F448303

General Info

Members Datasets Scaffolds Average Seq Length
459 229 918 207

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100542659|Ga0070683_1005426592
Length 244
Sequence MTIHARWMVAQIVLPDEKSDGRVLSGKLHPRGGNVTMADEPFIARGFHSRRQTAPANRLPPGQYETRDFPVLSAGPTPQTSLAEWDFRIEGLDGKSMRWSWTDILALPHETPTVDIHCVTKWSKFDTKWEGVSVDLLLDAARDAGVAEQPFIMAFSDGGYTTNLPRGDLTGGKAWIVFLYDDALLAPEHGGPVRLLVPHLYFWKSAKWLRGLRMMERDDPGFWEQLGYHDRGDPWREQRYQGDP

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
140 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
143 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
144 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
161 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
162 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
163 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
164 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
192 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
205 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
227 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
228 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
229 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 1.96
Rhizosphere 97.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100542659 3300005329 Bacteria 1112
2 JGI25407J50210_10043503 3300003373 Bacteria 1148
3 Ga0058863_11902036 3300004799 Bacteria 909
4 Ga0058862_12059109 3300004803 Bacteria 907
5 Ga0070658_10174876 3300005327 Bacteria 1805
6 Ga0070658_10810277 3300005327 Bacteria 814
7 Ga0070683_100000883 3300005329 Bacteria 22241
8 Ga0070683_100068420 3300005329 Bacteria 3309
9 Ga0070683_100097401 3300005329 Bacteria 2767
10 Ga0070683_100097656 3300005329 Bacteria 2763
11 Ga0070683_100191804 3300005329 Bacteria 1940
12 Ga0070683_100215569 3300005329 Bacteria 1824
13 Ga0068869_100002995 3300005334 Bacteria 10263
14 Ga0068869_100342488 3300005334 Bacteria 1217
15 Ga0070666_10297365 3300005335 Bacteria 1149
16 Ga0070666_10374335 3300005335 Bacteria 1022
17 Ga0070680_100008644 3300005336 Bacteria 7806
18 Ga0070680_100031126 3300005336 Bacteria 4289
19 Ga0070682_100155254 3300005337 Bacteria 1575
20 Ga0070682_100381052 3300005337 Bacteria 1061
21 Ga0068868_100011008 3300005338 Bacteria 6573
22 Ga0070660_100095149 3300005339 Bacteria 2354
23 Ga0070660_100411938 3300005339 Bacteria 1118
24 Ga0070689_100053767 3300005340 Bacteria 3117
25 Ga0070689_100057848 3300005340 Bacteria 3010
26 Ga0070661_100092915 3300005344 Bacteria 2236
27 Ga0070692_10078359 3300005345 Bacteria 1774
28 Ga0070668_100267427 3300005347 Bacteria 1424
29 Ga0070669_100129809 3300005353 Bacteria 1932
30 Ga0070669_100276172 3300005353 Bacteria 1345
31 Ga0070675_100041984 3300005354 Bacteria 3736
32 Ga0070671_100109159 3300005355 Bacteria 2323
33 Ga0070671_100798581 3300005355 Bacteria 822
34 Ga0070674_100303044 3300005356 Bacteria 1274
35 Ga0070673_100037216 3300005364 Bacteria 3706
36 Ga0070673_100243674 3300005364 Bacteria 1564
37 Ga0070667_100200062 3300005367 Bacteria 1773
38 Ga0070709_10060446 3300005434 Bacteria 2409
39 Ga0070709_10076859 3300005434 Bacteria 2169
40 Ga0070709_10158648 3300005434 Bacteria 1571
41 Ga0070714_100024811 3300005435 Bacteria 4942
42 Ga0070714_100102286 3300005435 Bacteria 2526
43 Ga0070713_100000829 3300005436 Bacteria 19766
44 Ga0070713_100003924 3300005436 Bacteria 9875
45 Ga0070713_100100078 3300005436 Bacteria 2509
46 Ga0070713_100272996 3300005436 Bacteria 1549
47 Ga0070710_10242524 3300005437 Bacteria 1155
48 Ga0070701_10177857 3300005438 Bacteria 1243
49 Ga0070711_100118117 3300005439 Bacteria 1957
50 Ga0070711_100228566 3300005439 Bacteria 1450
51 Ga0070708_100000396 3300005445 Bacteria 32956
52 Ga0070663_100115503 3300005455 Bacteria 2022
53 Ga0070662_100906779 3300005457 Bacteria 752
54 Ga0070681_10000348 3300005458 Bacteria 37221
55 Ga0070681_10011604 3300005458 Bacteria 8723
56 Ga0070681_10020604 3300005458 Bacteria 6607
57 Ga0070681_10049003 3300005458 Bacteria 4219
58 Ga0070681_10503053 3300005458 Bacteria 1125
59 Ga0070685_10093777 3300005466 Bacteria 1822
60 Ga0070698_100004324 3300005471 Bacteria 15611
61 Ga0070698_100006459 3300005471 Bacteria 12719
62 Ga0070698_100077051 3300005471 Bacteria 3335
63 Ga0070698_100083604 3300005471 Bacteria 3181
64 Ga0070699_100301912 3300005518 Bacteria 1436
65 Ga0070699_100342291 3300005518 Bacteria 1346
66 Ga0070679_100026032 3300005530 Bacteria 5741
67 Ga0070679_100042925 3300005530 Bacteria 4504
68 Ga0070679_100082609 3300005530 Bacteria 3202
69 Ga0070684_100004126 3300005535 Bacteria 10996
70 Ga0070684_100006050 3300005535 Bacteria 9324
71 Ga0070684_100012232 3300005535 Bacteria 6869
72 Ga0070684_100021969 3300005535 Bacteria 5316
73 Ga0070684_100033197 3300005535 Bacteria 4405
74 Ga0070684_100075275 3300005535 Bacteria 2977
75 Ga0070684_100546710 3300005535 Bacteria 1075
76 Ga0068853_100779523 3300005539 Bacteria 915
77 Ga0068853_100784160 3300005539 Bacteria 912
78 Ga0070695_100022768 3300005545 Bacteria 3845
79 Ga0070693_100021198 3300005547 Bacteria 3440
80 Ga0068855_100017908 3300005563 Bacteria 8511
81 Ga0070664_100001717 3300005564 Bacteria 17542
82 Ga0070664_100063696 3300005564 Bacteria 3143
83 Ga0070664_100161721 3300005564 Bacteria 1981
84 Ga0070664_100841820 3300005564 Bacteria 859
85 Ga0068856_100079032 3300005614 Bacteria 3261
86 Ga0068856_100414467 3300005614 Bacteria 1367
87 Ga0068856_100468891 3300005614 Bacteria 1280
88 Ga0068852_100004916 3300005616 Bacteria 9489
89 Ga0068852_100033551 3300005616 Bacteria 4263
90 Ga0068852_100620987 3300005616 Bacteria 1086
91 Ga0068852_100725600 3300005616 Bacteria 1005
92 Ga0068852_100783329 3300005616 Bacteria 967
93 Ga0068859_100016698 3300005617 Bacteria 7371
94 Ga0068864_100509575 3300005618 Bacteria 1159
95 Ga0068870_10049984 3300005840 Bacteria 2208
96 Ga0068870_10078758 3300005840 Bacteria 1816
97 Ga0068870_10365512 3300005840 Bacteria 930
98 Ga0068863_100110249 3300005841 Bacteria 2621
99 Ga0068860_100136153 3300005843 Bacteria 2359
100 Ga0068862_100630188 3300005844 Bacteria 1032
101 Ga0068862_101190981 3300005844 Bacteria 760
102 Ga0081538_10002653 3300005981 Bacteria 17264
103 Ga0081538_10003648 3300005981 Bacteria 14463
104 Ga0081538_10015604 3300005981 Bacteria 5870
105 Ga0081538_10021354 3300005981 Bacteria 4729
106 Ga0081538_10093753 3300005981 Bacteria 1540
107 Ga0081538_10198810 3300005981 Bacteria 827
108 Ga0070717_10002146 3300006028 Bacteria 13832
109 Ga0070717_10116470 3300006028 Bacteria 2285
110 Ga0070712_100016287 3300006175 Bacteria 4802
111 Ga0070712_100103976 3300006175 Bacteria 2106
112 Ga0097621_100071067 3300006237 Bacteria 2875
113 Ga0068871_100255132 3300006358 Bacteria 1528
114 Ga0075431_100112491 3300006847 Bacteria 2810
115 Ga0075431_100677721 3300006847 Bacteria 1010
116 Ga0075433_10027571 3300006852 Bacteria 4819
117 Ga0075433_10045298 3300006852 Bacteria 3823
118 Ga0075434_100007443 3300006871 Bacteria 10126
119 Ga0075434_100073873 3300006871 Bacteria 3403
120 Ga0075434_100089003 3300006871 Bacteria 3089
121 Ga0068865_100402794 3300006881 Bacteria 1121
122 Ga0068865_100824735 3300006881 Bacteria 802
123 Ga0097620_100016696 3300006931 Bacteria 7371
124 Ga0105240_10308889 3300009093 Bacteria 1806
125 Ga0111539_10465985 3300009094 Bacteria 1471
126 Ga0105245_10046458 3300009098 Bacteria 3880
127 Ga0105245_10190250 3300009098 Bacteria 1965
128 Ga0114129_10178930 3300009147 Bacteria 2887
129 Ga0114129_10228590 3300009147 Bacteria 2506
130 Ga0114129_10373907 3300009147 Bacteria 1883
131 Ga0105241_10040085 3300009174 Bacteria 3535
132 Ga0105241_10357319 3300009174 Bacteria 1270
133 Ga0105242_10127713 3300009176 Bacteria 2190
134 Ga0105248_10001376 3300009177 Bacteria 27106
135 Ga0105248_10045804 3300009177 Bacteria 4904
136 Ga0105248_10100101 3300009177 Bacteria 3266
137 Ga0105248_10334376 3300009177 Bacteria 1706
138 Ga0105248_10678745 3300009177 Bacteria 1162
139 Ga0105238_10013267 3300009551 Bacteria 8315
140 Ga0105238_10017179 3300009551 Bacteria 7348
141 Ga0105238_11092712 3300009551 Bacteria 820
142 Ga0105239_10024368 3300010375 Bacteria 6667
143 Ga0105239_10845559 3300010375 Bacteria 1049
144 Ga0105246_10001642 3300011119 Bacteria 13334
145 Ga0105246_10730527 3300011119 Bacteria 871
146 Ga0157373_10003959 3300013100 Bacteria 11188
147 Ga0157371_10027697 3300013102 Bacteria 4109
148 Ga0157370_10000931 3300013104 Bacteria 37069
149 Ga0157369_10081783 3300013105 Bacteria 3456
150 Ga0157369_10100291 3300013105 Bacteria 3087
151 Ga0157369_10183954 3300013105 Bacteria 2198
152 Ga0157369_10586710 3300013105 Bacteria 1151
153 Ga0157369_10878525 3300013105 Bacteria 920
154 Ga0157374_10008890 3300013296 Bacteria 8603
155 Ga0157374_10498538 3300013296 Bacteria 1222
156 Ga0157374_10700464 3300013296 Bacteria 1026
157 Ga0157372_10002700 3300013307 Bacteria 19181
158 Ga0157372_10011103 3300013307 Bacteria 9579
159 Ga0157372_10040599 3300013307 Bacteria 5140
160 Ga0157372_10208490 3300013307 Bacteria 2264
161 Ga0157372_10650887 3300013307 Bacteria 1227
162 Ga0157375_10017121 3300013308 Bacteria 6533
163 Ga0157375_10061877 3300013308 Bacteria 3718
164 Ga0157375_10135971 3300013308 Bacteria 2582
165 Ga0157375_10312240 3300013308 Bacteria 1736
166 Ga0163163_10001207 3300014325 Bacteria 21860
167 Ga0157377_10000926 3300014745 Bacteria 12256
168 Ga0157377_10040961 3300014745 Bacteria 2567
169 Ga0157376_10550775 3300014969 Bacteria 1141
170 Ga0157376_10772831 3300014969 Bacteria 971
171 Ga0163161_10210258 3300017792 Bacteria 1503
172 Ga0207692_10201359 3300025898 Bacteria 1171
173 Ga0207680_10087626 3300025903 Bacteria 1972
174 Ga0207699_10037957 3300025906 Bacteria 2757
175 Ga0207699_10292626 3300025906 Bacteria 1135
176 Ga0207645_10080117 3300025907 Bacteria 2093
177 Ga0207643_10052180 3300025908 Bacteria 2322
178 Ga0207643_10196607 3300025908 Bacteria 1226
179 Ga0207643_10463100 3300025908 Bacteria 808
180 Ga0207705_10118312 3300025909 Bacteria 1964
181 Ga0207705_10309671 3300025909 Bacteria 1212
182 Ga0207684_10420947 3300025910 Bacteria 1148
183 Ga0207654_10183647 3300025911 Bacteria 1366
184 Ga0207707_10013188 3300025912 Bacteria 7205
185 Ga0207707_10020501 3300025912 Bacteria 5773
186 Ga0207707_10241057 3300025912 Bacteria 1572
187 Ga0207707_10762779 3300025912 Bacteria 808
188 Ga0207695_10124589 3300025913 Bacteria 2541
189 Ga0207693_10033841 3300025915 Bacteria 4031
190 Ga0207663_10326246 3300025916 Bacteria 1155
191 Ga0207660_10011054 3300025917 Bacteria 5871
192 Ga0207660_10037802 3300025917 Bacteria 3366
193 Ga0207657_10093187 3300025919 Bacteria 2509
194 Ga0207657_10328090 3300025919 Bacteria 1209
195 Ga0207649_10007492 3300025920 Bacteria 5934
196 Ga0207649_10549880 3300025920 Bacteria 883
197 Ga0207652_10008476 3300025921 Bacteria 8272
198 Ga0207652_10156909 3300025921 Bacteria 2039
199 Ga0207694_10082712 3300025924 Bacteria 2524
200 Ga0207694_10217229 3300025924 Bacteria 1559
201 Ga0207650_10162303 3300025925 Bacteria 1771
202 Ga0207687_10119311 3300025927 Bacteria 1970
203 Ga0207700_10058027 3300025928 Bacteria 2922
204 Ga0207700_10097022 3300025928 Bacteria 2342
205 Ga0207700_10195210 3300025928 Bacteria 1703
206 Ga0207700_10666807 3300025928 Bacteria 928
207 Ga0207664_10015650 3300025929 Bacteria 5513
208 Ga0207664_10119781 3300025929 Bacteria 2201
209 Ga0207664_10511887 3300025929 Bacteria 1075
210 Ga0207644_10094288 3300025931 Bacteria 2236
211 Ga0207690_10028702 3300025932 Bacteria 3528
212 Ga0207690_10171406 3300025932 Bacteria 1626
213 Ga0207690_10416615 3300025932 Bacteria 1074
214 Ga0207706_10015647 3300025933 Bacteria 6854
215 Ga0207706_10112838 3300025933 Bacteria 2391
216 Ga0207706_10406495 3300025933 Bacteria 1180
217 Ga0207686_10122373 3300025934 Bacteria 1773
218 Ga0207670_10029940 3300025936 Bacteria 3473
219 Ga0207670_10221299 3300025936 Bacteria 1449
220 Ga0207669_10038319 3300025937 Bacteria 2759
221 Ga0207669_10212501 3300025937 Bacteria 1413
222 Ga0207704_10085565 3300025938 Bacteria 2053
223 Ga0207665_10271246 3300025939 Bacteria 1260
224 Ga0207691_10028742 3300025940 Bacteria 5204
225 Ga0207691_10555864 3300025940 Bacteria 973
226 Ga0207711_10315062 3300025941 Bacteria 1445
227 Ga0207711_10462190 3300025941 Bacteria 1182
228 Ga0207689_10000347 3300025942 Bacteria 43284
229 Ga0207689_10225497 3300025942 Bacteria 1549
230 Ga0207661_10001266 3300025944 Bacteria 16897
231 Ga0207661_10040367 3300025944 Bacteria 3668
232 Ga0207661_10042764 3300025944 Bacteria 3573
233 Ga0207661_10051842 3300025944 Bacteria 3275
234 Ga0207661_10172621 3300025944 Bacteria 1883
235 Ga0207661_10239984 3300025944 Bacteria 1608
236 Ga0207661_10329864 3300025944 Bacteria 1373
237 Ga0207661_10879222 3300025944 Bacteria 825
238 Ga0207679_10077195 3300025945 Bacteria 2533
239 Ga0207679_10082999 3300025945 Bacteria 2455
240 Ga0207679_10086594 3300025945 Bacteria 2410
241 Ga0207679_10246961 3300025945 Bacteria 1515
242 Ga0207679_10395874 3300025945 Bacteria 1214
243 Ga0207679_10904367 3300025945 Bacteria 807
244 Ga0207667_10227174 3300025949 Bacteria 1912
245 Ga0207651_10025441 3300025960 Bacteria 3679
246 Ga0207668_10220059 3300025972 Bacteria 1524
247 Ga0207640_11016758 3300025981 Bacteria 730
248 Ga0207639_10752503 3300026041 Bacteria 906
249 Ga0207639_11067298 3300026041 Bacteria 757
250 Ga0207708_10748173 3300026075 Bacteria 839
251 Ga0207702_10067021 3300026078 Bacteria 3079
252 Ga0207702_10181611 3300026078 Bacteria 1938
253 Ga0207641_10055388 3300026088 Bacteria 3367
254 Ga0207676_10034340 3300026095 Bacteria 3839
255 Ga0207676_10106948 3300026095 Bacteria 2332
256 Ga0207676_10249149 3300026095 Bacteria 1598
257 Ga0207674_10000102 3300026116 Bacteria 97500
258 Ga0207674_10003962 3300026116 Bacteria 18000
259 Ga0207683_10623204 3300026121 Bacteria 999
260 Ga0207698_10003334 3300026142 Bacteria 9660
261 Ga0207698_10088939 3300026142 Bacteria 2520
262 Ga0207698_10568679 3300026142 Bacteria 1113
263 Ga0207698_10831507 3300026142 Bacteria 927
264 Ga0207428_10107740 3300027907 Bacteria 2146
265 Ga0268266_11582205 3300028379 Bacteria 631
266 Ga0307405_10021395 3300031731 Bacteria 3635
267 Ga0307405_10155357 3300031731 Bacteria 1614
268 Ga0307413_10000291 3300031824 Bacteria 15454
269 Ga0307413_10503391 3300031824 Bacteria 973
270 Ga0307410_10030328 3300031852 Bacteria 3455
271 Ga0307410_10077604 3300031852 Bacteria 2322
272 Ga0307410_10426396 3300031852 Bacteria 1077
273 Ga0307406_10992197 3300031901 Bacteria 720
274 Ga0307407_10092852 3300031903 Bacteria 1854
275 Ga0307412_10043384 3300031911 Plasmid 2928
276 Ga0307409_100181920 3300031995 Bacteria 1862
277 Ga0307416_100315070 3300032002 Bacteria 1563
278 Ga0307414_10002713 3300032004 Bacteria 9318
279 Ga0307415_100140738 3300032126 Bacteria 1842
280 Ga0307415_100780808 3300032126 Bacteria 870
281 Ga0373926_0000713 3300035083 Bacteria 9203
282 Ga0373934_0008983 3300035086 Bacteria 3735
283 Ga0373934_0053739 3300035086 Bacteria 1598
284 Ga0373945_0016287 3300035116 Bacteria 2505
285 Ga0373945_0092083 3300035116 Bacteria 1175
286 Ga0373954_0003431 3300035118 Bacteria 6719
287 Ga0373954_0114083 3300035118 Bacteria 1308
288 Ga0373954_0168164 3300035118 Bacteria 1073
289 Ga0373956_0000068 3300035119 Bacteria 34707
290 Ga0373956_0258472 3300035119 Bacteria 828
291 Ga0373957_0004539 3300035120 Bacteria 4229
292 Ga0373943_0098055 3300035170 Bacteria 1528
293 Ga0373955_0001820 3300035172 Bacteria 9167
294 Ga0373955_0013742 3300035172 Bacteria 3924
295 Ga0373955_0030136 3300035172 Bacteria 2829
296 Ga0373924_0002018 3300035410 Bacteria 6762
297 Ga0373935_0076533 3300035692 Bacteria 2167
298 Ga0373935_0153404 3300035692 Bacteria 1565
299 Ga0373927_0005749 3300035695 Bacteria 8517
300 Ga0373927_0011068 3300035695 Bacteria 6009
301 Ga0373927_0343708 3300035695 Bacteria 983
302 Ga0373933_0000503 3300035724 Bacteria 24369
303 Ga0373933_0003846 3300035724 Bacteria 8291
304 Ga0373933_0087054 3300035724 Bacteria 1923
305 Ga0373947_0001768 3300035725 Bacteria 13224
306 Ga0373947_0572074 3300035725 Bacteria 770
307 Ga0373937_0000273 3300036401 Bacteria 49629
308 Ga0373937_0004756 3300036401 Bacteria 11543
309 Ga0373937_0005467 3300036401 Bacteria 10880
310 Ga0373937_0008767 3300036401 Bacteria 8777
311 Ga0373937_0325680 3300036401 Bacteria 1454
312 Ga0373925_0002383 3300037068 Bacteria 15079
313 Ga0373925_0150314 3300037068 Bacteria 1828
314 Ga0373925_0753618 3300037068 Bacteria 803
315 Ga0395899_0001040 3300037312 Bacteria 25180
316 Ga0395899_0030718 3300037312 Bacteria 4039
317 Ga0395900_0012312 3300037418 Bacteria 8750
318 Ga0395900_0045568 3300037418 Bacteria 4517
319 Ga0395900_0133913 3300037418 Bacteria 2539
320 Ga0395900_0936019 3300037418 Bacteria 788
321 Ga0395898_0002977 3300037466 Bacteria 19256
322 Ga0395898_0598335 3300037466 Bacteria 1045
323 Ga0395898_0722239 3300037466 Bacteria 938
324 Ga0395905_0001457 3300037471 Bacteria 28383
325 Ga0395905_0004952 3300037471 Bacteria 13726
326 Ga0395905_0017094 3300037471 Bacteria 6889
327 Ga0395905_0111637 3300037471 Bacteria 2567
328 Ga0395905_1045887 3300037471 Bacteria 719
329 Ga0395901_0003303 3300038443 Bacteria 16239
330 Ga0395901_0017616 3300038443 Bacteria 7294
331 Ga0395901_0645282 3300038443 Bacteria 1062
332 Ga0436365_1726020 3300039437 Bacteria 5101
333 Ga0451791_0443262 3300041451 Bacteria 4686
334 Ga0451797_1256129 3300041453 Bacteria 2092
335 Ga0451802_1751286 3300041460 Bacteria 1083
336 Ga0451843_0520066 3300041509 Bacteria 1206
337 Ga0450905_000964 3300042142 Bacteria 3605
338 Ga0466963_0739938 3300044694 Bacteria 694
339 Ga0495592_0015799 3300046454 Bacteria 5727
340 Ga0495603_0015333 3300046455 Bacteria 4637
341 Ga0495629_0003621 3300046459 Bacteria 11679
342 Ga0495629_0023355 3300046459 Bacteria 4407
343 Ga0495629_0525472 3300046459 Bacteria 796
344 Ga0495651_0000134 3300046462 Bacteria 55066
345 Ga0495651_0003354 3300046462 Bacteria 12299
346 Ga0495653_0000301 3300046463 Bacteria 40070
347 Ga0495653_0005233 3300046463 Bacteria 10550
348 Ga0495580_0003305 3300046472 Bacteria 13784
349 Ga0495580_0013077 3300046472 Bacteria 6354
350 Ga0495580_0043729 3300046472 Bacteria 3187
351 Ga0495582_0005202 3300046473 Bacteria 7281
352 Ga0495582_0011116 3300046473 Bacteria 4957
353 Ga0495582_0011481 3300046473 Bacteria 4880
354 Ga0495582_0081485 3300046473 Bacteria 1797
355 Ga0495639_0006333 3300046475 Bacteria 5086
356 Ga0495639_0022378 3300046475 Bacteria 2772
357 Ga0495664_0013797 3300046477 Bacteria 4581
358 Ga0495664_0171437 3300046477 Bacteria 1316
359 Ga0495594_0057333 3300046499 Bacteria 2151
360 Ga0495594_0099218 3300046499 Bacteria 1638
361 Ga0495594_0473008 3300046499 Bacteria 712
362 Ga0495608_0004393 3300046511 Bacteria 10101
363 Ga0495608_0006261 3300046511 Bacteria 8446
364 Ga0495608_0254537 3300046511 Bacteria 1094
365 Ga0495618_0038813 3300046514 Bacteria 2994
366 Ga0495628_0000996 3300046516 Bacteria 25892
367 Ga0495628_0039729 3300046516 Bacteria 3762
368 Ga0495630_0000753 3300046517 Bacteria 22806
369 Ga0495630_0005167 3300046517 Bacteria 9196
370 Ga0495630_0612302 3300046517 Bacteria 835
371 Ga0495652_0003504 3300046529 Bacteria 15451
372 Ga0495652_0009234 3300046529 Bacteria 8962
373 Ga0495652_0063098 3300046529 Bacteria 3121
374 Ga0495665_0004926 3300046531 Bacteria 7197
375 Ga0495665_0083761 3300046531 Bacteria 1677
376 Ga0495640_0233449 3300046533 Bacteria 1156
377 Ga0495586_0005377 3300046535 Bacteria 6847
378 Ga0495586_0258056 3300046535 Bacteria 995
379 Ga0495587_0000161 3300046536 Bacteria 48660
380 Ga0495587_0002381 3300046536 Bacteria 12555
381 Ga0495587_0005762 3300046536 Bacteria 8072
382 Ga0495645_0000549 3300046543 Bacteria 25780
383 Ga0495645_0003618 3300046543 Bacteria 10490
384 Ga0495645_0010657 3300046543 Bacteria 6452
385 Ga0495667_0002128 3300046559 Bacteria 13185
386 Ga0495667_0041223 3300046559 Bacteria 3062
387 Ga0495667_0043882 3300046559 Bacteria 2961
388 Ga0495635_0204812 3300046663 Bacteria 1337
389 Ga0495588_0024544 3300046674 Bacteria 2996
390 Ga0495657_0001277 3300046675 Bacteria 21884
391 Ga0495657_0032644 3300046675 Bacteria 3632
392 Ga0495599_0006403 3300046678 Bacteria 7101
393 Ga0495599_0016146 3300046678 Bacteria 4633
394 Ga0495599_0026004 3300046678 Bacteria 3667
395 Ga0495599_0061598 3300046678 Bacteria 2344
396 Ga0495623_0000025 3300046679 Bacteria 91529
397 Ga0495623_0022193 3300046679 Bacteria 4100
398 Ga0495623_0024224 3300046679 Bacteria 3914
399 Ga0495623_0086247 3300046679 Bacteria 1935
400 Ga0495646_0000124 3300046680 Bacteria 38603
401 Ga0495658_0000551 3300046683 Bacteria 20476
402 Ga0495658_0097069 3300046683 Bacteria 1754
403 Ga0495613_0015501 3300046689 Bacteria 5667
404 Ga0495613_0106974 3300046689 Bacteria 2018
405 Ga0495613_0198189 3300046689 Bacteria 1417
406 Ga0495613_0464249 3300046689 Bacteria 856
407 Ga0495600_0000448 3300046809 Bacteria 21287
408 Ga0495581_0016141 3300047315 Bacteria 4341
409 Ga0495581_0077014 3300047315 Bacteria 1929
410 Ga0495604_0000438 3300047317 Bacteria 37078
411 Ga0495604_0007757 3300047317 Bacteria 8500
412 Ga0495674_0008018 3300047319 Bacteria 10083
413 Ga0495674_0084293 3300047319 Bacteria 2724
414 Ga0495680_0003759 3300047322 Bacteria 14776
415 Ga0495680_0151208 3300047322 Bacteria 1692
416 Ga0495675_0002382 3300047444 Bacteria 11235
417 Ga0495675_0003352 3300047444 Bacteria 9647
418 Ga0495675_0006264 3300047444 Bacteria 7281
419 Ga0495675_0041384 3300047444 Bacteria 2937
420 Ga0495684_0000159 3300047471 Bacteria 50484
421 Ga0495684_0015646 3300047471 Bacteria 5838
422 Ga0495684_0017829 3300047471 Bacteria 5469
423 Ga0495684_0045813 3300047471 Bacteria 3346
424 Ga0495593_0000311 3300047673 Bacteria 26705
425 Ga0495593_0091122 3300047673 Bacteria 1570
426 Ga0495602_0001213 3300048088 Bacteria 25362
427 Ga0495602_0033538 3300048088 Bacteria 4815
428 Ga0495614_0000126 3300048089 Bacteria 26558
429 Ga0495615_0061848 3300048090 Bacteria 990
430 Ga0496101_0160860 3300048904 Bacteria 1722
431 Ga0496109_0082819 3300048912 Bacteria 2958
432 Ga0496112_0003544 3300048915 Bacteria 12961
433 Ga0496112_0039763 3300048915 Bacteria 4597
434 Ga0496113_0285268 3300048916 Bacteria 1321
435 Ga0496113_0553630 3300048916 Bacteria 922
436 Ga0501048_0495074 3300049582 Bacteria 876
437 Ga0501067_0423563 3300049583 Bacteria 743
438 Ga0501070_0672033 3300049586 Bacteria 821
439 Ga0501072_0007776 3300049588 Bacteria 8142
440 Ga0501083_0095684 3300049744 Bacteria 1959
441 Ga0501045_0574705 3300049824 Bacteria 835
442 nmdc:mga06z11_108012_c1 3300050494 Bacteria 1537
443 nmdc:mga05p37_150936_c1 3300050507 Bacteria 2842
444 nmdc:mga0qj67_886503_c1 3300050509 Bacteria 703
445 nmdc:mga06r32_250022_c1 3300050510 Bacteria 862
446 nmdc:mga06r32_99939_c1 3300050510 Bacteria 2846
447 nmdc:mga0n895_173823_c1 3300050512 Bacteria 2185
448 nmdc:mga0n895_5654_c1 3300050512 Bacteria 10479
449 nmdc:mga0rr50_21514_c1 3300050513 Bacteria 4405
450 nmdc:mga0a205_147257_c1 3300050515 Bacteria 2255
451 nmdc:mga0a205_18573_c1 3300050515 Bacteria 6540
452 Ga0495601_0126554 3300053077 Bacteria 1662
453 Ga0495612_0001517 3300053078 Bacteria 9557
454 Ga0495612_0063535 3300053078 Bacteria 1531
455 Ga0495619_0000210 3300053085 Bacteria 42468
456 Ga0500658_0010522 3300053134 Bacteria 3412
457 Ga0590074_003376 3300059423 Bacteria 2635
458 Ga0590075_004634 3300059424 Bacteria 3256
459 Ga0590077_004739 3300059426 Bacteria 2784
460 Ga0070683_100542659
461 JGI25407J50210_10043503
462 Ga0058863_11902036
463 Ga0058862_12059109
464 Ga0070658_10174876
465 Ga0070658_10810277
466 Ga0070683_100000883
467 Ga0070683_100068420
468 Ga0070683_100097401
469 Ga0070683_100097656
470 Ga0070683_100191804
471 Ga0070683_100215569
472 Ga0068869_100002995
473 Ga0068869_100342488
474 Ga0070666_10297365
475 Ga0070666_10374335
476 Ga0070680_100008644
477 Ga0070680_100031126
478 Ga0070682_100155254
479 Ga0070682_100381052
480 Ga0068868_100011008
481 Ga0070660_100095149
482 Ga0070660_100411938
483 Ga0070689_100053767
484 Ga0070689_100057848
485 Ga0070661_100092915
486 Ga0070692_10078359
487 Ga0070668_100267427
488 Ga0070669_100129809
489 Ga0070669_100276172
490 Ga0070675_100041984
491 Ga0070671_100109159
492 Ga0070671_100798581
493 Ga0070674_100303044
494 Ga0070673_100037216
495 Ga0070673_100243674
496 Ga0070667_100200062
497 Ga0070709_10060446
498 Ga0070709_10076859
499 Ga0070709_10158648
500 Ga0070714_100024811
501 Ga0070714_100102286
502 Ga0070713_100000829
503 Ga0070713_100003924
504 Ga0070713_100100078
505 Ga0070713_100272996
506 Ga0070710_10242524
507 Ga0070701_10177857
508 Ga0070711_100118117
509 Ga0070711_100228566
510 Ga0070708_100000396
511 Ga0070663_100115503
512 Ga0070662_100906779
513 Ga0070681_10000348
514 Ga0070681_10011604
515 Ga0070681_10020604
516 Ga0070681_10049003
517 Ga0070681_10503053
518 Ga0070685_10093777
519 Ga0070698_100004324
520 Ga0070698_100006459
521 Ga0070698_100077051
522 Ga0070698_100083604
523 Ga0070699_100301912
524 Ga0070699_100342291
525 Ga0070679_100026032
526 Ga0070679_100042925
527 Ga0070679_100082609
528 Ga0070684_100004126
529 Ga0070684_100006050
530 Ga0070684_100012232
531 Ga0070684_100021969
532 Ga0070684_100033197
533 Ga0070684_100075275
534 Ga0070684_100546710
535 Ga0068853_100779523
536 Ga0068853_100784160
537 Ga0070695_100022768
538 Ga0070693_100021198
539 Ga0068855_100017908
540 Ga0070664_100001717
541 Ga0070664_100063696
542 Ga0070664_100161721
543 Ga0070664_100841820
544 Ga0068856_100079032
545 Ga0068856_100414467
546 Ga0068856_100468891
547 Ga0068852_100004916
548 Ga0068852_100033551
549 Ga0068852_100620987
550 Ga0068852_100725600
551 Ga0068852_100783329
552 Ga0068859_100016698
553 Ga0068864_100509575
554 Ga0068870_10049984
555 Ga0068870_10078758
556 Ga0068870_10365512
557 Ga0068863_100110249
558 Ga0068860_100136153
559 Ga0068862_100630188
560 Ga0068862_101190981
561 Ga0081538_10002653
562 Ga0081538_10003648
563 Ga0081538_10015604
564 Ga0081538_10021354
565 Ga0081538_10093753
566 Ga0081538_10198810
567 Ga0070717_10002146
568 Ga0070717_10116470
569 Ga0070712_100016287
570 Ga0070712_100103976
571 Ga0097621_100071067
572 Ga0068871_100255132
573 Ga0075431_100112491
574 Ga0075431_100677721
575 Ga0075433_10027571
576 Ga0075433_10045298
577 Ga0075434_100007443
578 Ga0075434_100073873
579 Ga0075434_100089003
580 Ga0068865_100402794
581 Ga0068865_100824735
582 Ga0097620_100016696
583 Ga0105240_10308889
584 Ga0111539_10465985
585 Ga0105245_10046458
586 Ga0105245_10190250
587 Ga0114129_10178930
588 Ga0114129_10228590
589 Ga0114129_10373907
590 Ga0105241_10040085
591 Ga0105241_10357319
592 Ga0105242_10127713
593 Ga0105248_10001376
594 Ga0105248_10045804
595 Ga0105248_10100101
596 Ga0105248_10334376
597 Ga0105248_10678745
598 Ga0105238_10013267
599 Ga0105238_10017179
600 Ga0105238_11092712
601 Ga0105239_10024368
602 Ga0105239_10845559
603 Ga0105246_10001642
604 Ga0105246_10730527
605 Ga0157373_10003959
606 Ga0157371_10027697
607 Ga0157370_10000931
608 Ga0157369_10081783
609 Ga0157369_10100291
610 Ga0157369_10183954
611 Ga0157369_10586710
612 Ga0157369_10878525
613 Ga0157374_10008890
614 Ga0157374_10498538
615 Ga0157374_10700464
616 Ga0157372_10002700
617 Ga0157372_10011103
618 Ga0157372_10040599
619 Ga0157372_10208490
620 Ga0157372_10650887
621 Ga0157375_10017121
622 Ga0157375_10061877
623 Ga0157375_10135971
624 Ga0157375_10312240
625 Ga0163163_10001207
626 Ga0157377_10000926
627 Ga0157377_10040961
628 Ga0157376_10550775
629 Ga0157376_10772831
630 Ga0163161_10210258
631 Ga0207692_10201359
632 Ga0207680_10087626
633 Ga0207699_10037957
634 Ga0207699_10292626
635 Ga0207645_10080117
636 Ga0207643_10052180
637 Ga0207643_10196607
638 Ga0207643_10463100
639 Ga0207705_10118312
640 Ga0207705_10309671
641 Ga0207684_10420947
642 Ga0207654_10183647
643 Ga0207707_10013188
644 Ga0207707_10020501
645 Ga0207707_10241057
646 Ga0207707_10762779
647 Ga0207695_10124589
648 Ga0207693_10033841
649 Ga0207663_10326246
650 Ga0207660_10011054
651 Ga0207660_10037802
652 Ga0207657_10093187
653 Ga0207657_10328090
654 Ga0207649_10007492
655 Ga0207649_10549880
656 Ga0207652_10008476
657 Ga0207652_10156909
658 Ga0207694_10082712
659 Ga0207694_10217229
660 Ga0207650_10162303
661 Ga0207687_10119311
662 Ga0207700_10058027
663 Ga0207700_10097022
664 Ga0207700_10195210
665 Ga0207700_10666807
666 Ga0207664_10015650
667 Ga0207664_10119781
668 Ga0207664_10511887
669 Ga0207644_10094288
670 Ga0207690_10028702
671 Ga0207690_10171406
672 Ga0207690_10416615
673 Ga0207706_10015647
674 Ga0207706_10112838
675 Ga0207706_10406495
676 Ga0207686_10122373
677 Ga0207670_10029940
678 Ga0207670_10221299
679 Ga0207669_10038319
680 Ga0207669_10212501
681 Ga0207704_10085565
682 Ga0207665_10271246
683 Ga0207691_10028742
684 Ga0207691_10555864
685 Ga0207711_10315062
686 Ga0207711_10462190
687 Ga0207689_10000347
688 Ga0207689_10225497
689 Ga0207661_10001266
690 Ga0207661_10040367
691 Ga0207661_10042764
692 Ga0207661_10051842
693 Ga0207661_10172621
694 Ga0207661_10239984
695 Ga0207661_10329864
696 Ga0207661_10879222
697 Ga0207679_10077195
698 Ga0207679_10082999
699 Ga0207679_10086594
700 Ga0207679_10246961
701 Ga0207679_10395874
702 Ga0207679_10904367
703 Ga0207667_10227174
704 Ga0207651_10025441
705 Ga0207668_10220059
706 Ga0207640_11016758
707 Ga0207639_10752503
708 Ga0207639_11067298
709 Ga0207708_10748173
710 Ga0207702_10067021
711 Ga0207702_10181611
712 Ga0207641_10055388
713 Ga0207676_10034340
714 Ga0207676_10106948
715 Ga0207676_10249149
716 Ga0207674_10000102
717 Ga0207674_10003962
718 Ga0207683_10623204
719 Ga0207698_10003334
720 Ga0207698_10088939
721 Ga0207698_10568679
722 Ga0207698_10831507
723 Ga0207428_10107740
724 Ga0268266_11582205
725 Ga0307405_10021395
726 Ga0307405_10155357
727 Ga0307413_10000291
728 Ga0307413_10503391
729 Ga0307410_10030328
730 Ga0307410_10077604
731 Ga0307410_10426396
732 Ga0307406_10992197
733 Ga0307407_10092852
734 Ga0307412_10043384
735 Ga0307409_100181920
736 Ga0307416_100315070
737 Ga0307414_10002713
738 Ga0307415_100140738
739 Ga0307415_100780808
740 Ga0373926_0000713
741 Ga0373934_0008983
742 Ga0373934_0053739
743 Ga0373945_0016287
744 Ga0373945_0092083
745 Ga0373954_0003431
746 Ga0373954_0114083
747 Ga0373954_0168164
748 Ga0373956_0000068
749 Ga0373956_0258472
750 Ga0373957_0004539
751 Ga0373943_0098055
752 Ga0373955_0001820
753 Ga0373955_0013742
754 Ga0373955_0030136
755 Ga0373924_0002018
756 Ga0373935_0076533
757 Ga0373935_0153404
758 Ga0373927_0005749
759 Ga0373927_0011068
760 Ga0373927_0343708
761 Ga0373933_0000503
762 Ga0373933_0003846
763 Ga0373933_0087054
764 Ga0373947_0001768
765 Ga0373947_0572074
766 Ga0373937_0000273
767 Ga0373937_0004756
768 Ga0373937_0005467
769 Ga0373937_0008767
770 Ga0373937_0325680
771 Ga0373925_0002383
772 Ga0373925_0150314
773 Ga0373925_0753618
774 Ga0395899_0001040
775 Ga0395899_0030718
776 Ga0395900_0012312
777 Ga0395900_0045568
778 Ga0395900_0133913
779 Ga0395900_0936019
780 Ga0395898_0002977
781 Ga0395898_0598335
782 Ga0395898_0722239
783 Ga0395905_0001457
784 Ga0395905_0004952
785 Ga0395905_0017094
786 Ga0395905_0111637
787 Ga0395905_1045887
788 Ga0395901_0003303
789 Ga0395901_0017616
790 Ga0395901_0645282
791 Ga0436365_1726020
792 Ga0451791_0443262
793 Ga0451797_1256129
794 Ga0451802_1751286
795 Ga0451843_0520066
796 Ga0450905_000964
797 Ga0466963_0739938
798 Ga0495592_0015799
799 Ga0495603_0015333
800 Ga0495629_0003621
801 Ga0495629_0023355
802 Ga0495629_0525472
803 Ga0495651_0000134
804 Ga0495651_0003354
805 Ga0495653_0000301
806 Ga0495653_0005233
807 Ga0495580_0003305
808 Ga0495580_0013077
809 Ga0495580_0043729
810 Ga0495582_0005202
811 Ga0495582_0011116
812 Ga0495582_0011481
813 Ga0495582_0081485
814 Ga0495639_0006333
815 Ga0495639_0022378
816 Ga0495664_0013797
817 Ga0495664_0171437
818 Ga0495594_0057333
819 Ga0495594_0099218
820 Ga0495594_0473008
821 Ga0495608_0004393
822 Ga0495608_0006261
823 Ga0495608_0254537
824 Ga0495618_0038813
825 Ga0495628_0000996
826 Ga0495628_0039729
827 Ga0495630_0000753
828 Ga0495630_0005167
829 Ga0495630_0612302
830 Ga0495652_0003504
831 Ga0495652_0009234
832 Ga0495652_0063098
833 Ga0495665_0004926
834 Ga0495665_0083761
835 Ga0495640_0233449
836 Ga0495586_0005377
837 Ga0495586_0258056
838 Ga0495587_0000161
839 Ga0495587_0002381
840 Ga0495587_0005762
841 Ga0495645_0000549
842 Ga0495645_0003618
843 Ga0495645_0010657
844 Ga0495667_0002128
845 Ga0495667_0041223
846 Ga0495667_0043882
847 Ga0495635_0204812
848 Ga0495588_0024544
849 Ga0495657_0001277
850 Ga0495657_0032644
851 Ga0495599_0006403
852 Ga0495599_0016146
853 Ga0495599_0026004
854 Ga0495599_0061598
855 Ga0495623_0000025
856 Ga0495623_0022193
857 Ga0495623_0024224
858 Ga0495623_0086247
859 Ga0495646_0000124
860 Ga0495658_0000551
861 Ga0495658_0097069
862 Ga0495613_0015501
863 Ga0495613_0106974
864 Ga0495613_0198189
865 Ga0495613_0464249
866 Ga0495600_0000448
867 Ga0495581_0016141
868 Ga0495581_0077014
869 Ga0495604_0000438
870 Ga0495604_0007757
871 Ga0495674_0008018
872 Ga0495674_0084293
873 Ga0495680_0003759
874 Ga0495680_0151208
875 Ga0495675_0002382
876 Ga0495675_0003352
877 Ga0495675_0006264
878 Ga0495675_0041384
879 Ga0495684_0000159
880 Ga0495684_0015646
881 Ga0495684_0017829
882 Ga0495684_0045813
883 Ga0495593_0000311
884 Ga0495593_0091122
885 Ga0495602_0001213
886 Ga0495602_0033538
887 Ga0495614_0000126
888 Ga0495615_0061848
889 Ga0496101_0160860
890 Ga0496109_0082819
891 Ga0496112_0003544
892 Ga0496112_0039763
893 Ga0496113_0285268
894 Ga0496113_0553630
895 Ga0501048_0495074
896 Ga0501067_0423563
897 Ga0501070_0672033
898 Ga0501072_0007776
899 Ga0501083_0095684
900 Ga0501045_0574705
901 nmdc:mga06z11_108012_c1
902 nmdc:mga05p37_150936_c1
903 nmdc:mga0qj67_886503_c1
904 nmdc:mga06r32_250022_c1
905 nmdc:mga06r32_99939_c1
906 nmdc:mga0n895_173823_c1
907 nmdc:mga0n895_5654_c1
908 nmdc:mga0rr50_21514_c1
909 nmdc:mga0a205_147257_c1
910 nmdc:mga0a205_18573_c1
911 Ga0495601_0126554
912 Ga0495612_0001517
913 Ga0495612_0063535
914 Ga0495619_0000210
915 Ga0500658_0010522
916 Ga0590074_003376
917 Ga0590075_004634
918 Ga0590077_004739

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

74

223

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.8868 47 192
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.8783 42 192
2bii-assembly1.cif.gz_A crystal structure of nitrate-reducing fragment of assimilatory nitrate reductase from pichia angusta 0.8667 34 182
1sox-assembly1.cif.gz_A sulfite oxidase from chicken liver 0.8656 31 187
2a9d-assembly1.cif.gz_B crystal structure of recombinant chicken sulfite oxidase with arg at residue 161 0.8646 31 182
ID Description Score Start End Superfamily
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8908 42 192 3.90.420.10
af_P96400_291_442_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8838 45 176 3.90.420.10
2biiB01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8665 34 182 3.90.420.10
af_I1N786_1_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8601 31 187 3.90.420.10
2ca4A01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8543 35 182 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A535QEJ2-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9704 25 202
AF-A0A537VYY2-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.966 73 202
AF-A0A7V9ALQ2-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.9646 108 192 GO:0006790
GO:0008482
GO:0020037
GO:0030151
GO:0043546
AF-A0A519UX78-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9641 73 199
AF-A0A4Q6BRU9-F1-model_v4 Molybdopterin-binding oxidoreductase 0.9622 70 199

Map