metagRoot

F448277

General Info

Members	Datasets	Scaffolds	Average Seq Length
458	205	458	187

Family's Representative Sequence

Representative Sequence	3300053088\|Ga0500644_0014536\|Ga0500644_0014536_1153_1842
Length	229
Sequence	VAHCVVGALRFSLTVCQIPLAPIRISASQCIHVEILHKEEFFMYGVTDLKKGVLITLDGKPYRVIDYSQKVMGRGGSIVNVRVKNLLDGSVIPKTFKGAEKVAPASVENRTVQYLYKDGDNYNFMDGATFEQFELSSDTIGDIAPYLKEGNEVSLQSYEGKIINVELPNNLFLEVTYTENVVKGDTTSSVLKDATLETGLVVKVPAFIKLGDVIKVDTRTGEYLERKKD

Samples

	Sample ID	Description	Type	Environment
1	2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1	Metagenome	Rhizosphere
2	3300001915	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7	Metagenome	Rhizosphere
3	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
4	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
5	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
6	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
7	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
8	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
9	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
10	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
11	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
12	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
13	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
14	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
15	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
16	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
17	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
18	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
19	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
20	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
21	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
22	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
23	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
24	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
25	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
26	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
27	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
28	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
29	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
30	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
31	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
32	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
33	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
34	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
35	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
36	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
37	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
38	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
39	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
40	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
41	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
42	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
43	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
44	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
45	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
46	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
47	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
48	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
49	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
50	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
51	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
52	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
53	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
54	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
55	3300009979	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG	Metagenome	Rhizosphere
56	3300009984	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG	Metagenome	Rhizosphere
57	3300009986	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG	Metagenome	Rhizosphere
58	3300009993	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG	Metagenome	Rhizosphere
59	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
60	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
61	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
62	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
63	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
64	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
65	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
66	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
67	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
68	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
69	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
70	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
71	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
72	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
73	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
74	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
75	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
76	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
77	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
78	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
79	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
80	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
101	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
104	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
105	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
106	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
107	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
108	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
109	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
110	3300030734	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5	Metagenome	Rhizosphere
111	3300030736	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6	Metagenome	Rhizosphere
112	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
113	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
114	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
115	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
116	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
117	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
118	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
119	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
120	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
121	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
122	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
123	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
124	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
125	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
126	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
127	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
128	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
129	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
130	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
131	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
132	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
133	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
134	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
135	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
136	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
137	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
138	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
139	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
140	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
141	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
142	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
143	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
144	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
145	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
146	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
147	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
148	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
149	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
150	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
151	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
152	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
153	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
154	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
155	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
156	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
157	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
158	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
159	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
160	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
161	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
162	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
163	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
164	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
165	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
166	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
167	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
168	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
169	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
170	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
171	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
172	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
173	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
174	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
175	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
176	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
177	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
178	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
179	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
180	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
181	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
182	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
183	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
184	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
185	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
186	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
187	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
188	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
189	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
190	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
191	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
192	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
193	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
194	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
195	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
196	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
197	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
198	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
199	3300053147	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere	Metagenome	Endosphere
200	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
201	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
202	3300053722	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere	Metagenome	Endosphere
203	3300053724	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere	Metagenome	Endosphere
204	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
205	3300053738	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	30.35
Nodule	0
Rhizoplane	0.44
Rhizosphere	67.47
Stem	0
Stem Tuber	0
Unclassified	1.75

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	MBSR1b_contig_5452016	2162886012	Unclassified	1983
2	JGI24741J21665_1003818	3300001915	Bacteria	3490
3	JGI24740J21852_10002100	3300001979	Bacteria	9114
4	JGI24740J21852_10046072	3300001979	Unclassified	1282
5	JGI24740J21852_10073404	3300001979	Bacteria	911
6	JGI24737J22298_10000346	3300001990	Bacteria	15562
7	JGI24735J21928_10000055	3300002067	Bacteria	48760
8	rootH2_10004334	3300003320	Bacteria	85448
9	rootH2_10256068	3300003320	Unclassified	1738
10	rootL2_10034609	3300003322	Bacteria	5154
11	rootL2_10345480	3300003322	Bacteria	2906
12	rootH1_10001727	3300003323	Bacteria	102468
13	Ga0070658_10034525	3300005327	Bacteria	4069
14	Ga0070676_10000131	3300005328	Bacteria	28364
15	Ga0070676_10067529	3300005328	Bacteria	2138
16	Ga0070683_100000239	3300005329	Bacteria	37590
17	Ga0070683_100000380	3300005329	Bacteria	30907
18	Ga0070683_100313539	3300005329	Bacteria	1493
19	Ga0070683_101312503	3300005329	Bacteria	695
20	Ga0070670_100049074	3300005331	Bacteria	3631
21	Ga0070680_100108507	3300005336	Bacteria	2309
22	Ga0070680_100181560	3300005336	Bacteria	1772
23	Ga0070680_100345830	3300005336	Unclassified	1264
24	Ga0068868_100475767	3300005338	Bacteria	1090
25	Ga0068868_100966569	3300005338	Unclassified	777
26	Ga0070660_100000158	3300005339	Bacteria	44096
27	Ga0070660_100000226	3300005339	Bacteria	37370
28	Ga0070671_100000001	3300005355	Bacteria	1228151
29	Ga0070659_100097380	3300005366	Bacteria	2364
30	Ga0070659_100770645	3300005366	Unclassified	835
31	Ga0070667_100000503	3300005367	Bacteria	39598
32	Ga0070708_100592283	3300005445	Bacteria	1045
33	Ga0070678_100058574	3300005456	Bacteria	2828
34	Ga0070681_10060128	3300005458	Unclassified	3778
35	Ga0070681_10126730	3300005458	Bacteria	2485
36	Ga0070681_10258094	3300005458	Unclassified	1655
37	Ga0070681_10593901	3300005458	Unclassified	1021
38	Ga0070679_100004467	3300005530	Bacteria	12923
39	Ga0070679_100006731	3300005530	Bacteria	10719
40	Ga0070679_100207570	3300005530	Unclassified	1923
41	Ga0070679_100214688	3300005530	Unclassified	1887
42	Ga0070679_100219344	3300005530	Bacteria	1863
43	Ga0070679_100341741	3300005530	Bacteria	1445
44	Ga0070684_100000280	3300005535	Bacteria	35451
45	Ga0070684_100003029	3300005535	Bacteria	12528
46	Ga0070684_100013425	3300005535	Bacteria	6604
47	Ga0070684_101322644	3300005535	Bacteria	678
48	Ga0070665_100917412	3300005548	Unclassified	888
49	Ga0068855_100000002	3300005563	Bacteria	616881
50	Ga0068855_100001316	3300005563	Bacteria	30782
51	Ga0068855_101008636	3300005563	Unclassified	874
52	Ga0070664_100672032	3300005564	Unclassified	963
53	Ga0068857_100144434	3300005577	Bacteria	2152
54	Ga0068857_100308730	3300005577	Bacteria	1459
55	Ga0068857_100363740	3300005577	Bacteria	1341
56	Ga0068854_100326239	3300005578	Bacteria	1249
57	Ga0068856_100000441	3300005614	Bacteria	45741
58	Ga0068856_100002238	3300005614	Bacteria	19969
59	Ga0068856_100171882	3300005614	Bacteria	2179
60	Ga0068856_100418879	3300005614	Bacteria	1359
61	Ga0068852_100000001	3300005616	Bacteria	716526
62	Ga0068852_100000621	3300005616	Bacteria	23231
63	Ga0068852_100066076	3300005616	Unclassified	3157
64	Ga0068852_100114707	3300005616	Bacteria	2455
65	Ga0068861_100430638	3300005719	Bacteria	1177
66	Ga0068863_100180954	3300005841	Unclassified	2023
67	Ga0068858_101034077	3300005842	Unclassified	805
68	Ga0068860_100005087	3300005843	Bacteria	13372
69	Ga0068860_100066863	3300005843	Unclassified	3415
70	Ga0081455_10000006	3300005937	Bacteria	323066
71	Ga0081455_10000020	3300005937	Bacteria	172997
72	Ga0075365_10000005	3300006038	Bacteria	125137
73	Ga0075365_10000011	3300006038	Bacteria	85296
74	Ga0075365_10005061	3300006038	Bacteria	7075
75	Ga0075365_10008982	3300006038	Bacteria	5714
76	Ga0075365_10025194	3300006038	Bacteria	3764
77	Ga0075365_10128664	3300006038	Bacteria	1751
78	Ga0075365_10207579	3300006038	Bacteria	1373
79	Ga0075365_10487839	3300006038	Unclassified	871
80	Ga0075368_10000090	3300006042	Bacteria	22751
81	Ga0075364_10001478	3300006051	Bacteria	12801
82	Ga0075364_10001839	3300006051	Bacteria	11761
83	Ga0075364_10007360	3300006051	Bacteria	6534
84	Ga0075364_10010415	3300006051	Bacteria	5616
85	Ga0075364_10023820	3300006051	Bacteria	3879
86	Ga0075364_10029326	3300006051	Bacteria	3529
87	Ga0075364_10056654	3300006051	Bacteria	2566
88	Ga0075364_10083827	3300006051	Bacteria	2110
89	Ga0075364_10696600	3300006051	Bacteria	693
90	Ga0075362_10005308	3300006177	Bacteria	4706
91	Ga0075362_10093053	3300006177	Bacteria	1401
92	Ga0075367_10041094	3300006178	Bacteria	2702
93	Ga0075367_10114601	3300006178	Bacteria	1657
94	Ga0075367_10282022	3300006178	Bacteria	1044
95	Ga0075369_10000004	3300006186	Bacteria	154675
96	Ga0075369_10001191	3300006186	Bacteria	8804
97	Ga0075369_10003080	3300006186	Bacteria	6039
98	Ga0075369_10018614	3300006186	Unclassified	2829
99	Ga0075369_10073140	3300006186	Bacteria	1511
100	Ga0075366_10000003	3300006195	Bacteria	114017
101	Ga0075366_10000010	3300006195	Bacteria	81131
102	Ga0075366_10000015	3300006195	Bacteria	66498
103	Ga0075366_10060831	3300006195	Bacteria	2244
104	Ga0075366_10132200	3300006195	Unclassified	1506
105	Ga0075366_10286945	3300006195	Bacteria	1006
106	Ga0097621_100000052	3300006237	Bacteria	60152
107	Ga0097621_100017864	3300006237	Bacteria	5401
108	Ga0097621_100259736	3300006237	Bacteria	1523
109	Ga0075370_10025331	3300006353	Bacteria	3281
110	Ga0075370_10037936	3300006353	Bacteria	2711
111	Ga0075370_10043984	3300006353	Bacteria	2524
112	Ga0075370_10054647	3300006353	Bacteria	2268
113	Ga0075370_10088112	3300006353	Bacteria	1789
114	Ga0068871_100000006	3300006358	Bacteria	116822
115	Ga0068871_100108691	3300006358	Bacteria	2331
116	Ga0075428_100004205	3300006844	Bacteria	15856
117	Ga0105240_10000030	3300009093	Bacteria	321312
118	Ga0105240_10000761	3300009093	Bacteria	58856
119	Ga0105240_10000886	3300009093	Bacteria	53766
120	Ga0105240_10000909	3300009093	Bacteria	52908
121	Ga0105240_10061743	3300009093	Unclassified	4669
122	Ga0105240_10117185	3300009093	Bacteria	3212
123	Ga0105240_10408078	3300009093	Bacteria	1529
124	Ga0105240_10480195	3300009093	Bacteria	1386
125	Ga0105245_10000096	3300009098	Bacteria	84679
126	Ga0105245_10055122	3300009098	Bacteria	3570
127	Ga0105245_10378080	3300009098	Unclassified	1410
128	Ga0105247_10098549	3300009101	Bacteria	1866
129	Ga0105241_10014306	3300009174	Bacteria	5809
130	Ga0105241_10027475	3300009174	Bacteria	4238
131	Ga0105241_10183738	3300009174	Bacteria	1736
132	Ga0105248_10030208	3300009177	Bacteria	6049
133	Ga0105248_10236727	3300009177	Unclassified	2055
134	Ga0105237_10000001	3300009545	Bacteria	1009213
135	Ga0105237_10000159	3300009545	Bacteria	95980
136	Ga0105238_10000480	3300009551	Bacteria	41924
137	Ga0105238_10024039	3300009551	Bacteria	6213
138	Ga0105249_10062105	3300009553	Bacteria	3430
139	Ga0105032_100009	3300009979	Bacteria	86569
140	Ga0105032_100012	3300009979	Bacteria	73994
141	Ga0105032_101092	3300009979	Unclassified	2524
142	Ga0105032_108125	3300009979	Bacteria	866
143	Ga0105029_101151	3300009984	Bacteria	1591
144	Ga0105029_104786	3300009984	Bacteria	939
145	Ga0105033_100211	3300009986	Bacteria	4514
146	Ga0105028_100381	3300009993	Bacteria	4757
147	Ga0105028_100650	3300009993	Bacteria	3670
148	Ga0105028_103669	3300009993	Bacteria	1603
149	Ga0105028_104590	3300009993	Unclassified	1439
150	Ga0105028_120103	3300009993	Unclassified	722
151	Ga0105239_10076298	3300010375	Bacteria	3686
152	Ga0105239_10396144	3300010375	Unclassified	1562
153	Ga0105246_10000177	3300011119	Bacteria	31075
154	Ga0105246_10008863	3300011119	Bacteria	6191
155	Ga0157373_10000092	3300013100	Bacteria	74657
156	Ga0157373_10009954	3300013100	Bacteria	7007
157	Ga0157373_10124690	3300013100	Bacteria	1811
158	Ga0157371_10050249	3300013102	Bacteria	2962
159	Ga0157371_10058404	3300013102	Bacteria	2736
160	Ga0157370_10000232	3300013104	Bacteria	71177
161	Ga0157370_10001387	3300013104	Bacteria	29999
162	Ga0157370_10073049	3300013104	Bacteria	3236
163	Ga0157369_10000826	3300013105	Bacteria	39569
164	Ga0157369_10001538	3300013105	Bacteria	28252
165	Ga0157369_10068429	3300013105	Unclassified	3815
166	Ga0157369_10161422	3300013105	Bacteria	2366
167	Ga0157369_10230604	3300013105	Bacteria	1936
168	Ga0157369_10385922	3300013105	Unclassified	1453
169	Ga0157374_10000014	3300013296	Bacteria	396846
170	Ga0157374_10006886	3300013296	Bacteria	9673
171	Ga0157378_10519427	3300013297	Unclassified	1192
172	Ga0157378_10852738	3300013297	Bacteria	939
173	Ga0157372_10000007	3300013307	Bacteria	340690
174	Ga0157372_10000509	3300013307	Bacteria	42761
175	Ga0157372_10037735	3300013307	Bacteria	5330
176	Ga0157372_10042702	3300013307	Bacteria	5016
177	Ga0157372_10163592	3300013307	Bacteria	2572
178	Ga0157372_10797752	3300013307	Unclassified	1097
179	Ga0157372_10904371	3300013307	Unclassified	1024
180	Ga0157372_11272499	3300013307	Unclassified	849
181	Ga0157376_10000223	3300014969	Bacteria	39568
182	Ga0207680_10053071	3300025903	Bacteria	2432
183	Ga0207647_10000087	3300025904	Bacteria	70424
184	Ga0207645_10014711	3300025907	Bacteria	5224
185	Ga0207645_10168885	3300025907	Bacteria	1433
186	Ga0207705_10000019	3300025909	Bacteria	317770
187	Ga0207705_10010500	3300025909	Bacteria	6733
188	Ga0207705_10979731	3300025909	Unclassified	654
189	Ga0207654_10043496	3300025911	Bacteria	2546
190	Ga0207707_10058222	3300025912	Bacteria	3363
191	Ga0207707_11097096	3300025912	Bacteria	649
192	Ga0207695_10000009	3300025913	Bacteria	1034276
193	Ga0207695_10002910	3300025913	Bacteria	24751
194	Ga0207695_10012470	3300025913	Bacteria	10201
195	Ga0207695_10014974	3300025913	Bacteria	9153
196	Ga0207695_10046805	3300025913	Unclassified	4582
197	Ga0207695_10333721	3300025913	Bacteria	1404
198	Ga0207695_10478136	3300025913	Bacteria	1128
199	Ga0207671_10000003	3300025914	Bacteria	1065461
200	Ga0207671_10000008	3300025914	Bacteria	798229
201	Ga0207660_10109391	3300025917	Bacteria	2077
202	Ga0207660_10200943	3300025917	Bacteria	1557
203	Ga0207657_10000226	3300025919	Bacteria	59005
204	Ga0207657_10000547	3300025919	Bacteria	40133
205	Ga0207657_10028548	3300025919	Bacteria	5088
206	Ga0207652_10002428	3300025921	Bacteria	15728
207	Ga0207652_10007281	3300025921	Bacteria	8916
208	Ga0207652_10011441	3300025921	Bacteria	7153
209	Ga0207652_10131974	3300025921	Unclassified	2228
210	Ga0207652_10159167	3300025921	Unclassified	2024
211	Ga0207681_10202398	3300025923	Unclassified	1525
212	Ga0207694_10000785	3300025924	Bacteria	28533
213	Ga0207694_10036569	3300025924	Bacteria	3769
214	Ga0207650_10018353	3300025925	Bacteria	4909
215	Ga0207650_10190464	3300025925	Bacteria	1639
216	Ga0207687_10000008	3300025927	Bacteria	497738
217	Ga0207687_10067931	3300025927	Bacteria	2537
218	Ga0207687_10146123	3300025927	Unclassified	1799
219	Ga0207644_10000001	3300025931	Bacteria	1243214
220	Ga0207690_11014980	3300025932	Unclassified	690
221	Ga0207711_10026148	3300025941	Unclassified	4895
222	Ga0207661_10001467	3300025944	Bacteria	15941
223	Ga0207661_10002072	3300025944	Bacteria	13787
224	Ga0207661_10453416	3300025944	Bacteria	1168
225	Ga0207679_10465567	3300025945	Bacteria	1123
226	Ga0207667_10000005	3300025949	Bacteria	715503
227	Ga0207667_10000048	3300025949	Bacteria	238293
228	Ga0207667_10004009	3300025949	Bacteria	18097
229	Ga0207667_10015416	3300025949	Bacteria	8685
230	Ga0207667_10418804	3300025949	Unclassified	1363
231	Ga0207667_10707950	3300025949	Bacteria	1009
232	Ga0207712_10005969	3300025961	Bacteria	7682
233	Ga0207640_10298215	3300025981	Bacteria	1274
234	Ga0207658_10000003	3300025986	Bacteria	1151934
235	Ga0207658_10015037	3300025986	Bacteria	5306
236	Ga0207677_10930899	3300026023	Unclassified	785
237	Ga0207702_10000079	3300026078	Bacteria	110210
238	Ga0207702_10001968	3300026078	Bacteria	19973
239	Ga0207702_10026125	3300026078	Bacteria	4847
240	Ga0207702_10389376	3300026078	Bacteria	1342
241	Ga0207641_10936179	3300026088	Bacteria	861
242	Ga0207674_10051022	3300026116	Bacteria	4223
243	Ga0207674_10074449	3300026116	Bacteria	3407
244	Ga0207674_10153019	3300026116	Bacteria	2263
245	Ga0207674_10486030	3300026116	Unclassified	1193
246	Ga0207674_10980485	3300026116	Unclassified	814
247	Ga0207675_100448407	3300026118	Unclassified	1278
248	Ga0207683_10023437	3300026121	Bacteria	5311
249	Ga0207698_10000001	3300026142	Bacteria	625389
250	Ga0207698_10000820	3300026142	Bacteria	18049
251	Ga0207698_10013289	3300026142	Bacteria	5426
252	Ga0207698_10100487	3300026142	Bacteria	2396
253	Ga0209813_10000492	3300027866	Bacteria	9316
254	Ga0209813_10199237	3300027866	Unclassified	740
255	Ga0268266_10761769	3300028379	Unclassified	934
256	Ga0268264_10004228	3300028381	Bacteria	12257
257	Ga0265319_1062597	3300028563	Bacteria	1205
258	Ga0265334_10012087	3300028573	Bacteria	3628
259	Ga0265334_10150191	3300028573	Bacteria	822
260	Ga0265318_10072980	3300028577	Unclassified	1271
261	Ga0265322_10002967	3300028654	Bacteria	5167
262	Ga0265338_10000268	3300028800	Bacteria	95143
263	Ga0265338_10001797	3300028800	Bacteria	33738
264	Ga0265338_10006376	3300028800	Bacteria	15057
265	Ga0265338_10043034	3300028800	Unclassified	4195
266	Ga0265338_10063294	3300028800	Bacteria	3226
267	Ga0265338_10161152	3300028800	Bacteria	1732
268	Ga0265338_10266925	3300028800	Bacteria	1256
269	Ga0265324_10015610	3300029957	Bacteria	2789
270	Ga0314311_1002612	3300030733	Unclassified	1306
271	Ga0316179_1056598	3300030734	Bacteria	39107
272	Ga0316180_1008004	3300030736	Bacteria	4429
273	Ga0316183_1065354	3300030742	Bacteria	25518
274	Ga0316183_1102601	3300030742	Bacteria	6583
275	Ga0316183_1172979	3300030742	Bacteria	6723
276	Ga0316181_1123581	3300030744	Bacteria	76132
277	Ga0316181_1158685	3300030744	Bacteria	1721
278	Ga0316182_1014140	3300030745	Bacteria	16354
279	Ga0316182_1032588	3300030745	Bacteria	3634
280	Ga0316182_1088046	3300030745	Bacteria	1758
281	Ga0316182_1149236	3300030745	Bacteria	905
282	Ga0316182_1188782	3300030745	Bacteria	15742
283	Ga0265320_10003120	3300031240	Bacteria	11250
284	Ga0265325_10029613	3300031241	Bacteria	2941
285	Ga0265340_10062474	3300031247	Bacteria	1779
286	Ga0265339_10043579	3300031249	Unclassified	2480
287	Ga0265327_10000260	3300031251	Bacteria	104663
288	Ga0265327_10059694	3300031251	Bacteria	1952
289	Ga0265327_10167225	3300031251	Unclassified	1012
290	Ga0265316_10441927	3300031344	Unclassified	933
291	Ga0307509_10059742	3300031507	Bacteria	4033
292	Ga0307516_10037585	3300031730	Bacteria	4838
293	Ga0307516_10372819	3300031730	Bacteria	1090
294	Ga0307405_10060733	3300031731	Unclassified	2386
295	Ga0307406_10000001	3300031901	Bacteria	638191
296	Ga0307406_10001261	3300031901	Bacteria	14175
297	Ga0307412_10111240	3300031911	Unclassified	1956
298	Ga0373959_0000080	3300034820	Bacteria	21114
299	Ga0395899_0047068	3300037312	Bacteria	3211
300	Ga0395900_0009510	3300037418	Bacteria	9967
301	Ga0395900_0016132	3300037418	Bacteria	7609
302	Ga0395900_0051070	3300037418	Bacteria	4259
303	Ga0395900_0121346	3300037418	Bacteria	2681
304	Ga0395900_0231673	3300037418	Bacteria	1857
305	Ga0395898_0023510	3300037466	Bacteria	6226
306	Ga0395898_0084532	3300037466	Bacteria	3059
307	Ga0395898_0088014	3300037466	Unclassified	2991
308	Ga0395905_0050956	3300037471	Bacteria	3877
309	Ga0395905_0284093	3300037471	Unclassified	1541
310	Ga0395901_0004063	3300038443	Bacteria	14738
311	Ga0395901_0016381	3300038443	Bacteria	7547
312	Ga0395901_0157687	3300038443	Unclassified	2383
313	Ga0395901_1235742	3300038443	Unclassified	711
314	Ga0439447_005581	3300041407	Bacteria	4166
315	Ga0439466_0020707	3300041411	Bacteria	2342
316	Ga0439431_0006269	3300041997	Bacteria	2626
317	Ga0439431_0028749	3300041997	Bacteria	1370
318	Ga0439445_0003506	3300042004	Bacteria	3521
319	Ga0439432_000342	3300042006	Bacteria	16999
320	Ga0450920_002185	3300042122	Bacteria	3309
321	Ga0450906_000764	3300042145	Bacteria	6997
322	Ga0439446_0000002	3300042156	Bacteria	177065
323	Ga0439446_0024084	3300042156	Unclassified	1735
324	Ga0439434_0000935	3300042435	Bacteria	8411
325	Ga0439464_0045836	3300042439	Bacteria	1256
326	Ga0466965_0002723	3300044683	Bacteria	7575
327	Ga0466963_0082876	3300044694	Bacteria	2175
328	Ga0453684_0802059	3300044712	Unclassified	1015
329	Ga0453684_0808789	3300044712	Bacteria	1010
330	Ga0466970_0032787	3300044765	Bacteria	2745
331	Ga0466970_0219438	3300044765	Unclassified	1061
332	Ga0451576_0088196	3300045051	Bacteria	3227
333	Ga0451576_0349133	3300045051	Bacteria	1549
334	Ga0466967_0554269	3300045976	Bacteria	1131
335	Ga0495638_0000119	3300046460	Bacteria	127603
336	Ga0495638_0000256	3300046460	Bacteria	71804
337	Ga0495583_0021506	3300046506	Unclassified	3317
338	Ga0495587_0250263	3300046536	Unclassified	996
339	Ga0495609_0132008	3300046538	Unclassified	1069
340	Ga0495597_0008521	3300046542	Bacteria	5133
341	Ga0495622_0000231	3300046557	Bacteria	43928
342	Ga0495588_0000594	3300046674	Bacteria	17175
343	Ga0495658_0001166	3300046683	Bacteria	13871
344	Ga0495671_0174319	3300046692	Bacteria	1045
345	Ga0495600_0003400	3300046809	Bacteria	9369
346	Ga0495660_0000114	3300046810	Bacteria	86218
347	Ga0495660_0009713	3300046810	Bacteria	5606
348	Ga0495672_0000284	3300047320	Bacteria	70468
349	Ga0495672_0048276	3300047320	Bacteria	2525
350	Ga0496100_0444601	3300048903	Unclassified	993
351	Ga0496115_0000001	3300048918	Bacteria	367230
352	Ga0501034_0000187	3300049571	Bacteria	116046
353	Ga0501034_0001207	3300049571	Bacteria	35479
354	Ga0501034_0089672	3300049571	Bacteria	3073
355	Ga0501037_0000001	3300049573	Bacteria	753276
356	Ga0501037_0309086	3300049573	Unclassified	1096
357	Ga0501073_0787334	3300049589	Unclassified	656
358	Ga0501080_0000007	3300049742	Bacteria	135749
359	Ga0501083_0235397	3300049744	Unclassified	1192
360	Ga0501044_0394083	3300049823	Bacteria	1298
361	nmdc:mga03683_4298_c1	3300050489	Bacteria	4706
362	nmdc:mga03n38_110106_c1	3300050490	Bacteria	1340
363	nmdc:mga00v17_12587_c1	3300050491	Bacteria	4671
364	nmdc:mga00v17_1326_c1	3300050491	Bacteria	12961
365	nmdc:mga00v17_136982_c1	3300050491	Bacteria	1568
366	nmdc:mga00v17_235739_c1	3300050491	Bacteria	1186
367	nmdc:mga00v17_301_c1	3300050491	Bacteria	28737
368	nmdc:mga00v17_3682_c1	3300050491	Bacteria	7918
369	nmdc:mga00v17_6979_c1	3300050491	Bacteria	6009
370	nmdc:mga00v17_9270_c1	3300050491	Bacteria	5321
371	nmdc:mga00v17_9643_c1	3300050491	Bacteria	2568
372	nmdc:mga0yw44_103269_c1	3300050492	Bacteria	1818
373	nmdc:mga0yw44_114_c1	3300050492	Bacteria	28261
374	nmdc:mga0yw44_11_c1	3300050492	Bacteria	130624
375	nmdc:mga0yw44_180600_c1	3300050492	Bacteria	1389
376	nmdc:mga0yw44_3_c1	3300050492	Bacteria	561857
377	nmdc:mga0yw44_5740_c1	3300050492	Bacteria	5914
378	nmdc:mga0yw44_5_c1	3300050492	Bacteria	313167
379	nmdc:mga0yw44_619814_c1	3300050492	Unclassified	735
380	nmdc:mga0yw44_6867_c1	3300050492	Bacteria	5540
381	nmdc:mga0yw44_7_c1	3300050492	Bacteria	260877
382	nmdc:mga0yw44_94354_c1	3300050492	Bacteria	1896
383	nmdc:mga0k408_1_c1	3300050493	Bacteria	1089059
384	nmdc:mga0k408_204018_c1	3300050493	Bacteria	1180
385	nmdc:mga0k408_27102_c1	3300050493	Bacteria	3252
386	nmdc:mga0k408_4338_c1	3300050493	Bacteria	7533
387	nmdc:mga0k408_54_c1	3300050493	Bacteria	57640
388	nmdc:mga0k408_691_c1	3300050493	Bacteria	15167
389	nmdc:mga06z11_131901_c1	3300050494	Bacteria	1404
390	nmdc:mga06z11_2968_c1	3300050494	Bacteria	6535
391	nmdc:mga04h51_12588_c1	3300050495	Bacteria	2378
392	nmdc:mga04h51_228573_c1	3300050495	Unclassified	739
393	nmdc:mga07m45_219151_c1	3300050496	Bacteria	1107
394	nmdc:mga07m45_25242_c2	3300050496	Bacteria	2654
395	nmdc:mga07m45_254352_c1	3300050496	Unclassified	1022
396	nmdc:mga07m45_3028_c1	3300050496	Bacteria	8017
397	nmdc:mga07m45_37210_c1	3300050496	Bacteria	2714
398	nmdc:mga07m45_3765_c1	3300050496	Bacteria	7337
399	nmdc:mga0sz30_10_c2	3300050516	Bacteria	32861
400	nmdc:mga0sz30_145736_c1	3300050516	Unclassified	1046
401	nmdc:mga0sz30_28338_c1	3300050516	Bacteria	1429
402	nmdc:mga0sz30_2_c1	3300050516	Bacteria	626403
403	nmdc:mga0sz30_301571_c1	3300050516	Bacteria	714
404	nmdc:mga0sz30_5229_c1	3300050516	Bacteria	4749
405	Ga0500643_000061	3300053087	Bacteria	127538
406	Ga0500643_000157	3300053087	Bacteria	68258
407	Ga0500643_002224	3300053087	Bacteria	10249
408	Ga0500643_002762	3300053087	Bacteria	8787
409	Ga0500644_0001390	3300053088	Bacteria	6453
410	Ga0500644_0010070	3300053088	Unclassified	2549
411	Ga0500644_0014536	3300053088	Bacteria	2224
412	Ga0500646_0000010	3300053090	Bacteria	91525
413	Ga0500646_0022151	3300053090	Bacteria	1698
414	Ga0500583_0000199	3300053092	Bacteria	22979
415	Ga0500583_0008417	3300053092	Bacteria	3701
416	Ga0500583_0312728	3300053092	Bacteria	767
417	Ga0500651_0000043	3300053093	Bacteria	86502
418	Ga0500651_0000319	3300053093	Bacteria	27588
419	Ga0500651_0440938	3300053093	Bacteria	726
420	Ga0500566_0000001	3300053094	Bacteria	1101031
421	Ga0500641_0000001	3300053096	Bacteria	1115973
422	Ga0500650_0001096	3300053098	Bacteria	7820
423	Ga0500555_000001	3300053103	Bacteria	1353713
424	Ga0500555_000002	3300053103	Bacteria	1314346
425	Ga0500555_000045	3300053103	Bacteria	63148
426	Ga0500562_000001	3300053108	Bacteria	1178987
427	Ga0500562_000002	3300053108	Bacteria	977234
428	Ga0500569_000002	3300053109	Bacteria	127605
429	Ga0500593_000001	3300053117	Bacteria	784404
430	Ga0500594_0000019	3300053118	Bacteria	56688
431	Ga0500594_0000028	3300053118	Bacteria	50845
432	Ga0500614_000001	3300053123	Bacteria	1274484
433	Ga0500628_000005	3300053129	Bacteria	201423
434	Ga0500652_000001	3300053131	Bacteria	946868
435	Ga0500652_000012	3300053131	Bacteria	155076
436	Ga0500652_055206	3300053131	Bacteria	1627
437	Ga0500655_001360	3300053133	Bacteria	4626
438	Ga0500559_0010084	3300053136	Bacteria	4066
439	Ga0500561_0000002	3300053137	Bacteria	394147
440	Ga0500568_0006413	3300053139	Bacteria	5905
441	Ga0500568_0014578	3300053139	Bacteria	3545
442	Ga0500577_0000143	3300053142	Bacteria	17463
443	Ga0500577_0014452	3300053142	Unclassified	2441
444	Ga0500577_0027143	3300053142	Bacteria	1957
445	Ga0500577_0100037	3300053142	Bacteria	1184
446	Ga0500588_0001636	3300053146	Bacteria	4329
447	Ga0500589_021455	3300053147	Bacteria	2960
448	Ga0500616_0000005	3300053153	Bacteria	961725
449	Ga0500616_0000067	3300053153	Bacteria	236311
450	Ga0500616_0024645	3300053153	Bacteria	3341
451	Ga0500620_015172	3300053155	Bacteria	2172
452	Ga0500649_000006	3300053722	Bacteria	116211
453	Ga0500570_000001	3300053724	Bacteria	243552
454	Ga0500570_027611	3300053724	Bacteria	3099
455	Ga0500570_033704	3300053724	Bacteria	2746
456	Ga0500611_001283	3300053727	Bacteria	2718
457	Ga0500611_018595	3300053727	Bacteria	1284
458	Ga0500613_000093	3300053738	Bacteria	3984

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300001979	JGI24740J21852_10046072	JGI24740J21852_100460722	186
2	3300001979	JGI24740J21852_10073404	JGI24740J21852_100734041	186
3	3300003320	rootH2_10004334	rootH2_1000433456	186
4	3300003322	rootL2_10345480	rootL2_103454805	186
5	3300003323	rootH1_10001727	rootH1_1000172727	186
6	3300005328	Ga0070676_10067529	Ga0070676_100675295	186
7	3300005329	Ga0070683_100313539	Ga0070683_1003135392	186
8	3300005331	Ga0070670_100049074	Ga0070670_1000490746	186
9	3300005535	Ga0070684_100013425	Ga0070684_1000134254	186
10	3300005578	Ga0068854_100326239	Ga0068854_1003262393	186
11	3300005614	Ga0068856_100000441	Ga0068856_10000044117	186
12	3300005614	Ga0068856_100171882	Ga0068856_1001718822	186
13	3300005614	Ga0068856_100418879	Ga0068856_1004188791	186
14	3300005616	Ga0068852_100000621	Ga0068852_1000006214	186
15	3300005616	Ga0068852_100066076	Ga0068852_1000660766	186
16	3300005616	Ga0068852_100114707	Ga0068852_1001147072	186
17	3300005842	Ga0068858_101034077	Ga0068858_1010340772	186
18	3300005937	Ga0081455_10000006	Ga0081455_10000006218	186
19	3300006038	Ga0075365_10000005	Ga0075365_1000000526	186
20	3300006038	Ga0075365_10005061	Ga0075365_100050615	186
21	3300006038	Ga0075365_10008982	Ga0075365_100089826	186
22	3300006038	Ga0075365_10487839	Ga0075365_104878392	186
23	3300006042	Ga0075368_10000090	Ga0075368_1000009023	186
24	3300006051	Ga0075364_10010415	Ga0075364_100104152	186
25	3300006178	Ga0075367_10041094	Ga0075367_100410945	186
26	3300006186	Ga0075369_10003080	Ga0075369_100030806	186
27	3300006195	Ga0075366_10132200	Ga0075366_101322002	186
28	3300006195	Ga0075366_10286945	Ga0075366_102869452	186
29	3300006237	Ga0097621_100017864	Ga0097621_1000178647	186
30	3300006353	Ga0075370_10025331	Ga0075370_100253315	186
31	3300006353	Ga0075370_10043984	Ga0075370_100439845	186
32	3300006353	Ga0075370_10054647	Ga0075370_100546472	186
33	3300006844	Ga0075428_100004205	Ga0075428_1000042055	186
34	3300009093	Ga0105240_10000030	Ga0105240_10000030319	186
35	3300009093	Ga0105240_10000761	Ga0105240_1000076124	186
36	3300009093	Ga0105240_10000886	Ga0105240_1000088629	186
37	3300009174	Ga0105241_10183738	Ga0105241_101837382	186
38	3300009545	Ga0105237_10000001	Ga0105237_1000000156	186
39	3300009551	Ga0105238_10024039	Ga0105238_100240396	186
40	3300009979	Ga0105032_100009	Ga0105032_10000941	186
41	3300009979	Ga0105032_100012	Ga0105032_10001225	186
42	3300009979	Ga0105032_108125	Ga0105032_1081252	186
43	3300009984	Ga0105029_101151	Ga0105029_1011512	186
44	3300009984	Ga0105029_104786	Ga0105029_1047862	186
45	3300009993	Ga0105028_100650	Ga0105028_1006505	186
46	3300009993	Ga0105028_120103	Ga0105028_1201031	186
47	3300013102	Ga0157371_10050249	Ga0157371_100502492	186
48	3300013104	Ga0157370_10000232	Ga0157370_1000023255	186
49	3300013105	Ga0157369_10001538	Ga0157369_1000153824	186
50	3300013105	Ga0157369_10161422	Ga0157369_101614221	186
51	3300013105	Ga0157369_10230604	Ga0157369_102306044	186
52	3300013307	Ga0157372_10000007	Ga0157372_1000000756	186
53	3300013307	Ga0157372_10042702	Ga0157372_100427023	186
54	3300013307	Ga0157372_10904371	Ga0157372_109043712	186
55	3300013307	Ga0157372_11272499	Ga0157372_112724991	186
56	3300025907	Ga0207645_10168885	Ga0207645_101688852	186
57	3300025913	Ga0207695_10000009	Ga0207695_1000000957	186
58	3300025913	Ga0207695_10002910	Ga0207695_1000291024	186
59	3300025913	Ga0207695_10012470	Ga0207695_100124703	186
60	3300025914	Ga0207671_10000003	Ga0207671_1000000357	186
61	3300025919	Ga0207657_10000547	Ga0207657_1000054716	186
62	3300025924	Ga0207694_10036569	Ga0207694_100365694	186
63	3300025925	Ga0207650_10190464	Ga0207650_101904643	186
64	3300025944	Ga0207661_10453416	Ga0207661_104534162	186
65	3300025945	Ga0207679_10465567	Ga0207679_104655673	186
66	3300025949	Ga0207667_10000048	Ga0207667_10000048222	186
67	3300025949	Ga0207667_10015416	Ga0207667_100154166	186
68	3300025981	Ga0207640_10298215	Ga0207640_102982152	186
69	3300026078	Ga0207702_10000079	Ga0207702_1000007953	186
70	3300026078	Ga0207702_10389376	Ga0207702_103893761	186
71	3300026142	Ga0207698_10000820	Ga0207698_1000082017	186
72	3300026142	Ga0207698_10013289	Ga0207698_100132894	186
73	3300026142	Ga0207698_10100487	Ga0207698_101004873	186
74	3300027866	Ga0209813_10000492	Ga0209813_100004928	186
75	3300030733	Ga0314311_1002612	Ga0314311_10026123	186
76	3300030734	Ga0316179_1056598	Ga0316179_105659842	186
77	3300030736	Ga0316180_1008004	Ga0316180_10080042	186
78	3300030742	Ga0316183_1065354	Ga0316183_106535423	186
79	3300030742	Ga0316183_1102601	Ga0316183_11026018	186
80	3300030742	Ga0316183_1172979	Ga0316183_11729796	186
81	3300030744	Ga0316181_1123581	Ga0316181_112358148	186
82	3300030744	Ga0316181_1158685	Ga0316181_11586852	186
83	3300030745	Ga0316182_1014140	Ga0316182_10141408	186
84	3300030745	Ga0316182_1032588	Ga0316182_10325886	186
85	3300030745	Ga0316182_1088046	Ga0316182_10880462	186
86	3300030745	Ga0316182_1149236	Ga0316182_11492362	186
87	3300030745	Ga0316182_1188782	Ga0316182_11887826	186
88	3300031730	Ga0307516_10037585	Ga0307516_100375853	186
89	3300031731	Ga0307405_10060733	Ga0307405_100607335	186
90	3300031911	Ga0307412_10111240	Ga0307412_101112401	186
91	3300037312	Ga0395899_0047068	Ga0395899_0047068_906_1466	186
92	3300041407	Ga0439447_005581	Ga0439447_005581_2248_2808	186
93	3300041411	Ga0439466_0020707	Ga0439466_0020707_1180_1740	186
94	3300041997	Ga0439431_0006269	Ga0439431_0006269_447_1007	186
95	3300042004	Ga0439445_0003506	Ga0439445_0003506_1296_1856	186
96	3300042006	Ga0439432_000342	Ga0439432_000342_2521_3081	186
97	3300042122	Ga0450920_002185	Ga0450920_002185_1080_1640	186
98	3300042145	Ga0450906_000764	Ga0450906_000764_2644_3204	186
99	3300042156	Ga0439446_0000002	Ga0439446_0000002_55244_55804	186
100	3300042435	Ga0439434_0000935	Ga0439434_0000935_1649_2209	186
101	3300042439	Ga0439464_0045836	Ga0439464_0045836_139_699	186
102	3300044683	Ga0466965_0002723	Ga0466965_0002723_6758_7318	186
103	3300044765	Ga0466970_0219438	Ga0466970_0219438_60_620	186
104	3300046460	Ga0495638_0000119	Ga0495638_0000119_83537_84097	186
105	3300046542	Ga0495597_0008521	Ga0495597_0008521_863_1423	186
106	3300046810	Ga0495660_0000114	Ga0495660_0000114_33940_34500	186
107	3300049571	Ga0501034_0000187	Ga0501034_0000187_73461_74021	186
108	3300049571	Ga0501034_0001207	Ga0501034_0001207_34804_35364	186
109	3300049573	Ga0501037_0000001	Ga0501037_0000001_703321_703881	186
110	3300050491	nmdc:mga00v17_301_c1	nmdc:mga00v17_301_c1_5741_6301	186
111	3300050492	nmdc:mga0yw44_103269_c1	nmdc:mga0yw44_103269_c1_890_1450	186
112	3300050492	nmdc:mga0yw44_114_c1	nmdc:mga0yw44_114_c1_22753_23313	186
113	3300050492	nmdc:mga0yw44_11_c1	nmdc:mga0yw44_11_c1_105684_106244	186
114	3300050492	nmdc:mga0yw44_5_c1	nmdc:mga0yw44_5_c1_252453_253013	186
115	3300050492	nmdc:mga0yw44_619814_c1	nmdc:mga0yw44_619814_c1_35_595	186
116	3300050492	nmdc:mga0yw44_6867_c1	nmdc:mga0yw44_6867_c1_4046_4606	186
117	3300050493	nmdc:mga0k408_204018_c1	nmdc:mga0k408_204018_c1_29_589	186
118	3300050494	nmdc:mga06z11_2968_c1	nmdc:mga06z11_2968_c1_4776_5336	186
119	3300050495	nmdc:mga04h51_12588_c1	nmdc:mga04h51_12588_c1_473_1033	186
120	3300050496	nmdc:mga07m45_25242_c2	nmdc:mga07m45_25242_c2_1485_2045	186
121	3300050496	nmdc:mga07m45_254352_c1	nmdc:mga07m45_254352_c1_431_991	186
122	3300050496	nmdc:mga07m45_3028_c1	nmdc:mga07m45_3028_c1_6115_6675	186
123	3300050496	nmdc:mga07m45_37210_c1	nmdc:mga07m45_37210_c1_775_1335	186
124	3300050516	nmdc:mga0sz30_5229_c1	nmdc:mga0sz30_5229_c1_1873_2433	186
125	3300053087	Ga0500643_002762	Ga0500643_002762_5988_6548	186
126	3300053090	Ga0500646_0000010	Ga0500646_0000010_38445_39005	186
127	3300053092	Ga0500583_0000199	Ga0500583_0000199_14110_14670	186
128	3300053092	Ga0500583_0312728	Ga0500583_0312728_128_688	186
129	3300053093	Ga0500651_0000043	Ga0500651_0000043_61307_61867	186
130	3300053096	Ga0500641_0000001	Ga0500641_0000001_714459_715019	186
131	3300053098	Ga0500650_0001096	Ga0500650_0001096_7033_7593	186
132	3300053103	Ga0500555_000045	Ga0500555_000045_62420_62980	186
133	3300053109	Ga0500569_000002	Ga0500569_000002_43507_44067	186
134	3300053118	Ga0500594_0000028	Ga0500594_0000028_24638_25198	186
135	3300053131	Ga0500652_000001	Ga0500652_000001_766409_766969	186
136	3300053131	Ga0500652_055206	Ga0500652_055206_351_911	186
137	3300053139	Ga0500568_0014578	Ga0500568_0014578_431_991	186
138	3300053142	Ga0500577_0014452	Ga0500577_0014452_831_1391	186
139	3300053142	Ga0500577_0100037	Ga0500577_0100037_515_1075	186
140	3300053146	Ga0500588_0001636	Ga0500588_0001636_1539_2099	186
141	3300053153	Ga0500616_0000067	Ga0500616_0000067_221131_221691	186
142	3300053153	Ga0500616_0024645	Ga0500616_0024645_91_651	186
143	3300053155	Ga0500620_015172	Ga0500620_015172_474_1034	186
144	3300053724	Ga0500570_027611	Ga0500570_027611_1739_2299	186
145	3300053724	Ga0500570_033704	Ga0500570_033704_2048_2608	186
146	3300053738	Ga0500613_000093	Ga0500613_000093_943_1503	186
147	3300003320	rootH2_10256068	rootH2_102560682	187
148	3300003322	rootL2_10034609	rootL2_100346097	187
149	3300005336	Ga0070680_100181560	Ga0070680_1001815603	187
150	3300005366	Ga0070659_100770645	Ga0070659_1007706451	187
151	3300005445	Ga0070708_100592283	Ga0070708_1005922832	187
152	3300005458	Ga0070681_10060128	Ga0070681_100601286	187
153	3300005530	Ga0070679_100006731	Ga0070679_1000067315	187
154	3300005719	Ga0068861_100430638	Ga0068861_1004306383	187
155	3300006038	Ga0075365_10000011	Ga0075365_1000001127	187
156	3300006038	Ga0075365_10025194	Ga0075365_100251944	187
157	3300006038	Ga0075365_10207579	Ga0075365_102075792	187
158	3300006051	Ga0075364_10001839	Ga0075364_100018394	187
159	3300006051	Ga0075364_10023820	Ga0075364_100238205	187
160	3300006051	Ga0075364_10056654	Ga0075364_100566546	187
161	3300006178	Ga0075367_10114601	Ga0075367_101146012	187
162	3300006178	Ga0075367_10282022	Ga0075367_102820222	187
163	3300006186	Ga0075369_10001191	Ga0075369_100011916	187
164	3300006195	Ga0075366_10000003	Ga0075366_1000000381	187
165	3300006195	Ga0075366_10000015	Ga0075366_1000001546	187
166	3300006195	Ga0075366_10060831	Ga0075366_100608314	187
167	3300006353	Ga0075370_10088112	Ga0075370_100881122	187
168	3300009979	Ga0105032_101092	Ga0105032_1010925	187
169	3300009993	Ga0105028_103669	Ga0105028_1036693	187
170	3300009993	Ga0105028_104590	Ga0105028_1045903	187
171	3300010375	Ga0105239_10076298	Ga0105239_100762986	187
172	3300013102	Ga0157371_10058404	Ga0157371_100584042	187
173	3300013307	Ga0157372_10037735	Ga0157372_100377354	187
174	3300025917	Ga0207660_10200943	Ga0207660_102009432	187
175	3300025932	Ga0207690_11014980	Ga0207690_110149802	187
176	3300026118	Ga0207675_100448407	Ga0207675_1004484073	187
177	3300028573	Ga0265334_10150191	Ga0265334_101501912	187
178	3300028800	Ga0265338_10000268	Ga0265338_1000026862	187
179	3300028800	Ga0265338_10006376	Ga0265338_100063765	187
180	3300028800	Ga0265338_10063294	Ga0265338_100632944	187
181	3300028800	Ga0265338_10161152	Ga0265338_101611521	187
182	3300031251	Ga0265327_10059694	Ga0265327_100596942	187
183	3300031507	Ga0307509_10059742	Ga0307509_100597423	187
184	3300034820	Ga0373959_0000080	Ga0373959_0000080_2032_2595	187
185	3300041997	Ga0439431_0028749	Ga0439431_0028749_633_1196	187
186	3300042156	Ga0439446_0024084	Ga0439446_0024084_258_821	187
187	3300044694	Ga0466963_0082876	Ga0466963_0082876_377_940	187
188	3300044712	Ga0453684_0802059	Ga0453684_0802059_388_951	187
189	3300044712	Ga0453684_0808789	Ga0453684_0808789_180_743	187
190	3300045051	Ga0451576_0088196	Ga0451576_0088196_791_1354	187
191	3300045051	Ga0451576_0349133	Ga0451576_0349133_417_980	187
192	3300046460	Ga0495638_0000256	Ga0495638_0000256_7983_8546	187
193	3300046536	Ga0495587_0250263	Ga0495587_0250263_331_894	187
194	3300046557	Ga0495622_0000231	Ga0495622_0000231_19859_20422	187
195	3300046674	Ga0495588_0000594	Ga0495588_0000594_4123_4686	187
196	3300046683	Ga0495658_0001166	Ga0495658_0001166_3949_4512	187
197	3300046692	Ga0495671_0174319	Ga0495671_0174319_335_898	187
198	3300046809	Ga0495600_0003400	Ga0495600_0003400_7866_8429	187
199	3300046810	Ga0495660_0009713	Ga0495660_0009713_133_696	187
200	3300047320	Ga0495672_0048276	Ga0495672_0048276_419_982	187
201	3300050491	nmdc:mga00v17_12587_c1	nmdc:mga00v17_12587_c1_3447_4010	187
202	3300050491	nmdc:mga00v17_3682_c1	nmdc:mga00v17_3682_c1_4808_5374	187
203	3300050491	nmdc:mga00v17_9643_c1	nmdc:mga00v17_9643_c1_292_855	187
204	3300050492	nmdc:mga0yw44_180600_c1	nmdc:mga0yw44_180600_c1_255_821	187
205	3300050492	nmdc:mga0yw44_3_c1	nmdc:mga0yw44_3_c1_501584_502147	187
206	3300050492	nmdc:mga0yw44_5740_c1	nmdc:mga0yw44_5740_c1_4236_4799	187
207	3300050493	nmdc:mga0k408_1_c1	nmdc:mga0k408_1_c1_59103_59666	187
208	3300050493	nmdc:mga0k408_27102_c1	nmdc:mga0k408_27102_c1_385_948	187
209	3300050493	nmdc:mga0k408_54_c1	nmdc:mga0k408_54_c1_36061_36624	187
210	3300050494	nmdc:mga06z11_131901_c1	nmdc:mga06z11_131901_c1_493_1059	187
211	3300050496	nmdc:mga07m45_219151_c1	nmdc:mga07m45_219151_c1_182_745	187
212	3300050516	nmdc:mga0sz30_10_c2	nmdc:mga0sz30_10_c2_20722_21285	187
213	3300050516	nmdc:mga0sz30_28338_c1	nmdc:mga0sz30_28338_c1_564_1127	187
214	3300050516	nmdc:mga0sz30_301571_c1	nmdc:mga0sz30_301571_c1_123_686	187
215	3300053087	Ga0500643_000061	Ga0500643_000061_59468_60031	187
216	3300053092	Ga0500583_0008417	Ga0500583_0008417_426_989	187
217	3300053093	Ga0500651_0000319	Ga0500651_0000319_645_1208	187
218	3300053094	Ga0500566_0000001	Ga0500566_0000001_19165_19728	187
219	3300053108	Ga0500562_000001	Ga0500562_000001_769908_770471	187
220	3300053123	Ga0500614_000001	Ga0500614_000001_993762_994325	187
221	3300053136	Ga0500559_0010084	Ga0500559_0010084_2323_2886	187
222	3300053142	Ga0500577_0027143	Ga0500577_0027143_370_933	187
223	3300053147	Ga0500589_021455	Ga0500589_021455_646_1209	187
224	3300053722	Ga0500649_000006	Ga0500649_000006_87326_87889	187
225	3300053724	Ga0500570_000001	Ga0500570_000001_186421_186984	187
226	3300053727	Ga0500611_018595	Ga0500611_018595_596_1159	187
227	3300001915	JGI24741J21665_1003818	JGI24741J21665_10038187	188
228	3300001979	JGI24740J21852_10002100	JGI24740J21852_1000210010	188
229	3300001990	JGI24737J22298_10000346	JGI24737J22298_100003461	188
230	3300002067	JGI24735J21928_10000055	JGI24735J21928_1000005544	188
231	3300005327	Ga0070658_10034525	Ga0070658_100345256	188
232	3300005328	Ga0070676_10000131	Ga0070676_1000013123	188
233	3300005329	Ga0070683_100000239	Ga0070683_10000023934	188
234	3300005329	Ga0070683_100000380	Ga0070683_10000038019	188
235	3300005329	Ga0070683_101312503	Ga0070683_1013125031	188
236	3300005336	Ga0070680_100108507	Ga0070680_1001085073	188
237	3300005336	Ga0070680_100345830	Ga0070680_1003458302	188
238	3300005338	Ga0068868_100966569	Ga0068868_1009665691	188
239	3300005339	Ga0070660_100000158	Ga0070660_10000015839	188
240	3300005339	Ga0070660_100000226	Ga0070660_10000022640	188
241	3300005355	Ga0070671_100000001	Ga0070671_1000000011253	188
242	3300005366	Ga0070659_100097380	Ga0070659_1000973804	188
243	3300005367	Ga0070667_100000503	Ga0070667_10000050315	188
244	3300005456	Ga0070678_100058574	Ga0070678_1000585743	188
245	3300005458	Ga0070681_10126730	Ga0070681_101267303	188
246	3300005458	Ga0070681_10258094	Ga0070681_102580944	188
247	3300005458	Ga0070681_10593901	Ga0070681_105939012	188
248	3300005530	Ga0070679_100004467	Ga0070679_10000446716	188
249	3300005530	Ga0070679_100207570	Ga0070679_1002075703	188
250	3300005530	Ga0070679_100214688	Ga0070679_1002146882	188
251	3300005530	Ga0070679_100219344	Ga0070679_1002193443	188
252	3300005530	Ga0070679_100341741	Ga0070679_1003417411	188
253	3300005535	Ga0070684_100000280	Ga0070684_1000002808	188
254	3300005535	Ga0070684_100003029	Ga0070684_1000030298	188
255	3300005535	Ga0070684_101322644	Ga0070684_1013226441	188
256	3300005548	Ga0070665_100917412	Ga0070665_1009174122	188
257	3300005563	Ga0068855_100001316	Ga0068855_10000131619	188
258	3300005563	Ga0068855_101008636	Ga0068855_1010086362	188
259	3300005564	Ga0070664_100672032	Ga0070664_1006720322	188
260	3300005577	Ga0068857_100308730	Ga0068857_1003087302	188
261	3300005577	Ga0068857_100363740	Ga0068857_1003637402	188
262	3300005614	Ga0068856_100002238	Ga0068856_10000223814	188
263	3300005841	Ga0068863_100180954	Ga0068863_1001809541	188
264	3300005843	Ga0068860_100005087	Ga0068860_1000050879	188
265	3300005843	Ga0068860_100066863	Ga0068860_1000668635	188
266	3300005937	Ga0081455_10000020	Ga0081455_10000020157	188
267	3300006038	Ga0075365_10128664	Ga0075365_101286644	188
268	3300006051	Ga0075364_10001478	Ga0075364_100014788	188
269	3300006051	Ga0075364_10007360	Ga0075364_100073604	188
270	3300006051	Ga0075364_10029326	Ga0075364_100293263	188
271	3300006051	Ga0075364_10083827	Ga0075364_100838275	188
272	3300006051	Ga0075364_10696600	Ga0075364_106966002	188
273	3300006177	Ga0075362_10005308	Ga0075362_100053084	188
274	3300006177	Ga0075362_10093053	Ga0075362_100930532	188
275	3300006186	Ga0075369_10000004	Ga0075369_10000004104	188
276	3300006186	Ga0075369_10018614	Ga0075369_100186142	188
277	3300006186	Ga0075369_10073140	Ga0075369_100731403	188
278	3300006195	Ga0075366_10000010	Ga0075366_1000001012	188
279	3300006237	Ga0097621_100000052	Ga0097621_10000005255	188
280	3300006237	Ga0097621_100259736	Ga0097621_1002597362	188
281	3300006353	Ga0075370_10037936	Ga0075370_100379364	188
282	3300006358	Ga0068871_100000006	Ga0068871_10000000686	188
283	3300006358	Ga0068871_100108691	Ga0068871_1001086912	188
284	3300009093	Ga0105240_10061743	Ga0105240_100617434	188
285	3300009093	Ga0105240_10408078	Ga0105240_104080782	188
286	3300009098	Ga0105245_10000096	Ga0105245_1000009633	188
287	3300009098	Ga0105245_10055122	Ga0105245_100551225	188
288	3300009098	Ga0105245_10378080	Ga0105245_103780803	188
289	3300009101	Ga0105247_10098549	Ga0105247_100985492	188
290	3300009174	Ga0105241_10027475	Ga0105241_100274757	188
291	3300009177	Ga0105248_10030208	Ga0105248_100302085	188
292	3300009553	Ga0105249_10062105	Ga0105249_100621054	188
293	3300009986	Ga0105033_100211	Ga0105033_1002114	188
294	3300009993	Ga0105028_100381	Ga0105028_1003816	188
295	3300011119	Ga0105246_10000177	Ga0105246_1000017718	188
296	3300011119	Ga0105246_10008863	Ga0105246_100088639	188
297	3300013100	Ga0157373_10000092	Ga0157373_1000009234	188
298	3300013100	Ga0157373_10009954	Ga0157373_100099547	188
299	3300013100	Ga0157373_10124690	Ga0157373_101246902	188
300	3300013104	Ga0157370_10001387	Ga0157370_1000138732	188
301	3300013104	Ga0157370_10073049	Ga0157370_100730491	188
302	3300013105	Ga0157369_10000826	Ga0157369_1000082632	188
303	3300013105	Ga0157369_10068429	Ga0157369_100684294	188
304	3300013105	Ga0157369_10385922	Ga0157369_103859223	188
305	3300013296	Ga0157374_10000014	Ga0157374_10000014373	188
306	3300013296	Ga0157374_10006886	Ga0157374_100068865	188
307	3300013297	Ga0157378_10519427	Ga0157378_105194272	188
308	3300013297	Ga0157378_10852738	Ga0157378_108527382	188
309	3300013307	Ga0157372_10000509	Ga0157372_1000050914	188
310	3300013307	Ga0157372_10163592	Ga0157372_101635922	188
311	3300014969	Ga0157376_10000223	Ga0157376_1000022331	188
312	3300025903	Ga0207680_10053071	Ga0207680_100530713	188
313	3300025904	Ga0207647_10000087	Ga0207647_1000008719	188
314	3300025907	Ga0207645_10014711	Ga0207645_100147117	188
315	3300025909	Ga0207705_10000019	Ga0207705_10000019269	188
316	3300025909	Ga0207705_10010500	Ga0207705_100105008	188
317	3300025909	Ga0207705_10979731	Ga0207705_109797311	188
318	3300025911	Ga0207654_10043496	Ga0207654_100434966	188
319	3300025912	Ga0207707_10058222	Ga0207707_100582223	188
320	3300025912	Ga0207707_11097096	Ga0207707_110970961	188
321	3300025913	Ga0207695_10046805	Ga0207695_100468055	188
322	3300025913	Ga0207695_10333721	Ga0207695_103337212	188
323	3300025917	Ga0207660_10109391	Ga0207660_101093912	188
324	3300025919	Ga0207657_10000226	Ga0207657_1000022611	188
325	3300025919	Ga0207657_10028548	Ga0207657_100285487	188
326	3300025921	Ga0207652_10002428	Ga0207652_1000242819	188
327	3300025921	Ga0207652_10007281	Ga0207652_1000728110	188
328	3300025921	Ga0207652_10011441	Ga0207652_100114417	188
329	3300025921	Ga0207652_10131974	Ga0207652_101319743	188
330	3300025921	Ga0207652_10159167	Ga0207652_101591674	188
331	3300025923	Ga0207681_10202398	Ga0207681_102023983	188
332	3300025925	Ga0207650_10018353	Ga0207650_100183534	188
333	3300025927	Ga0207687_10000008	Ga0207687_10000008373	188
334	3300025927	Ga0207687_10067931	Ga0207687_100679314	188
335	3300025927	Ga0207687_10146123	Ga0207687_101461232	188
336	3300025931	Ga0207644_10000001	Ga0207644_10000001181	188
337	3300025941	Ga0207711_10026148	Ga0207711_100261486	188
338	3300025944	Ga0207661_10001467	Ga0207661_1000146712	188
339	3300025944	Ga0207661_10002072	Ga0207661_1000207212	188
340	3300025949	Ga0207667_10004009	Ga0207667_1000400919	188
341	3300025949	Ga0207667_10418804	Ga0207667_104188042	188
342	3300025949	Ga0207667_10707950	Ga0207667_107079502	188
343	3300025961	Ga0207712_10005969	Ga0207712_100059696	188
344	3300025986	Ga0207658_10000003	Ga0207658_1000000397	188
345	3300025986	Ga0207658_10015037	Ga0207658_100150374	188
346	3300026023	Ga0207677_10930899	Ga0207677_109308992	188
347	3300026078	Ga0207702_10001968	Ga0207702_1000196810	188
348	3300026088	Ga0207641_10936179	Ga0207641_109361791	188
349	3300026116	Ga0207674_10074449	Ga0207674_100744498	188
350	3300026116	Ga0207674_10486030	Ga0207674_104860302	188
351	3300026121	Ga0207683_10023437	Ga0207683_100234373	188
352	3300027866	Ga0209813_10199237	Ga0209813_101992372	188
353	3300028379	Ga0268266_10761769	Ga0268266_107617692	188
354	3300028381	Ga0268264_10004228	Ga0268264_100042288	188
355	3300028563	Ga0265319_1062597	Ga0265319_10625973	188
356	3300028573	Ga0265334_10012087	Ga0265334_100120875	188
357	3300028577	Ga0265318_10072980	Ga0265318_100729802	188
358	3300028654	Ga0265322_10002967	Ga0265322_100029674	188
359	3300028800	Ga0265338_10001797	Ga0265338_1000179712	188
360	3300028800	Ga0265338_10043034	Ga0265338_100430343	188
361	3300028800	Ga0265338_10266925	Ga0265338_102669253	188
362	3300029957	Ga0265324_10015610	Ga0265324_100156107	188
363	3300031240	Ga0265320_10003120	Ga0265320_1000312010	188
364	3300031241	Ga0265325_10029613	Ga0265325_100296132	188
365	3300031247	Ga0265340_10062474	Ga0265340_100624742	188
366	3300031249	Ga0265339_10043579	Ga0265339_100435792	188
367	3300031251	Ga0265327_10000260	Ga0265327_1000026087	188
368	3300031251	Ga0265327_10167225	Ga0265327_101672252	188
369	3300031344	Ga0265316_10441927	Ga0265316_104419272	188
370	3300031730	Ga0307516_10372819	Ga0307516_103728192	188
371	3300037418	Ga0395900_0009510	Ga0395900_0009510_3955_4521	188
372	3300037418	Ga0395900_0016132	Ga0395900_0016132_3205_3771	188
373	3300037418	Ga0395900_0051070	Ga0395900_0051070_2146_2712	188
374	3300037418	Ga0395900_0121346	Ga0395900_0121346_984_1550	188
375	3300037418	Ga0395900_0231673	Ga0395900_0231673_161_727	188
376	3300037466	Ga0395898_0023510	Ga0395898_0023510_3877_4443	188
377	3300037466	Ga0395898_0084532	Ga0395898_0084532_1460_2026	188
378	3300037466	Ga0395898_0088014	Ga0395898_0088014_2405_2971	188
379	3300037471	Ga0395905_0050956	Ga0395905_0050956_2980_3546	188
380	3300037471	Ga0395905_0284093	Ga0395905_0284093_200_766	188
381	3300038443	Ga0395901_0004063	Ga0395901_0004063_12051_12617	188
382	3300038443	Ga0395901_0016381	Ga0395901_0016381_3019_3585	188
383	3300038443	Ga0395901_0157687	Ga0395901_0157687_624_1190	188
384	3300038443	Ga0395901_1235742	Ga0395901_1235742_11_577	188
385	3300045976	Ga0466967_0554269	Ga0466967_0554269_493_1059	188
386	3300046506	Ga0495583_0021506	Ga0495583_0021506_2328_2894	188
387	3300046538	Ga0495609_0132008	Ga0495609_0132008_349_915	188
388	3300047320	Ga0495672_0000284	Ga0495672_0000284_52111_52677	188
389	3300049571	Ga0501034_0089672	Ga0501034_0089672_726_1292	188
390	3300049573	Ga0501037_0309086	Ga0501037_0309086_271_837	188
391	3300049589	Ga0501073_0787334	Ga0501073_0787334_52_618	188
392	3300049742	Ga0501080_0000007	Ga0501080_0000007_95323_95889	188
393	3300049744	Ga0501083_0235397	Ga0501083_0235397_416_982	188
394	3300049823	Ga0501044_0394083	Ga0501044_0394083_525_1091	188
395	3300050489	nmdc:mga03683_4298_c1	nmdc:mga03683_4298_c1_3406_3972	188
396	3300050491	nmdc:mga00v17_1326_c1	nmdc:mga00v17_1326_c1_4971_5537	188
397	3300050491	nmdc:mga00v17_136982_c1	nmdc:mga00v17_136982_c1_635_1201	188
398	3300050491	nmdc:mga00v17_235739_c1	nmdc:mga00v17_235739_c1_103_669	188
399	3300050491	nmdc:mga00v17_6979_c1	nmdc:mga00v17_6979_c1_4582_5148	188
400	3300050491	nmdc:mga00v17_9270_c1	nmdc:mga00v17_9270_c1_1451_2017	188
401	3300050492	nmdc:mga0yw44_7_c1	nmdc:mga0yw44_7_c1_200890_201456	188
402	3300050492	nmdc:mga0yw44_94354_c1	nmdc:mga0yw44_94354_c1_819_1385	188
403	3300050493	nmdc:mga0k408_4338_c1	nmdc:mga0k408_4338_c1_4479_5045	188
404	3300050493	nmdc:mga0k408_691_c1	nmdc:mga0k408_691_c1_4764_5330	188
405	3300050495	nmdc:mga04h51_228573_c1	nmdc:mga04h51_228573_c1_143_709	188
406	3300050496	nmdc:mga07m45_3765_c1	nmdc:mga07m45_3765_c1_2629_3195	188
407	3300050516	nmdc:mga0sz30_145736_c1	nmdc:mga0sz30_145736_c1_146_712	188
408	3300050516	nmdc:mga0sz30_2_c1	nmdc:mga0sz30_2_c1_124779_125345	188
409	3300053087	Ga0500643_000157	Ga0500643_000157_42987_43553	188
410	3300053087	Ga0500643_002224	Ga0500643_002224_9175_9741	188
411	3300053088	Ga0500644_0001390	Ga0500644_0001390_4018_4584	188
412	3300053088	Ga0500644_0010070	Ga0500644_0010070_203_769	188
413	3300053093	Ga0500651_0440938	Ga0500651_0440938_146_712	188
414	3300053103	Ga0500555_000001	Ga0500555_000001_59986_60552	188
415	3300053103	Ga0500555_000002	Ga0500555_000002_1233616_1234182	188
416	3300053108	Ga0500562_000002	Ga0500562_000002_302808_303374	188
417	3300053117	Ga0500593_000001	Ga0500593_000001_223040_223606	188
418	3300053118	Ga0500594_0000019	Ga0500594_0000019_36382_36948	188
419	3300053129	Ga0500628_000005	Ga0500628_000005_110855_111421	188
420	3300053131	Ga0500652_000012	Ga0500652_000012_50897_51463	188
421	3300053137	Ga0500561_0000002	Ga0500561_0000002_326925_327491	188
422	3300053139	Ga0500568_0006413	Ga0500568_0006413_3341_3907	188
423	3300053142	Ga0500577_0000143	Ga0500577_0000143_2532_3098	188
424	3300053153	Ga0500616_0000005	Ga0500616_0000005_800243_800809	188
425	3300053727	Ga0500611_001283	Ga0500611_001283_1361_1927	188
426	2162886012	MBSR1b_contig_5452016	MBSR1b_0991.00005230	189
427	3300005338	Ga0068868_100475767	Ga0068868_1004757672	189
428	3300005563	Ga0068855_100000002	Ga0068855_100000002623	189
429	3300005577	Ga0068857_100144434	Ga0068857_1001444342	189
430	3300005616	Ga0068852_100000001	Ga0068852_10000000159	189
431	3300009093	Ga0105240_10000909	Ga0105240_1000090930	189
432	3300009093	Ga0105240_10117185	Ga0105240_101171854	189
433	3300009093	Ga0105240_10480195	Ga0105240_104801952	189
434	3300009174	Ga0105241_10014306	Ga0105241_100143066	189
435	3300009177	Ga0105248_10236727	Ga0105248_102367273	189
436	3300009545	Ga0105237_10000159	Ga0105237_1000015949	189
437	3300009551	Ga0105238_10000480	Ga0105238_1000048048	189
438	3300010375	Ga0105239_10396144	Ga0105239_103961443	189
439	3300013307	Ga0157372_10797752	Ga0157372_107977522	189
440	3300025913	Ga0207695_10014974	Ga0207695_100149749	189
441	3300025913	Ga0207695_10478136	Ga0207695_104781362	189
442	3300025914	Ga0207671_10000008	Ga0207671_1000000858	189
443	3300025924	Ga0207694_10000785	Ga0207694_100007856	189
444	3300025949	Ga0207667_10000005	Ga0207667_10000005733	189
445	3300026078	Ga0207702_10026125	Ga0207702_100261255	189
446	3300026116	Ga0207674_10051022	Ga0207674_100510224	189
447	3300026116	Ga0207674_10153019	Ga0207674_101530195	189
448	3300026116	Ga0207674_10980485	Ga0207674_109804852	189
449	3300026142	Ga0207698_10000001	Ga0207698_1000000111	189
450	3300031901	Ga0307406_10000001	Ga0307406_10000001642	189
451	3300031901	Ga0307406_10001261	Ga0307406_1000126113	189
452	3300044765	Ga0466970_0032787	Ga0466970_0032787_1986_2555	189
453	3300048903	Ga0496100_0444601	Ga0496100_0444601_214_783	189
454	3300048918	Ga0496115_0000001	Ga0496115_0000001_362057_362626	189
455	3300050490	nmdc:mga03n38_110106_c1	nmdc:mga03n38_110106_c1_279_866	189
456	3300053088	Ga0500644_0014536	Ga0500644_0014536_1153_1842	189
457	3300053090	Ga0500646_0022151	Ga0500646_0022151_737_1426	189
458	3300053133	Ga0500655_001360	Ga0500655_001360_2220_2789	189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09285

Elong-fact-P_C

Elongation factor P, C-terminal

172

226

0.99 PF01132

EFP

Elongation factor P (EF-P) OB domain

110

163

0.98 PF08207

EFP_N

Elongation factor P (EF-P) KOW-like domain

45

102

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5wxk-assembly1.cif.gz_B	earp bound with domain i of ef-p	0.8543	4	66
6s8z-assembly1.cif.gz_A	elongation factor p from corynebacterium glutamicum	0.8153	4	189
6s8z-assembly1.cif.gz_A	elongation factor p from corynebacterium glutamicum	0.8113	4	189
5wxk-assembly1.cif.gz_B	earp bound with domain i of ef-p	0.8093	4	66
3a5z-assembly2.cif.gz_F	crystal structure of escherichia coli genx in complex with elongation factor p	0.7998	4	60

ID	Description	Score	Start	End	Superfamily
af_I1L709_180_237_2.40.50.140	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins	0.9636	131	187	2.40.50.140
5j3bA03	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins	0.9458	131	187	2.40.50.140
1ybyB03	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins	0.9346	131	187	2.40.50.140
af_I1L709_180_237_2.40.50.140	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins	0.9319	131	187	2.40.50.140
af_P0A6N8_132_190_2.40.50.140	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins	0.928	131	188	2.40.50.140

ID	Description	Score	Start	End	GO Terms
AF-A0A2W4I513-F1-model_v4	Elongation factor P (EF-P)	0.9428	4	188	GO:0003746 GO:0005737 GO:0043043
AF-A0A1F4XLJ2-F1-model_v4	Elongation factor P (EF-P)	0.9418	4	189	GO:0003746 GO:0005737 GO:0043043
AF-A0A0G1JVK9-F1-model_v4	Elongation factor P (EF-P)	0.9369	4	187	GO:0003746 GO:0005737 GO:0043043
AF-A0A1F4VJN1-F1-model_v4	Elongation factor P (EF-P)	0.9365	4	187	GO:0003746 GO:0005737 GO:0043043
AF-A0A2W4I513-F1-model_v4	Elongation factor P (EF-P)	0.9331	4	188	GO:0003746 GO:0005737 GO:0043043

Feature Viewer

pLDDT	pTM	Quality
90.06	0.72	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F448277

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF09285

Elong-fact-P_C

Elongation factor P, C-terminal

172

226

0.99

PF01132

EFP

Elongation factor P (EF-P) OB domain

110

163

0.98

PF08207

EFP_N

Elongation factor P (EF-P) KOW-like domain

45

102

0.97

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map