1958
222 Ga0157376_10225710 3300014969 Bacteria 1737
223 Ga0163161_10814161 3300017792 Bacteria 786
224 Ga0213876_10181298 3300021384 Unclassified 1120
225 Ga0207682_10112226 3300025893 Bacteria 1201
226 Ga0207642_10014183 3300025899 Bacteria 2933
227 Ga0207642_10151354 3300025899 Bacteria 1235
228 Ga0207688_10064627 3300025901 Bacteria 2066
229 Ga0207680_10011877 3300025903 Bacteria 4419
230 Ga0207680_10466730 3300025903 Bacteria 897
231 Ga0207680_10798681 3300025903 Bacteria 676
232 Ga0207680_10927342 3300025903 Bacteria 624
233 Ga0207699_10004035 3300025906 Bacteria 7028
234 Ga0207645_10013665 3300025907 Bacteria 5462
235 Ga0207645_10091296 3300025907 Bacteria 1958
236 Ga0207645_11140094 3300025907 Bacteria 525
237 Ga0207643_10353771 3300025908 Bacteria 922
238 Ga0207684_10574043 3300025910 Unclassified 964
239 Ga0207662_10093279 3300025918 Bacteria 1855
240 Ga0207662_10336432 3300025918 Bacteria 1011
241 Ga0207662_10353977 3300025918 Bacteria 987
242 Ga0207649_10422335 3300025920 Unclassified 1001
243 Ga0207646_10009560 3300025922 Bacteria 9569
244 Ga0207646_10142907 3300025922 Bacteria 2156
245 Ga0207646_10672167 3300025922 Bacteria 927
246 Ga0207681_10050447 3300025923 Bacteria 2816
247 Ga0207681_10330773 3300025923 Bacteria 1214
248 Ga0207650_10267401 3300025925 Bacteria 1389
249 Ga0207650_10317570 3300025925 Bacteria 1275
250 Ga0207659_10002395 3300025926 Bacteria 11160
251 Ga0207659_10002686 3300025926 Bacteria 10597
252 Ga0207659_10004094 3300025926 Bacteria 8795
253 Ga0207659_10018712 3300025926 Bacteria 4544
254 Ga0207659_10351529 3300025926 Unclassified 1223
255 Ga0207700_10015728 3300025928 Bacteria 5003
256 Ga0207644_10487793 3300025931 Bacteria 1015
257 Ga0207706_10064741 3300025933 Bacteria 3219
258 Ga0207706_10395161 3300025933 Bacteria 1199
259 Ga0207706_10887001 3300025933 Bacteria 754
260 Ga0207686_10004121 3300025934 Bacteria 7798
261 Ga0207709_10004978 3300025935 Bacteria 7604
262 Ga0207709_10398121 3300025935 Bacteria 1052
263 Ga0207670_10038784 3300025936 Bacteria 3114
264 Ga0207670_10138053 3300025936 Bacteria 1795
265 Ga0207670_10218017 3300025936 Bacteria 1459
266 Ga0207670_10467966 3300025936 Bacteria 1019
267 Ga0207670_10484938 3300025936 Unclassified 1002
268 Ga0207669_10365197 3300025937 Bacteria 1120
269 Ga0207704_10005464 3300025938 Bacteria 5859
270 Ga0207704_10729071 3300025938 Unclassified 823
271 Ga0207691_10008508 3300025940 Bacteria 9856
272 Ga0207691_10023491 3300025940 Bacteria 5805
273 Ga0207691_10134440 3300025940 Bacteria 2183
274 Ga0207691_10258207 3300025940 Bacteria 1502
275 Ga0207711_10023767 3300025941 Bacteria 5131
276 Ga0207711_10108472 3300025941 Bacteria 2466
277 Ga0207711_10127584 3300025941 Bacteria 2277
278 Ga0207711_10331664 3300025941 Unclassified 1407
279 Ga0207689_10002672 3300025942 Bacteria 16479
280 Ga0207689_10161849 3300025942 Unclassified 1844
281 Ga0207679_10001586 3300025945 Bacteria 14202
282 Ga0207679_10119282 3300025945 Bacteria 2097
283 Ga0207651_10002960 3300025960 Bacteria 8216
284 Ga0207651_10014121 3300025960 Bacteria 4600
285 Ga0207651_10103014 3300025960 Bacteria 2123
286 Ga0207640_10086929 3300025981 Bacteria 2154
287 Ga0207640_10223461 3300025981 Bacteria 1443
288 Ga0207677_10136117 3300026023 Bacteria 1873
289 Ga0207677_10698143 3300026023 Bacteria 900
290 Ga0207677_10718470 3300026023 Bacteria 888
291 Ga0207703_10073489 3300026035 Bacteria 2829
292 Ga0207703_10122536 3300026035 Bacteria 2234
293 Ga0207703_10483377 3300026035 Bacteria 1161
294 Ga0207703_10523542 3300026035 Unclassified 1115
295 Ga0207703_10783478 3300026035 Bacteria 910
296 Ga0207639_10884771 3300026041 Unclassified 834
297 Ga0207708_10019773 3300026075 Bacteria 5077
298 Ga0207641_10018299 3300026088 Bacteria 5743
299 Ga0207641_10019480 3300026088 Bacteria 5571
300 Ga0207641_11488137 3300026088 Bacteria 679
301 Ga0207648_10001006 3300026089 Bacteria 31735
302 Ga0207648_10081576 3300026089 Bacteria 2821
303 Ga0207648_10247279 3300026089 Bacteria 1589
304 Ga0207676_10003451 3300026095 Bacteria 11186
305 Ga0207676_10296294 3300026095 Bacteria 1475
306 Ga0207674_10091304 3300026116 Bacteria 3036
307 Ga0207675_100005870 3300026118 Bacteria 11723
308 Ga0207675_100065697 3300026118 Bacteria 3391
309 Ga0207675_100104454 3300026118 Bacteria 2670
310 Ga0207675_100269159 3300026118 Bacteria 1653
311 Ga0207675_100289294 3300026118 Bacteria 1594
312 Ga0207683_10032017 3300026121 Bacteria 4566
313 Ga0207683_10231065 3300026121 Bacteria 1687
314 Ga0207683_10389483 3300026121 Bacteria 1281
315 Ga0209983_1105340 3300027665 Bacteria 640
316 Ga0209971_1019143 3300027682 Bacteria 1625
317 Ga0207428_10298950 3300027907 Unclassified 1191
318 Ga0268265_10131655 3300028380 Bacteria 2080
319 Ga0268265_10263110 3300028380 Bacteria 1535
320 Ga0268265_10324201 3300028380 Bacteria 1396
321 Ga0268264_10018063 3300028381 Bacteria 5768
322 Ga0268264_10766184 3300028381 Unclassified 962
323 Ga0307408_100066456 3300031548 Bacteria 2648
324 Ga0307405_10001249 3300031731 Bacteria 10587
325 Ga0307413_10005583 3300031824 Bacteria 5635
326 Ga0307407_10000665 3300031903 Bacteria 11072
327 Ga0307412_10006091 3300031911 Bacteria 6792
328 Ga0307409_100040581 3300031995 Bacteria 3467
329 Ga0307416_100013144 3300032002 Bacteria 5616
330 Ga0307415_100207446 3300032126 Bacteria 1560
331 Ga0373923_0161653 3300035111 Bacteria 1022
332 Ga0373953_0168012 3300035117 Unclassified 944
333 Ga0373956_0027351 3300035119 Bacteria 2476
334 Ga0373960_0046741 3300035121 Unclassified 1271
335 Ga0373943_0000540 3300035170 Bacteria 16373
336 Ga0373955_0052275 3300035172 Bacteria 2228
337 Ga0373924_0001259 3300035410 Bacteria 8113
338 Ga0373935_0016120 3300035692 Bacteria 4522
339 Ga0373927_0122176 3300035695 Bacteria 1700
340 Ga0373933_0507769 3300035724 Bacteria 790
341 Ga0373947_0002509 3300035725 Bacteria 11028
342 Ga0373937_0175197 3300036401 Bacteria 2013
343 Ga0373937_0176441 3300036401 Bacteria 2006
344 Ga0373937_0205981 3300036401 Bacteria 1850
345 Ga0373925_0015338 3300037068 Bacteria 5543
346 Ga0436365_1816735 3300039437 Bacteria 2386
347 Ga0436360_1055648 3300039438 Unclassified 1098
348 Ga0436363_0379905 3300039450 Bacteria 990
349 Ga0439439_0021426 3300041406 Unclassified 1611
350 Ga0451853_3892731 3300041512 Bacteria 840
351 Ga0439446_0219155 3300042156 Bacteria 648
352 Ga0450908_008291 3300042184 Unclassified 1948
353 Ga0451576_1110053 3300045051 Bacteria 827
354 Ga0495603_0669350 3300046455 Bacteria 594
355 Ga0495629_0303916 3300046459 Bacteria 1092
356 Ga0495580_0052566 3300046472 Bacteria 2877
357 Ga0495580_0569632 3300046472 Bacteria 751
358 Ga0495582_0329535 3300046473 Unclassified 879
359 Ga0495582_0484247 3300046473 Unclassified 715
360 Ga0495662_0327037 3300046476 Unclassified 754
361 Ga0495662_0544930 3300046476 Bacteria 568
362 Ga0495608_0057657 3300046511 Bacteria 2562
363 Ga0495618_0025686 3300046514 Unclassified 3657
364 Ga0495628_0014399 3300046516 Bacteria 6631
365 Ga0495630_0025482 3300046517 Bacteria 4374
366 Ga0495630_0200266 3300046517 Bacteria 1524
367 Ga0495630_0244056 3300046517 Bacteria 1372
368 Ga0495630_0476560 3300046517 Bacteria 957
369 Ga0495652_0069874 3300046529 Bacteria 2938
370 Ga0495640_0065239 3300046533 Bacteria 2459
371 Ga0495640_0399608 3300046533 Bacteria 844
372 Ga0495586_0031679 3300046535 Bacteria 2834
373 Ga0495586_0385931 3300046535 Unclassified 806
374 Ga0495634_0022335 3300046642 Unclassified 4459
375 Ga0495634_0142906 3300046642 Bacteria 1518
376 Ga0495634_0615891 3300046642 Bacteria 629
377 Ga0495635_0414962 3300046663 Bacteria 893
378 Ga0495635_0792400 3300046663 Bacteria 611
379 Ga0495588_0196637 3300046674 Unclassified 1065
380 Ga0495657_0110961 3300046675 Bacteria 1737
381 Ga0495647_0101305 3300046681 Bacteria 1193
382 Ga0495647_0252034 3300046681 Bacteria 786
383 Ga0495658_0014047 3300046683 Bacteria 4083
384 Ga0495658_0331252 3300046683 Unclassified 966
385 Ga0495613_0000383 3300046689 Bacteria 38129
386 Ga0495613_0122775 3300046689 Bacteria 1864
387 Ga0495624_0707807 3300046690 Bacteria 598
388 Ga0495670_0277683 3300046691 Bacteria 896
389 Ga0495600_0024338 3300046809 Bacteria 3897
390 Ga0495604_0125294 3300047317 Bacteria 1853
391 Ga0495636_0026291 3300047318 Unclassified 2367
392 Ga0495636_0066950 3300047318 Bacteria 1528
393 Ga0495674_0016421 3300047319 Bacteria 6905
394 Ga0495674_0111913 3300047319 Bacteria 2314
395 Ga0495674_0343170 3300047319 Bacteria 1213
396 Ga0495680_0548573 3300047322 Bacteria 779
397 Ga0495675_0249357 3300047444 Bacteria 1067
398 Ga0495684_0000859 3300047471 Bacteria 24642
399 Ga0495684_0194762 3300047471 Bacteria 1497
400 Ga0495684_0415785 3300047471 Bacteria 941
401 Ga0495684_0592468 3300047471 Bacteria 749
402 Ga0495684_0686007 3300047471 Unclassified 681
403 Ga0496104_0389552 3300048907 Bacteria 1306
404 Ga0496104_0624363 3300048907 Bacteria 987
405 Ga0496109_0735108 3300048912 Bacteria 925
406 Ga0496109_0993465 3300048912 Bacteria 777
407 Ga0501040_0489259 3300049576 Bacteria 887
408 Ga0501041_0029451 3300049577 Bacteria 3312
409 Ga0501042_0067656 3300049578 Bacteria 2554
410 Ga0501071_0205379 3300049587 Bacteria 1481
411 Ga0501072_0026367 3300049588 Bacteria 4532
412 Ga0501073_0279463 3300049589 Bacteria 1152
413 Ga0501075_0222385 3300049591 Bacteria 1440
414 Ga0501076_0025688 3300049592 Bacteria 4560
415 Ga0501080_0601527 3300049742 Bacteria 976
416 Ga0501081_0911037 3300049743 Bacteria 663
417 Ga0501083_0017579 3300049744 Bacteria 4985
418 nmdc:mga03683_594444_c1 3300050489 Unclassified 541
419 nmdc:mga05p37_154323_c1 3300050507 Bacteria 2807
420 nmdc:mga05p37_225942_c1 3300050507 Bacteria 2257
421 nmdc:mga05p37_232588_c1 3300050507 Bacteria 2220
422 nmdc:mga05p37_318298_c1 3300050507 Bacteria 1842
423 nmdc:mga05p37_37744_c1 3300050507 Bacteria 5926
424 nmdc:mga05p37_73776_c1 3300050507 Unclassified 3256
425 nmdc:mga05p37_881868_c1 3300050507 Bacteria 967
426 nmdc:mga09592_106527_c1 3300050508 Unclassified 2404
427 nmdc:mga09592_156004_c1 3300050508 Unclassified 1971
428 nmdc:mga09592_405112_c1 3300050508 Unclassified 1179
429 nmdc:mga09592_4361_c1 3300050508 Bacteria 11436
430 nmdc:mga0qj67_174553_c1 3300050509 Bacteria 1745
431 nmdc:mga06r32_114504_c1 3300050510 Bacteria 2655
432 nmdc:mga06r32_438708_c1 3300050510 Unclassified 1286
433 nmdc:mga06r32_65921_c1 3300050510 Unclassified 3494
434 nmdc:mga08y16_123488_c1 3300050511 Unclassified 2694
435 nmdc:mga08y16_75114_c1 3300050511 Unclassified 3523
436 nmdc:mga0n895_1173940_c1 3300050512 Bacteria 742
437 nmdc:mga0n895_1511157_c1 3300050512 Bacteria 638
438 nmdc:mga0n895_177113_c1 3300050512 Unclassified 2163
439 nmdc:mga0n895_281684_c1 3300050512 Unclassified 1686
440 nmdc:mga0rr50_147715_c1 3300050513 Unclassified 1897
441 nmdc:mga0rr50_477900_c1 3300050513 Bacteria 1058
442 nmdc:mga0rr50_554651_c1 3300050513 Bacteria 978
443 nmdc:mga0rr50_738843_c1 3300050513 Unclassified 840
444 nmdc:mga0a205_1108100_c1 3300050515 Unclassified 639
445 nmdc:mga0a205_143252_c1 3300050515 Unclassified 2290
446 nmdc:mga0a205_20985_c1 3300050515 Bacteria 6173
447 nmdc:mga0a205_301951_c1 3300050515 Unclassified 1474
448 nmdc:mga0a205_44378_c1 3300050515 Unclassified 4285
449 nmdc:mga0a205_55103_c1 3300050515 Bacteria 3840
450 Ga0495601_0006558 3300053077 Bacteria 6809
451 Ga0495601_0255492 3300053077 Bacteria 1144
452 Ga0495601_0281966 3300053077 Unclassified 1083
453 Ga0495595_0062740 3300053084 Bacteria 1743
454 Ga0495619_0000790 3300053085 Bacteria 20742
455 Ga0495619_0389323 3300053085 Unclassified 963
456 Ga0495619_0541442 3300053085 Bacteria 799
457 Ga0500556_0013284 3300053104 Bacteria 2487
458 Ga0501084_0665034 3300054114 Bacteria 879
459 Ga0530510_0572735 3300061734 Bacteria 858
460 Ga0070678_100316092
461 JGI25406J46586_10009242
462 JGI25406J46586_10139157
463 Ga0065714_10139113
464 Ga0065712_10098838
465 Ga0065715_10428521
466 Ga0065715_10626481
467 Ga0065707_10042537
468 Ga0065707_10118413
469 Ga0065707_10331690
470 Ga0070676_10315178
471 Ga0070690_100325539
472 Ga0070690_100653758
473 Ga0070670_100010727
474 Ga0070670_100141093
475 Ga0070670_100193361
476 Ga0070670_100443771
477 Ga0068869_100004415
478 Ga0068869_100234197
479 Ga0070666_10002685
480 Ga0070666_10541639
481 Ga0068868_100001145
482 Ga0068868_100805086
483 Ga0070689_100022268
484 Ga0070689_100058669
485 Ga0070689_100133958
486 Ga0070689_100317054
487 Ga0070689_100321878
488 Ga0070689_100405020
489 Ga0070689_100495147
490 Ga0070689_101161198
491 Ga0070687_100201016
492 Ga0070687_100249641
493 Ga0070687_100351671
494 Ga0070687_100395885
495 Ga0070661_100011363
496 Ga0070669_100021481
497 Ga0070675_100001347
498 Ga0070675_100002154
499 Ga0070675_100004677
500 Ga0070675_100026423
501 Ga0070675_100036098
502 Ga0070675_100072534
503 Ga0070675_100722316
504 Ga0070671_100004806
505 Ga0070674_100097888
506 Ga0070674_100763623
507 Ga0070673_100006359
508 Ga0070673_100020905
509 Ga0070673_100118454
510 Ga0070673_100217411
511 Ga0070673_100330178
512 Ga0070688_100004115
513 Ga0070688_100367735
514 Ga0070688_100841819
515 Ga0070667_100003626
516 Ga0070703_10288281
517 Ga0070713_100213985
518 Ga0070713_100360223
519 Ga0070701_10007060
520 Ga0070701_10935593
521 Ga0070711_100147193
522 Ga0070705_100253797
523 Ga0070678_100102627
524 Ga0070662_100291715
525 Ga0070662_100381898
526 Ga0068867_101092630
527 Ga0070685_10026785
528 Ga0070685_10028826
529 Ga0070685_10285216
530 Ga0070685_10299399
531 Ga0070685_10590244
532 Ga0070706_100358903
533 Ga0070707_100035755
534 Ga0070707_100871549
535 Ga0070698_100097497
536 Ga0070698_100334709
537 Ga0070699_100024273
538 Ga0070699_100651542
539 Ga0070684_100029268
540 Ga0070672_100018805
541 Ga0070672_100116272
542 Ga0070672_100143395
543 Ga0070672_100251152
544 Ga0070672_100291119
545 Ga0070686_101048350
546 Ga0070686_101134185
547 Ga0070695_100142906
548 Ga0070695_101431683
549 Ga0070693_100032168
550 Ga0070693_100888966
551 Ga0070704_100985381
552 Ga0070664_100000890
553 Ga0070664_100058519
554 Ga0068854_100106749
555 Ga0068854_100142590
556 Ga0068859_100005927
557 Ga0068859_100011972
558 Ga0068859_100100995
559 Ga0068859_100247298
560 Ga0068859_100887334
561 Ga0068864_100001136
562 Ga0068864_100071026
563 Ga0068864_100326214
564 Ga0068864_100461764
565 Ga0068864_100854629
566 Ga0068864_101965879
567 Ga0068866_10022789
568 Ga0068861_100004809
569 Ga0068861_100138475
570 Ga0068861_100627098
571 Ga0068870_10408657
572 Ga0068870_10475662
573 Ga0068863_100017928
574 Ga0068863_100038129
575 Ga0068863_100156803
576 Ga0068863_100207353
577 Ga0068858_100018943
578 Ga0068858_100020064
579 Ga0068858_100103207
580 Ga0068858_100159902
581 Ga0068860_100013848
582 Ga0068860_100501181
583 Ga0068860_100767270
584 Ga0068862_100143414
585 Ga0081455_10098899
586 Ga0081455_10375260
587 Ga0081539_10000122
588 Ga0081539_10001218
589 Ga0097621_100019326
590 Ga0097621_100065184
591 Ga0097621_100069685
592 Ga0068871_100022130
593 Ga0068871_100424359
594 Ga0075428_100016149
595 Ga0075428_100070395
596 Ga0075428_100657899
597 Ga0075428_101500620
598 Ga0075430_100038590
599 Ga0075431_100017844
600 Ga0075431_100308415
601 Ga0075431_100605233
602 Ga0075433_10022388
603 Ga0075433_10099671
604 Ga0075433_10154957
605 Ga0075433_11139985
606 Ga0075434_100026012
607 Ga0075434_100092403
608 Ga0075434_100311077
609 Ga0075434_100384264
610 Ga0075434_101153599
611 Ga0075429_100005009
612 Ga0075429_100023300
613 Ga0075429_100357006
614 Ga0075429_100688365
615 Ga0068865_100013660
616 Ga0068865_100667441
617 Ga0075436_100767260
618 Ga0097620_100005927
619 Ga0097620_100011972
620 Ga0097620_100100994
621 Ga0097620_100247294
622 Ga0097620_100887422
623 Ga0075435_100090721
624 Ga0075435_100317028
625 Ga0075435_100490683
626 Ga0075435_100540115
627 Ga0099794_10119789
628 Ga0099795_10201591
629 Ga0111539_10014420
630 Ga0111539_10035061
631 Ga0111539_10117956
632 Ga0111539_11018991
633 Ga0111539_12590223
634 Ga0105245_10146502
635 Ga0105245_10207451
636 Ga0105245_12520922
637 Ga0105247_10206989
638 Ga0114129_10025762
639 Ga0114129_10124769
640 Ga0114129_10265107
641 Ga0114129_10468149
642 Ga0114129_10884984
643 Ga0105243_10009108
644 Ga0105243_11525165
645 Ga0105242_10008742
646 Ga0105242_10685241
647 Ga0105242_11035318
648 Ga0105242_11441821
649 Ga0105248_10001450
650 Ga0105248_10037094
651 Ga0105248_10071208
652 Ga0105248_10173379
653 Ga0105248_10229529
654 Ga0105248_10472754
655 Ga0105248_11187500
656 Ga0105248_11305763
657 Ga0105248_11512045
658 Ga0105249_12798662
659 Ga0105246_10076855
660 Ga0157374_10907187
661 Ga0157378_10007688
662 Ga0163162_10006345
663 Ga0163162_10018228
664 Ga0157375_10000288
665 Ga0157375_10006273
666 Ga0157375_10219668
667 Ga0157375_10495021
668 Ga0157375_11453181
669 Ga0163163_10017731
670 Ga0163163_10036808
671 Ga0163163_10635050
672 Ga0157380_10050918
673 Ga0157380_10511381
674 Ga0157380_10699162
675 Ga0157377_10037494
676 Ga0157379_11165822
677 Ga0157376_10037060
678 Ga0157376_10090932
679 Ga0157376_10135424
680 Ga0157376_10174736
681 Ga0157376_10225710
682 Ga0163161_10814161
683 Ga0213876_10181298
684 Ga0207682_10112226
685 Ga0207642_10014183
686 Ga0207642_10151354
687 Ga0207688_10064627
688 Ga0207680_10011877
689 Ga0207680_10466730
690 Ga0207680_10798681
691 Ga0207680_10927342
692 Ga0207699_10004035
693 Ga0207645_10013665
694 Ga0207645_10091296
695 Ga0207645_11140094
696 Ga0207643_10353771
697 Ga0207684_10574043
698 Ga0207662_10093279
699 Ga0207662_10336432
700 Ga0207662_10353977
701 Ga0207649_10422335
702 Ga0207646_10009560
703 Ga0207646_10142907
704 Ga0207646_10672167
705 Ga0207681_10050447
706 Ga0207681_10330773
707 Ga0207650_10267401
708 Ga0207650_10317570
709 Ga0207659_10002395
710 Ga0207659_10002686
711 Ga0207659_10004094
712 Ga0207659_10018712
713 Ga0207659_10351529
714 Ga0207700_10015728
715 Ga0207644_10487793
716 Ga0207706_10064741
717 Ga0207706_10395161
718 Ga0207706_10887001
719 Ga0207686_10004121
720 Ga0207709_10004978
721 Ga0207709_10398121
722 Ga0207670_10038784
723 Ga0207670_10138053
724 Ga0207670_10218017
725 Ga0207670_10467966
726 Ga0207670_10484938
727 Ga0207669_10365197
728 Ga0207704_10005464
729 Ga0207704_10729071
730 Ga0207691_10008508
731 Ga0207691_10023491
732 Ga0207691_10134440
733 Ga0207691_10258207
734 Ga0207711_10023767
735 Ga0207711_10108472
736 Ga0207711_10127584
737 Ga0207711_10331664
738 Ga0207689_10002672
739 Ga0207689_10161849
740 Ga0207679_10001586
741 Ga0207679_10119282
742 Ga0207651_10002960
743 Ga0207651_10014121
744 Ga0207651_10103014
745 Ga0207640_10086929
746 Ga0207640_10223461
747 Ga0207677_10136117
748 Ga0207677_10698143
749 Ga0207677_10718470
750 Ga0207703_10073489
751 Ga0207703_10122536
752 Ga0207703_10483377
753 Ga0207703_10523542
754 Ga0207703_10783478
755 Ga0207639_10884771
756 Ga0207708_10019773
757 Ga0207641_10018299
758 Ga0207641_10019480
759 Ga0207641_11488137
760 Ga0207648_10001006
761 Ga0207648_10081576
762 Ga0207648_10247279
763 Ga0207676_10003451
764 Ga0207676_10296294
765 Ga0207674_10091304
766 Ga0207675_100005870
767 Ga0207675_100065697
768 Ga0207675_100104454
769 Ga0207675_100269159
770 Ga0207675_100289294
771 Ga0207683_10032017
772 Ga0207683_10231065
773 Ga0207683_10389483
774 Ga0209983_1105340
775 Ga0209971_1019143
776 Ga0207428_10298950
777 Ga0268265_10131655
778 Ga0268265_10263110
779 Ga0268265_10324201
780 Ga0268264_10018063
781 Ga0268264_10766184
782 Ga0307408_100066456
783 Ga0307405_10001249
784 Ga0307413_10005583
785 Ga0307407_10000665
786 Ga0307412_10006091
787 Ga0307409_100040581
788 Ga0307416_100013144
789 Ga0307415_100207446
790 Ga0373923_0161653
791 Ga0373953_0168012
792 Ga0373956_0027351
793 Ga0373960_0046741
794 Ga0373943_0000540
795 Ga0373955_0052275
796 Ga0373924_0001259
797 Ga0373935_0016120
798 Ga0373927_0122176
799 Ga0373933_0507769
800 Ga0373947_0002509
801 Ga0373937_0175197
802 Ga0373937_0176441
803 Ga0373937_0205981
804 Ga0373925_0015338
805 Ga0436365_1816735
806 Ga0436360_1055648
807 Ga0436363_0379905
808 Ga0439439_0021426
809 Ga0451853_3892731
810 Ga0439446_0219155
811 Ga0450908_008291
812 Ga0451576_1110053
813 Ga0495603_0669350
814 Ga0495629_0303916
815 Ga0495580_0052566
816 Ga0495580_0569632
817 Ga0495582_0329535
818 Ga0495582_0484247
819 Ga0495662_0327037
820 Ga0495662_0544930
821 Ga0495608_0057657
822 Ga0495618_0025686
823 Ga0495628_0014399
824 Ga0495630_0025482
825 Ga0495630_0200266
826 Ga0495630_0244056
827 Ga0495630_0476560
828 Ga0495652_0069874
829 Ga0495640_0065239
830 Ga0495640_0399608
831 Ga0495586_0031679
832 Ga0495586_0385931
833 Ga0495634_0022335
834 Ga0495634_0142906
835 Ga0495634_0615891
836 Ga0495635_0414962
837 Ga0495635_0792400
838 Ga0495588_0196637
839 Ga0495657_0110961
840 Ga0495647_0101305
841 Ga0495647_0252034
842 Ga0495658_0014047
843 Ga0495658_0331252
844 Ga0495613_0000383
845 Ga0495613_0122775
846 Ga0495624_0707807
847 Ga0495670_0277683
848 Ga0495600_0024338
849 Ga0495604_0125294
850 Ga0495636_0026291
851 Ga0495636_0066950
852 Ga0495674_0016421
853 Ga0495674_0111913
854 Ga0495674_0343170
855 Ga0495680_0548573
856 Ga0495675_0249357
857 Ga0495684_0000859
858 Ga0495684_0194762
859 Ga0495684_0415785
860 Ga0495684_0592468
861 Ga0495684_0686007
862 Ga0496104_0389552
863 Ga0496104_0624363
864 Ga0496109_0735108
865 Ga0496109_0993465
866 Ga0501040_0489259
867 Ga0501041_0029451
868 Ga0501042_0067656
869 Ga0501071_0205379
870 Ga0501072_0026367
871 Ga0501073_0279463
872 Ga0501075_0222385
873 Ga0501076_0025688
874 Ga0501080_0601527
875 Ga0501081_0911037
876 Ga0501083_0017579
877 nmdc:mga03683_594444_c1
878 nmdc:mga05p37_154323_c1
879 nmdc:mga05p37_225942_c1
880 nmdc:mga05p37_232588_c1
881 nmdc:mga05p37_318298_c1
882 nmdc:mga05p37_37744_c1
883 nmdc:mga05p37_73776_c1
884 nmdc:mga05p37_881868_c1
885 nmdc:mga09592_106527_c1
886 nmdc:mga09592_156004_c1
887 nmdc:mga09592_405112_c1
888 nmdc:mga09592_4361_c1
889 nmdc:mga0qj67_174553_c1
890 nmdc:mga06r32_114504_c1
891 nmdc:mga06r32_438708_c1
892 nmdc:mga06r32_65921_c1
893 nmdc:mga08y16_123488_c1
894 nmdc:mga08y16_75114_c1
895 nmdc:mga0n895_1173940_c1
896 nmdc:mga0n895_1511157_c1
897 nmdc:mga0n895_177113_c1
898 nmdc:mga0n895_281684_c1
899 nmdc:mga0rr50_147715_c1
900 nmdc:mga0rr50_477900_c1
901 nmdc:mga0rr50_554651_c1
902 nmdc:mga0rr50_738843_c1
903 nmdc:mga0a205_1108100_c1
904 nmdc:mga0a205_143252_c1
905 nmdc:mga0a205_20985_c1
906 nmdc:mga0a205_301951_c1
907 nmdc:mga0a205_44378_c1
908 nmdc:mga0a205_55103_c1
909 Ga0495601_0006558
910 Ga0495601_0255492
911 Ga0495601_0281966
912 Ga0495595_0062740
913 Ga0495619_0000790
914 Ga0495619_0389323
915 Ga0495619_0541442
916 Ga0500556_0013284
917 Ga0501084_0665034
918 Ga0530510_0572735

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

73

146

0.94

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

6

72

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4c7y-assembly1.cif.gz_A aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide 0.9552 1 149
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.947 1 151
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.946 1 151
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.9452 2 153
5g5h-assembly1.cif.gz_A escherichia coli periplasmic aldehyde oxidase r440h mutant 0.9412 1 149
ID Description Score Start End Superfamily
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9449 1 75 3.10.20.30
1alo001 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9428 1 72 3.10.20.30
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9361 1 75 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.934 1 75 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9324 1 74 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A2V9DAT7-F1-model_v4 (2Fe-2S)-binding protein 0.9863 1 151 GO:0016491
GO:0046872
GO:0051537
AF-A0A830F942-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9785 1 151 GO:0016491
GO:0046872
GO:0051537
AF-A0A535EJI5-F1-model_v4 (2Fe-2S)-binding protein 0.9771 2 150 GO:0016020
GO:0016491
GO:0046872
GO:0051537
AF-A0A807CKA1-F1-model_v4 deleted 0.9763 6 152
AF-A0A7S7UDG4-F1-model_v4 (2Fe-2S)-binding protein 0.9751 2 151 GO:0016491
GO:0046872
GO:0051537

Map