metagRoot

F448259

General Info

Members	Datasets	Scaffolds	Average Seq Length
458	217	458	208

Family's Representative Sequence

Representative Sequence	3300048904\|Ga0496101_0782258\|Ga0496101_0782258_22_711
Length	229
Sequence	VTSERSDEATAADADPVAHTLAHPALGGFGRGPDGRSTEISSRQGTPDWLAASLNYCSRCGARLAFGEVAGEDRERLACQSCGFIAYVNPRLVVTAIPVTDEGRVVLLRRGIEPGRGLWAQPGGFLEVDETVSEAAIRETFEETGLVIRPGEIVGLYSRLEAAVVVIAFEAHVVAGEPRLNPEALEIATFAPADIPWPEVAFLTSKWAIRDWIRLRRPDALPTTPLLPG

Samples

	Sample ID	Description	Type	Environment
1	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
2	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
3	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
4	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
5	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
6	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
7	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
8	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
9	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
10	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
11	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
12	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
13	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
14	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
15	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
16	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
17	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
18	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
19	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
20	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
21	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
22	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
23	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
24	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
25	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
26	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
27	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
28	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
29	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
30	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
31	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
32	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
33	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
34	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
35	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
36	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
37	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
38	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
39	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
40	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
41	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
42	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
43	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
44	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
45	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
46	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
47	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
48	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
49	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
50	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
51	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
52	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
53	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
54	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
55	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
56	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
57	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
58	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
59	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
60	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
61	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
62	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
63	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
64	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
65	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
66	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
67	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
68	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
69	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
70	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
71	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
72	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
73	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
74	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
75	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
76	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
77	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
78	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
79	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
80	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
81	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
82	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
83	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
84	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
85	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
86	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
87	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
88	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
89	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
120	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
123	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
124	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
125	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
126	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
127	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
128	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
129	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
130	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
131	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
132	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
133	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
134	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
135	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
136	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
137	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
138	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
139	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
140	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
141	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
142	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
143	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
144	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
145	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
146	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
147	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
148	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
149	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
150	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
151	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
152	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
153	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
154	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
155	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
156	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
157	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
158	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
159	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
160	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
161	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
162	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
163	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
164	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
165	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
166	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
167	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
168	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
169	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
170	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
171	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
172	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
173	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
174	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
175	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
176	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
177	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
178	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
179	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
180	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
181	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
182	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
183	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
184	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
185	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
186	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
187	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
188	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
189	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
190	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
191	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
192	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
193	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
194	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
195	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
196	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
197	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
198	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
199	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
200	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
201	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
202	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
203	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
204	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
205	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
206	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
207	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
208	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
209	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
210	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
211	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
212	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
213	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
214	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
215	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
216	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
217	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.78
Metatranscriptomes	0.22
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.44
Nodule	0
Rhizoplane	8.52
Rhizosphere	90.83
Stem	0
Stem Tuber	0
Unclassified	0.22

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0070683_100171931	3300005329	Bacteria	2057
2	Ga0070670_100147700	3300005331	Bacteria	2034
3	Ga0068869_100382427	3300005334	Bacteria	1154
4	Ga0070666_10189097	3300005335	Bacteria	1446
5	Ga0070682_100136775	3300005337	Bacteria	1665
6	Ga0068868_100536901	3300005338	Bacteria	1029
7	Ga0070660_100240715	3300005339	Bacteria	1474
8	Ga0070689_100001619	3300005340	Bacteria	14378
9	Ga0070691_10159332	3300005341	Bacteria	1162
10	Ga0070687_100018919	3300005343	Bacteria	3196
11	Ga0070687_100054439	3300005343	Bacteria	2085
12	Ga0070661_100041668	3300005344	Bacteria	3351
13	Ga0070692_10071455	3300005345	Bacteria	1850
14	Ga0070674_100016789	3300005356	Bacteria	4592
15	Ga0070673_100016382	3300005364	Bacteria	5239
16	Ga0070659_100010563	3300005366	Bacteria	6797
17	Ga0070703_10071393	3300005406	Unclassified	1161
18	Ga0070701_10169684	3300005438	Bacteria	1270
19	Ga0070705_100031639	3300005440	Bacteria	2932
20	Ga0070705_100156631	3300005440	Unclassified	1518
21	Ga0070705_100301803	3300005440	Bacteria	1148
22	Ga0070705_100304535	3300005440	Bacteria	1143
23	Ga0070700_100003444	3300005441	Bacteria	8160
24	Ga0070700_100514122	3300005441	Bacteria	924
25	Ga0070694_100055927	3300005444	Bacteria	2678
26	Ga0070694_100122599	3300005444	Bacteria	1867
27	Ga0070694_100248715	3300005444	Bacteria	1344
28	Ga0070694_100305217	3300005444	Bacteria	1221
29	Ga0070694_100646024	3300005444	Bacteria	856
30	Ga0070708_100004583	3300005445	Bacteria	10884
31	Ga0070708_100124717	3300005445	Bacteria	2379
32	Ga0070708_100384944	3300005445	Bacteria	1323
33	Ga0070708_100623128	3300005445	Bacteria	1017
34	Ga0070663_100514737	3300005455	Bacteria	996
35	Ga0070678_100548934	3300005456	Bacteria	1026
36	Ga0070662_100304436	3300005457	Bacteria	1296
37	Ga0068867_100089705	3300005459	Bacteria	2331
38	Ga0068867_100124769	3300005459	Bacteria	1994
39	Ga0068867_100791233	3300005459	Bacteria	845
40	Ga0070685_10042809	3300005466	Bacteria	2586
41	Ga0070706_100000360	3300005467	Bacteria	54865
42	Ga0070706_100002124	3300005467	Bacteria	20188
43	Ga0070706_100012277	3300005467	Bacteria	7938
44	Ga0070706_100017266	3300005467	Bacteria	6662
45	Ga0070706_100340834	3300005467	Archaea	1398
46	Ga0070706_100380930	3300005467	Bacteria	1314
47	Ga0070706_100572069	3300005467	Bacteria	1051
48	Ga0070707_100002910	3300005468	Bacteria	16262
49	Ga0070707_100005585	3300005468	Bacteria	11750
50	Ga0070707_100106472	3300005468	Bacteria	2720
51	Ga0070707_100150183	3300005468	Bacteria	2268
52	Ga0070707_100419922	3300005468	Bacteria	1298
53	Ga0070707_100439089	3300005468	Bacteria	1266
54	Ga0070707_100671542	3300005468	Bacteria	999
55	Ga0070698_100040577	3300005471	Bacteria	4782
56	Ga0070698_100067344	3300005471	Bacteria	3601
57	Ga0070698_100147671	3300005471	Bacteria	2299
58	Ga0070698_100277173	3300005471	Bacteria	1609
59	Ga0070698_100349840	3300005471	Unclassified	1409
60	Ga0070699_100000514	3300005518	Bacteria	36724
61	Ga0070699_100004678	3300005518	Bacteria	12103
62	Ga0070699_100139749	3300005518	Bacteria	2138
63	Ga0070699_100318019	3300005518	Bacteria	1398
64	Ga0070699_100414695	3300005518	Unclassified	1219
65	Ga0070699_100500187	3300005518	Bacteria	1104
66	Ga0070699_100666381	3300005518	Bacteria	950
67	Ga0070699_100840077	3300005518	Unclassified	841
68	Ga0070679_100227931	3300005530	Bacteria	1823
69	Ga0070684_100103335	3300005535	Bacteria	2549
70	Ga0070697_100016532	3300005536	Bacteria	5804
71	Ga0070697_100018131	3300005536	Bacteria	5548
72	Ga0070697_100018167	3300005536	Bacteria	5542
73	Ga0070697_100052112	3300005536	Bacteria	3325
74	Ga0070697_100090255	3300005536	Bacteria	2532
75	Ga0070697_100094088	3300005536	Bacteria	2482
76	Ga0070686_100021371	3300005544	Bacteria	3846
77	Ga0070686_100199061	3300005544	Bacteria	1435
78	Ga0070695_100001526	3300005545	Bacteria	12882
79	Ga0070695_100457005	3300005545	Bacteria	980
80	Ga0070696_100000553	3300005546	Bacteria	23774
81	Ga0070696_100009517	3300005546	Bacteria	6504
82	Ga0070696_100012329	3300005546	Bacteria	5733
83	Ga0070696_100034345	3300005546	Bacteria	3488
84	Ga0070696_100047079	3300005546	Bacteria	2991
85	Ga0070696_100078550	3300005546	Bacteria	2334
86	Ga0070696_100081140	3300005546	Bacteria	2298
87	Ga0070696_100238715	3300005546	Bacteria	1370
88	Ga0070693_100443821	3300005547	Bacteria	909
89	Ga0070704_100015228	3300005549	Bacteria	4825
90	Ga0070704_100021900	3300005549	Bacteria	4151
91	Ga0070704_100044793	3300005549	Bacteria	3076
92	Ga0070704_100155312	3300005549	Bacteria	1804
93	Ga0070704_100578007	3300005549	Unclassified	985
94	Ga0068855_100212362	3300005563	Bacteria	2174
95	Ga0070664_100671437	3300005564	Bacteria	964
96	Ga0068854_100219970	3300005578	Bacteria	1502
97	Ga0068856_101171206	3300005614	Bacteria	785
98	Ga0070702_100002063	3300005615	Bacteria	8503
99	Ga0070702_100660647	3300005615	Bacteria	792
100	Ga0068852_100432884	3300005616	Bacteria	1299
101	Ga0068859_100119963	3300005617	Bacteria	2697
102	Ga0068864_100039333	3300005618	Bacteria	4042
103	Ga0068864_100063682	3300005618	Bacteria	3196
104	Ga0068866_10143146	3300005718	Bacteria	1375
105	Ga0068861_100040173	3300005719	Bacteria	3496
106	Ga0068851_10129650	3300005834	Bacteria	1363
107	Ga0068863_100028855	3300005841	Bacteria	5298
108	Ga0068863_100160159	3300005841	Bacteria	2156
109	Ga0068863_100215264	3300005841	Bacteria	1850
110	Ga0068858_100565672	3300005842	Unclassified	1101
111	Ga0068860_100008399	3300005843	Bacteria	10284
112	Ga0068860_100033945	3300005843	Bacteria	4895
113	Ga0081539_10091791	3300005985	Unclassified	1567
114	Ga0075365_10042799	3300006038	Bacteria	2962
115	Ga0070716_100491724	3300006173	Bacteria	903
116	Ga0070712_100505848	3300006175	Bacteria	1013
117	Ga0075428_100304252	3300006844	Bacteria	1714
118	Ga0075431_100158632	3300006847	Bacteria	2327
119	Ga0075431_100190719	3300006847	Bacteria	2100
120	Ga0075433_10216272	3300006852	Bacteria	1703
121	Ga0075433_10413977	3300006852	Bacteria	1189
122	Ga0075434_100082986	3300006871	Bacteria	3202
123	Ga0075434_100165889	3300006871	Bacteria	2228
124	Ga0075434_100175996	3300006871	Bacteria	2160
125	Ga0068865_100003283	3300006881	Bacteria	9680
126	Ga0097620_100119963	3300006931	Bacteria	2697
127	Ga0075435_100191721	3300007076	Bacteria	1730
128	Ga0075435_100256968	3300007076	Bacteria	1488
129	Ga0075435_100906512	3300007076	Bacteria	769
130	Ga0105244_10325638	3300009036	Bacteria	709
131	Ga0111539_10037956	3300009094	Bacteria	5811
132	Ga0111539_10215277	3300009094	Bacteria	2238
133	Ga0111539_10768027	3300009094	Unclassified	1122
134	Ga0105245_10323952	3300009098	Bacteria	1519
135	Ga0105245_10330952	3300009098	Bacteria	1503
136	Ga0105245_10433097	3300009098	Bacteria	1320
137	Ga0105247_10369470	3300009101	Bacteria	1014
138	Ga0114129_10047397	3300009147	Bacteria	6038
139	Ga0114129_10058892	3300009147	Bacteria	5372
140	Ga0114129_10431361	3300009147	Bacteria	1732
141	Ga0114129_10498200	3300009147	Bacteria	1591
142	Ga0114129_10656261	3300009147	Unclassified	1353
143	Ga0105243_10578989	3300009148	Bacteria	1077
144	Ga0105241_10552244	3300009174	Bacteria	1034
145	Ga0105242_10105382	3300009176	Bacteria	2395
146	Ga0105242_10192933	3300009176	Bacteria	1805
147	Ga0105248_10018739	3300009177	Bacteria	7653
148	Ga0105248_10262189	3300009177	Bacteria	1945
149	Ga0105248_10576985	3300009177	Bacteria	1269
150	Ga0105248_10591468	3300009177	Bacteria	1252
151	Ga0105238_10393186	3300009551	Bacteria	1379
152	Ga0105249_10002247	3300009553	Bacteria	16765
153	Ga0105249_10009004	3300009553	Bacteria	8721
154	Ga0105249_10525873	3300009553	Bacteria	1231
155	Ga0105249_10582615	3300009553	Bacteria	1172
156	Ga0105249_11064085	3300009553	Bacteria	879
157	Ga0099796_10056612	3300010159	Bacteria	1377
158	Ga0105239_10024546	3300010375	Bacteria	6641
159	Ga0105239_10038354	3300010375	Bacteria	5250
160	Ga0105239_10700739	3300010375	Bacteria	1158
161	Ga0105239_11245466	3300010375	Unclassified	858
162	Ga0105246_10423240	3300011119	Bacteria	1112
163	Ga0157374_10553500	3300013296	Bacteria	1158
164	Ga0157378_11290368	3300013297	Bacteria	771
165	Ga0163162_10226305	3300013306	Bacteria	2000
166	Ga0163162_10226629	3300013306	Unclassified	1999
167	Ga0163162_10571190	3300013306	Bacteria	1258
168	Ga0157375_10027400	3300013308	Bacteria	5325
169	Ga0157375_10076032	3300013308	Bacteria	3383
170	Ga0163163_10017916	3300014325	Bacteria	6615
171	Ga0163163_10071624	3300014325	Bacteria	3454
172	Ga0163163_10302627	3300014325	Bacteria	1651
173	Ga0163163_10442651	3300014325	Bacteria	1359
174	Ga0157380_10050949	3300014326	Bacteria	3271
175	Ga0157380_10161908	3300014326	Bacteria	1946
176	Ga0157380_10790064	3300014326	Bacteria	965
177	Ga0182008_10020237	3300014497	Bacteria	3429
178	Ga0182008_10253659	3300014497	Bacteria	908
179	Ga0157377_10002990	3300014745	Bacteria	7573
180	Ga0157379_10023454	3300014968	Bacteria	5477
181	Ga0157379_10100401	3300014968	Bacteria	2598
182	Ga0157379_10286051	3300014968	Bacteria	1501
183	Ga0163161_10318894	3300017792	Bacteria	1228
184	Ga0206356_11218727	3300020070	Bacteria	1338
185	Ga0207653_10034618	3300025885	Bacteria	1641
186	Ga0207688_10007898	3300025901	Bacteria	5791
187	Ga0207643_10003512	3300025908	Bacteria	8430
188	Ga0207684_10000143	3300025910	Bacteria	127272
189	Ga0207684_10014082	3300025910	Bacteria	6906
190	Ga0207684_10023218	3300025910	Bacteria	5297
191	Ga0207684_10049677	3300025910	Bacteria	3558
192	Ga0207684_10121349	3300025910	Bacteria	2241
193	Ga0207707_10205398	3300025912	Bacteria	1717
194	Ga0207663_10324911	3300025916	Bacteria	1157
195	Ga0207660_10000003	3300025917	Bacteria	675759
196	Ga0207662_10010504	3300025918	Bacteria	5115
197	Ga0207662_10071824	3300025918	Bacteria	2096
198	Ga0207652_10229573	3300025921	Bacteria	1673
199	Ga0207646_10001168	3300025922	Bacteria	33305
200	Ga0207646_10001479	3300025922	Bacteria	29023
201	Ga0207646_10015719	3300025922	Bacteria	7132
202	Ga0207646_10022068	3300025922	Bacteria	5872
203	Ga0207646_10027094	3300025922	Bacteria	5226
204	Ga0207646_10324336	3300025922	Bacteria	1391
205	Ga0207659_10110943	3300025926	Bacteria	2085
206	Ga0207659_10258552	3300025926	Bacteria	1415
207	Ga0207659_10675744	3300025926	Bacteria	883
208	Ga0207687_10061518	3300025927	Bacteria	2652
209	Ga0207687_10074283	3300025927	Bacteria	2436
210	Ga0207644_10806894	3300025931	Bacteria	785
211	Ga0207706_10008131	3300025933	Bacteria	9680
212	Ga0207706_10201380	3300025933	Bacteria	1746
213	Ga0207706_10618577	3300025933	Bacteria	929
214	Ga0207686_10173675	3300025934	Bacteria	1522
215	Ga0207709_10019682	3300025935	Bacteria	3799
216	Ga0207709_10181648	3300025935	Bacteria	1486
217	Ga0207709_10459461	3300025935	Bacteria	986
218	Ga0207709_10828031	3300025935	Bacteria	749
219	Ga0207670_10024276	3300025936	Bacteria	3787
220	Ga0207669_10081458	3300025937	Bacteria	2074
221	Ga0207711_10148765	3300025941	Bacteria	2112
222	Ga0207667_10042924	3300025949	Bacteria	4802
223	Ga0207651_10718334	3300025960	Bacteria	881
224	Ga0207640_10220768	3300025981	Bacteria	1451
225	Ga0207640_10370279	3300025981	Bacteria	1157
226	Ga0207640_10805436	3300025981	Bacteria	814
227	Ga0207703_10354414	3300026035	Bacteria	1352
228	Ga0207678_10009511	3300026067	Bacteria	8552
229	Ga0207708_10000493	3300026075	Bacteria	30297
230	Ga0207708_10049586	3300026075	Bacteria	3198
231	Ga0207708_10395029	3300026075	Unclassified	1142
232	Ga0207641_10500742	3300026088	Bacteria	1180
233	Ga0207648_10008425	3300026089	Bacteria	9985
234	Ga0207648_10118228	3300026089	Bacteria	2329
235	Ga0207648_10629845	3300026089	Bacteria	990
236	Ga0207676_10274612	3300026095	Unclassified	1528
237	Ga0207676_10693839	3300026095	Bacteria	986
238	Ga0207674_10004737	3300026116	Bacteria	16310
239	Ga0207674_10191129	3300026116	Bacteria	1997
240	Ga0207698_10180260	3300026142	Bacteria	1870
241	Ga0207698_10429830	3300026142	Bacteria	1269
242	Ga0207428_10070295	3300027907	Bacteria	2751
243	Ga0207428_10298242	3300027907	Unclassified	1193
244	Ga0268265_10109546	3300028380	Bacteria	2251
245	Ga0268264_10062053	3300028381	Bacteria	3137
246	Ga0268264_10538239	3300028381	Bacteria	1144
247	Ga0265319_1021236	3300028563	Bacteria	2388
248	Ga0265334_10020341	3300028573	Bacteria	2719
249	Ga0265318_10005715	3300028577	Bacteria	5821
250	Ga0265318_10071876	3300028577	Unclassified	1282
251	Ga0265318_10083044	3300028577	Unclassified	1182
252	Ga0265336_10009746	3300028666	Bacteria	3312
253	Ga0265338_10230799	3300028800	Unclassified	1377
254	Ga0265332_10057222	3300031238	Bacteria	1670
255	Ga0265320_10007662	3300031240	Bacteria	6679
256	Ga0265325_10030533	3300031241	Bacteria	2889
257	Ga0265325_10110709	3300031241	Unclassified	1335
258	Ga0265329_10013528	3300031242	Bacteria	2906
259	Ga0265340_10015432	3300031247	Bacteria	3968
260	Ga0265339_10040427	3300031249	Bacteria	2592
261	Ga0265339_10043132	3300031249	Bacteria	2495
262	Ga0265339_10157616	3300031249	Unclassified	1144
263	Ga0265331_10028559	3300031250	Bacteria	2789
264	Ga0265331_10093068	3300031250	Bacteria	1392
265	Ga0265316_10350151	3300031344	Unclassified	1069
266	Ga0307408_100509003	3300031548	Unclassified	1055
267	Ga0265314_10047592	3300031711	Bacteria	3015
268	Ga0265314_10136054	3300031711	Bacteria	1525
269	Ga0265314_10348320	3300031711	Unclassified	816
270	Ga0307405_10120914	3300031731	Unclassified	1792
271	Ga0307406_10009083	3300031901	Bacteria	5562
272	Ga0307409_100103413	3300031995	Bacteria	2369
273	Ga0307416_100021974	3300032002	Bacteria	4594
274	Ga0307411_10279648	3300032005	Unclassified	1328
275	Ga0307415_100049530	3300032126	Bacteria	2841
276	Ga0307415_100987877	3300032126	Bacteria	781
277	Ga0373928_0033934	3300035084	Bacteria	1143
278	Ga0373941_0091365	3300035115	Archaea	1045
279	Ga0373931_0113232	3300035691	Bacteria	1542
280	Ga0373937_0079715	3300036401	Bacteria	3027
281	Ga0373937_0125513	3300036401	Bacteria	2394
282	Ga0373937_0652726	3300036401	Bacteria	998
283	Ga0451802_1441249	3300041460	Bacteria	1029
284	Ga0451853_1970243	3300041512	Unclassified	663
285	Ga0450910_020706	3300042147	Bacteria	993
286	Ga0451577_0102513	3300042876	Unclassified	2557
287	Ga0453683_0107329	3300044673	Bacteria	1755
288	Ga0453684_0423386	3300044712	Unclassified	1487
289	Ga0451576_0459308	3300045051	Bacteria	1337
290	Ga0451576_0761829	3300045051	Bacteria	1017
291	Ga0466967_1069952	3300045976	Bacteria	803
292	Ga0495603_0048174	3300046455	Bacteria	2538
293	Ga0495641_0053919	3300046461	Bacteria	1828
294	Ga0495628_0453903	3300046516	Bacteria	931
295	Ga0495630_0300444	3300046517	Bacteria	1227
296	Ga0495630_0526909	3300046517	Bacteria	906
297	Ga0495640_0534890	3300046533	Bacteria	711
298	Ga0495587_0143495	3300046536	Bacteria	1362
299	Ga0495588_0120059	3300046674	Bacteria	1386
300	Ga0495658_0217380	3300046683	Bacteria	1196
301	Ga0496100_0344127	3300048903	Bacteria	1125
302	Ga0496100_0403423	3300048903	Bacteria	1042
303	Ga0496101_0323540	3300048904	Bacteria	1210
304	Ga0496101_0782258	3300048904	Bacteria	753
305	Ga0496102_0036203	3300048905	Bacteria	4446
306	Ga0496102_0056780	3300048905	Bacteria	3572
307	Ga0496102_0077512	3300048905	Bacteria	3059
308	Ga0496102_0159316	3300048905	Bacteria	2123
309	Ga0496102_0679770	3300048905	Bacteria	952
310	Ga0496103_0042159	3300048906	Bacteria	2807
311	Ga0496103_0221931	3300048906	Bacteria	1216
312	Ga0496104_0054904	3300048907	Bacteria	3766
313	Ga0496105_0015209	3300048908	Bacteria	6128
314	Ga0496106_0095541	3300048909	Bacteria	2299
315	Ga0496106_0330879	3300048909	Bacteria	1223
316	Ga0496106_0381637	3300048909	Bacteria	1132
317	Ga0496107_0066985	3300048910	Bacteria	2604
318	Ga0496107_0127846	3300048910	Bacteria	1875
319	Ga0496107_0157177	3300048910	Bacteria	1684
320	Ga0496107_0263807	3300048910	Bacteria	1282
321	Ga0496108_0015006	3300048911	Bacteria	6324
322	Ga0496108_0317798	3300048911	Bacteria	1357
323	Ga0496108_0933509	3300048911	Bacteria	744
324	Ga0496109_0011799	3300048912	Bacteria	7520
325	Ga0496109_0056798	3300048912	Bacteria	3571
326	Ga0496109_0063933	3300048912	Bacteria	3366
327	Ga0496109_0169463	3300048912	Bacteria	2048
328	Ga0496109_0552562	3300048912	Unclassified	1086
329	Ga0496110_0009543	3300048913	Bacteria	7855
330	Ga0496110_0011573	3300048913	Bacteria	7231
331	Ga0496112_0000069	3300048915	Bacteria	68177
332	Ga0496112_0016398	3300048915	Bacteria	6939
333	Ga0496112_0150113	3300048915	Bacteria	2298
334	Ga0496112_0401335	3300048915	Bacteria	1311
335	Ga0496113_0018109	3300048916	Bacteria	4901
336	Ga0496113_0089421	3300048916	Bacteria	2370
337	Ga0496114_0034666	3300048917	Bacteria	4165
338	Ga0496114_0328988	3300048917	Bacteria	1351
339	Ga0501032_0173402	3300049569	Bacteria	1414
340	Ga0501032_0458908	3300049569	Unclassified	816
341	Ga0501033_0462095	3300049570	Bacteria	881
342	Ga0501036_0220134	3300049572	Unclassified	1594
343	Ga0501036_0720386	3300049572	Bacteria	824
344	Ga0501037_0025616	3300049573	Bacteria	4358
345	Ga0501038_0099231	3300049574	Bacteria	2428
346	Ga0501038_0179491	3300049574	Bacteria	1709
347	Ga0501039_0095395	3300049575	Bacteria	2319
348	Ga0501039_0106556	3300049575	Unclassified	2189
349	Ga0501039_0758786	3300049575	Unclassified	757
350	Ga0501040_0033052	3300049576	Bacteria	3502
351	Ga0501040_0041543	3300049576	Unclassified	3132
352	Ga0501040_0102397	3300049576	Bacteria	1998
353	Ga0501040_0102825	3300049576	Bacteria	1994
354	Ga0501040_0365436	3300049576	Bacteria	1034
355	Ga0501040_0537542	3300049576	Bacteria	843
356	Ga0501041_0043524	3300049577	Bacteria	2730
357	Ga0501041_0149195	3300049577	Unclassified	1459
358	Ga0501041_0181376	3300049577	Bacteria	1318
359	Ga0501041_0463008	3300049577	Bacteria	805
360	Ga0501041_0580085	3300049577	Bacteria	715
361	Ga0501042_0076152	3300049578	Bacteria	2401
362	Ga0501042_0096863	3300049578	Unclassified	2120
363	Ga0501042_0123251	3300049578	Bacteria	1866
364	Ga0501042_0446675	3300049578	Bacteria	938
365	Ga0501046_0091696	3300049580	Bacteria	2337
366	Ga0501046_0106535	3300049580	Bacteria	2145
367	Ga0501046_0123341	3300049580	Bacteria	1970
368	Ga0501046_0190109	3300049580	Bacteria	1532
369	Ga0501048_0022619	3300049582	Bacteria	4596
370	Ga0501048_0108423	3300049582	Bacteria	1960
371	Ga0501048_0400035	3300049582	Unclassified	982
372	Ga0501068_0056970	3300049584	Bacteria	2369
373	Ga0501068_0182903	3300049584	Bacteria	1326
374	Ga0501069_0307184	3300049585	Bacteria	931
375	Ga0501070_0124684	3300049586	Bacteria	2129
376	Ga0501070_0252081	3300049586	Unclassified	1444
377	Ga0501071_0033208	3300049587	Bacteria	3667
378	Ga0501071_0033273	3300049587	Bacteria	3662
379	Ga0501071_0218419	3300049587	Bacteria	1434
380	Ga0501071_0244461	3300049587	Unclassified	1353
381	Ga0501071_0428345	3300049587	Unclassified	1011
382	Ga0501072_0311514	3300049588	Bacteria	1251
383	Ga0501072_0594595	3300049588	Bacteria	872
384	Ga0501072_0724150	3300049588	Bacteria	781
385	Ga0501074_0079670	3300049590	Bacteria	2350
386	Ga0501074_0390636	3300049590	Bacteria	987
387	Ga0501075_0040171	3300049591	Bacteria	3503
388	Ga0501075_0127633	3300049591	Bacteria	1937
389	Ga0501075_0153598	3300049591	Bacteria	1755
390	Ga0501075_0928287	3300049591	Unclassified	661
391	Ga0501076_0108928	3300049592	Bacteria	2238
392	Ga0501076_0157484	3300049592	Bacteria	1849
393	Ga0501077_0010514	3300049593	Bacteria	5761
394	Ga0501077_0027549	3300049593	Bacteria	3608
395	Ga0501077_0129157	3300049593	Bacteria	1602
396	Ga0501077_0237001	3300049593	Bacteria	1160
397	Ga0501077_0244195	3300049593	Bacteria	1141
398	Ga0501077_0348170	3300049593	Unclassified	945
399	Ga0501079_0037378	3300049741	Bacteria	3742
400	Ga0501079_0045761	3300049741	Bacteria	3377
401	Ga0501079_0123142	3300049741	Unclassified	2017
402	Ga0501079_0149887	3300049741	Bacteria	1818
403	Ga0501079_0151495	3300049741	Unclassified	1808
404	Ga0501079_0235120	3300049741	Bacteria	1432
405	Ga0501079_0504161	3300049741	Bacteria	951
406	Ga0501080_0200204	3300049742	Bacteria	1834
407	Ga0501080_0333543	3300049742	Unclassified	1371
408	Ga0501080_0447670	3300049742	Bacteria	1158
409	Ga0501081_0023574	3300049743	Bacteria	4126
410	Ga0501081_0076265	3300049743	Bacteria	2341
411	Ga0501081_0077044	3300049743	Bacteria	2329
412	Ga0501081_0134294	3300049743	Bacteria	1770
413	Ga0501083_0372855	3300049744	Bacteria	928
414	Ga0501035_0047115	3300049822	Bacteria	3872
415	Ga0501045_0014627	3300049824	Bacteria	5564
416	Ga0501045_0040125	3300049824	Bacteria	3406
417	Ga0501045_0048533	3300049824	Unclassified	3095
418	Ga0501045_0053863	3300049824	Bacteria	2940
419	Ga0501045_0072539	3300049824	Bacteria	2535
420	Ga0501045_0164086	3300049824	Bacteria	1654
421	Ga0501045_0444739	3300049824	Unclassified	964
422	nmdc:mga0yw44_286520_c1	3300050492	Unclassified	1102
423	nmdc:mga05p37_236501_c1	3300050507	Bacteria	1651
424	nmdc:mga05p37_254172_c1	3300050507	Bacteria	2106
425	nmdc:mga05p37_4500_c1	3300050507	Bacteria	16293
426	nmdc:mga05p37_57891_c1	3300050507	Bacteria	4773
427	nmdc:mga05p37_58437_c1	3300050507	Bacteria	4750
428	nmdc:mga05p37_664640_c1	3300050507	Unclassified	1164
429	nmdc:mga06r32_76371_c1	3300050510	Bacteria	3253
430	nmdc:mga08y16_31919_c1	3300050511	Bacteria	3218
431	nmdc:mga08y16_874113_c1	3300050511	Bacteria	887
432	nmdc:mga0n895_170914_c1	3300050512	Bacteria	2205
433	nmdc:mga0n895_206403_c1	3300050512	Bacteria	1995
434	nmdc:mga0n895_266322_c1	3300050512	Bacteria	1738
435	nmdc:mga0n895_327594_c1	3300050512	Bacteria	1552
436	nmdc:mga0a205_141657_c1	3300050515	Bacteria	2304
437	nmdc:mga0a205_259804_c1	3300050515	Bacteria	773
438	nmdc:mga0a205_28815_c1	3300050515	Bacteria	5309
439	nmdc:mga0a205_597744_c1	3300050515	Unclassified	956
440	Ga0495601_0119392	3300053077	Bacteria	1712
441	Ga0495601_0143042	3300053077	Bacteria	1560
442	Ga0495612_0000036	3300053078	Bacteria	67883
443	Ga0495619_0515157	3300053085	Bacteria	822
444	Ga0501084_0104172	3300054114	Bacteria	2383
445	Ga0501084_0427610	3300054114	Bacteria	1119
446	Ga0501084_0542658	3300054114	Bacteria	982
447	Ga0590071_001480	3300059421	Bacteria	6196
448	Ga0590075_001517	3300059424	Bacteria	5780
449	Ga0590077_003421	3300059426	Bacteria	3286
450	Ga0501082_0048832	3300060353	Bacteria	3648
451	Ga0501082_0105078	3300060353	Bacteria	2443
452	Ga0501082_0401128	3300060353	Bacteria	1197
453	Ga0530510_0028344	3300061734	Bacteria	4015
454	Ga0530510_0088713	3300061734	Bacteria	2254
455	Ga0530510_0111470	3300061734	Bacteria	2004
456	Ga0530510_0119813	3300061734	Bacteria	1931
457	Ga0530510_0198398	3300061734	Bacteria	1490
458	Ga0530510_0453851	3300061734	Unclassified	969

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049576	Ga0501040_0365436	Ga0501040_0365436_381_935	184
2	3300049577	Ga0501041_0463008	Ga0501041_0463008_61_615	184
3	3300049578	Ga0501042_0446675	Ga0501042_0446675_242_796	184
4	3300049584	Ga0501068_0182903	Ga0501068_0182903_106_660	184
5	3300049587	Ga0501071_0218419	Ga0501071_0218419_491_1045	184
6	3300049590	Ga0501074_0390636	Ga0501074_0390636_299_853	184
7	3300049592	Ga0501076_0108928	Ga0501076_0108928_974_1528	184
8	3300049593	Ga0501077_0129157	Ga0501077_0129157_467_1021	184
9	3300049741	Ga0501079_0235120	Ga0501079_0235120_381_935	184
10	3300049743	Ga0501081_0076265	Ga0501081_0076265_16_570	184
11	3300049744	Ga0501083_0372855	Ga0501083_0372855_280_834	184
12	3300049824	Ga0501045_0164086	Ga0501045_0164086_257_811	184
13	3300054114	Ga0501084_0427610	Ga0501084_0427610_327_881	184
14	3300061734	Ga0530510_0198398	Ga0530510_0198398_224_778	184
15	3300049582	Ga0501048_0400035	Ga0501048_0400035_177_734	185
16	3300036401	Ga0373937_0079715	Ga0373937_0079715_674_1240	188
17	3300036401	Ga0373937_0125513	Ga0373937_0125513_392_958	188
18	3300048915	Ga0496112_0000069	Ga0496112_0000069_8751_9317	188
19	3300041460	Ga0451802_1441249	Ga0451802_1441249_427_1011	190
20	3300005438	Ga0070701_10169684	Ga0070701_101696842	191
21	3300059421	Ga0590071_001480	Ga0590071_001480_4404_4997	197
22	3300059424	Ga0590075_001517	Ga0590075_001517_1105_1698	197
23	3300059426	Ga0590077_003421	Ga0590077_003421_1220_1813	197
24	3300046533	Ga0495640_0534890	Ga0495640_0534890_29_691	198
25	3300046536	Ga0495587_0143495	Ga0495587_0143495_550_1212	198
26	3300005536	Ga0070697_100094088	Ga0070697_1000940882	199
27	3300005549	Ga0070704_100155312	Ga0070704_1001553121	199
28	3300013297	Ga0157378_11290368	Ga0157378_112903681	199
29	3300005444	Ga0070694_100122599	Ga0070694_1001225992	200
30	3300005444	Ga0070694_100248715	Ga0070694_1002487152	200
31	3300005444	Ga0070694_100646024	Ga0070694_1006460242	200
32	3300005467	Ga0070706_100002124	Ga0070706_10000212410	200
33	3300005467	Ga0070706_100340834	Ga0070706_1003408342	200
34	3300005468	Ga0070707_100150183	Ga0070707_1001501833	200
35	3300005471	Ga0070698_100040577	Ga0070698_1000405772	200
36	3300005471	Ga0070698_100147671	Ga0070698_1001476713	200
37	3300005518	Ga0070699_100414695	Ga0070699_1004146952	200
38	3300005518	Ga0070699_100666381	Ga0070699_1006663812	200
39	3300005518	Ga0070699_100840077	Ga0070699_1008400771	200
40	3300005536	Ga0070697_100018167	Ga0070697_1000181673	200
41	3300005536	Ga0070697_100090255	Ga0070697_1000902553	200
42	3300005546	Ga0070696_100000553	Ga0070696_10000055314	200
43	3300005549	Ga0070704_100578007	Ga0070704_1005780071	200
44	3300006852	Ga0075433_10216272	Ga0075433_102162722	200
45	3300006852	Ga0075433_10413977	Ga0075433_104139772	200
46	3300006871	Ga0075434_100082986	Ga0075434_1000829862	200
47	3300007076	Ga0075435_100256968	Ga0075435_1002569683	200
48	3300007076	Ga0075435_100906512	Ga0075435_1009065121	200
49	3300009177	Ga0105248_10591468	Ga0105248_105914682	200
50	3300025910	Ga0207684_10049677	Ga0207684_100496775	200
51	3300025918	Ga0207662_10071824	Ga0207662_100718242	200
52	3300025922	Ga0207646_10027094	Ga0207646_100270944	200
53	3300026116	Ga0207674_10191129	Ga0207674_101911293	200
54	3300050512	nmdc:mga0n895_206403_c1	nmdc:mga0n895_206403_c1_200_820	200
55	3300050515	nmdc:mga0a205_141657_c1	nmdc:mga0a205_141657_c1_1560_2180	200
56	3300050515	nmdc:mga0a205_28815_c1	nmdc:mga0a205_28815_c1_3718_4338	200
57	3300005544	Ga0070686_100199061	Ga0070686_1001990611	201
58	3300005545	Ga0070695_100457005	Ga0070695_1004570052	201
59	3300009098	Ga0105245_10330952	Ga0105245_103309521	201
60	3300025927	Ga0207687_10074283	Ga0207687_100742833	201
61	3300025935	Ga0207709_10181648	Ga0207709_101816483	201
62	3300025981	Ga0207640_10220768	Ga0207640_102207682	201
63	3300048905	Ga0496102_0159316	Ga0496102_0159316_129_752	201
64	3300048906	Ga0496103_0221931	Ga0496103_0221931_141_764	201
65	3300048909	Ga0496106_0095541	Ga0496106_0095541_801_1424	201
66	3300048910	Ga0496107_0157177	Ga0496107_0157177_479_1102	201
67	3300005440	Ga0070705_100301803	Ga0070705_1003018031	202
68	3300014497	Ga0182008_10253659	Ga0182008_102536591	202
69	3300049572	Ga0501036_0720386	Ga0501036_0720386_52_663	203
70	3300005331	Ga0070670_100147700	Ga0070670_1001477002	204
71	3300005335	Ga0070666_10189097	Ga0070666_101890972	204
72	3300005337	Ga0070682_100136775	Ga0070682_1001367753	204
73	3300005340	Ga0070689_100001619	Ga0070689_1000016198	204
74	3300005341	Ga0070691_10159332	Ga0070691_101593322	204
75	3300005343	Ga0070687_100054439	Ga0070687_1000544392	204
76	3300005344	Ga0070661_100041668	Ga0070661_1000416682	204
77	3300005345	Ga0070692_10071455	Ga0070692_100714552	204
78	3300005356	Ga0070674_100016789	Ga0070674_1000167892	204
79	3300005364	Ga0070673_100016382	Ga0070673_1000163825	204
80	3300005366	Ga0070659_100010563	Ga0070659_1000105639	204
81	3300005440	Ga0070705_100031639	Ga0070705_1000316393	204
82	3300005441	Ga0070700_100003444	Ga0070700_1000034447	204
83	3300005441	Ga0070700_100514122	Ga0070700_1005141222	204
84	3300005444	Ga0070694_100055927	Ga0070694_1000559272	204
85	3300005445	Ga0070708_100004583	Ga0070708_1000045837	204
86	3300005455	Ga0070663_100514737	Ga0070663_1005147371	204
87	3300005457	Ga0070662_100304436	Ga0070662_1003044362	204
88	3300005459	Ga0068867_100089705	Ga0068867_1000897052	204
89	3300005466	Ga0070685_10042809	Ga0070685_100428092	204
90	3300005467	Ga0070706_100012277	Ga0070706_1000122773	204
91	3300005467	Ga0070706_100380930	Ga0070706_1003809302	204
92	3300005468	Ga0070707_100005585	Ga0070707_1000055851	204
93	3300005471	Ga0070698_100277173	Ga0070698_1002771732	204
94	3300005471	Ga0070698_100349840	Ga0070698_1003498401	204
95	3300005518	Ga0070699_100139749	Ga0070699_1001397493	204
96	3300005518	Ga0070699_100318019	Ga0070699_1003180192	204
97	3300005518	Ga0070699_100500187	Ga0070699_1005001872	204
98	3300005530	Ga0070679_100227931	Ga0070679_1002279312	204
99	3300005536	Ga0070697_100018131	Ga0070697_1000181314	204
100	3300005544	Ga0070686_100021371	Ga0070686_1000213714	204
101	3300005546	Ga0070696_100012329	Ga0070696_1000123292	204
102	3300005546	Ga0070696_100238715	Ga0070696_1002387151	204
103	3300005614	Ga0068856_101171206	Ga0068856_1011712062	204
104	3300005615	Ga0070702_100002063	Ga0070702_1000020638	204
105	3300005616	Ga0068852_100432884	Ga0068852_1004328842	204
106	3300005617	Ga0068859_100119963	Ga0068859_1001199633	204
107	3300005618	Ga0068864_100039333	Ga0068864_1000393336	204
108	3300005718	Ga0068866_10143146	Ga0068866_101431463	204
109	3300005719	Ga0068861_100040173	Ga0068861_1000401736	204
110	3300005834	Ga0068851_10129650	Ga0068851_101296502	204
111	3300005841	Ga0068863_100215264	Ga0068863_1002152642	204
112	3300005843	Ga0068860_100008399	Ga0068860_10000839910	204
113	3300005985	Ga0081539_10091791	Ga0081539_100917913	204
114	3300006038	Ga0075365_10042799	Ga0075365_100427993	204
115	3300006844	Ga0075428_100304252	Ga0075428_1003042522	204
116	3300006847	Ga0075431_100158632	Ga0075431_1001586324	204
117	3300006871	Ga0075434_100175996	Ga0075434_1001759964	204
118	3300006881	Ga0068865_100003283	Ga0068865_1000032835	204
119	3300006931	Ga0097620_100119963	Ga0097620_1001199633	204
120	3300007076	Ga0075435_100191721	Ga0075435_1001917212	204
121	3300009036	Ga0105244_10325638	Ga0105244_103256381	204
122	3300009094	Ga0111539_10037956	Ga0111539_100379564	204
123	3300009094	Ga0111539_10215277	Ga0111539_102152773	204
124	3300009094	Ga0111539_10768027	Ga0111539_107680272	204
125	3300009147	Ga0114129_10058892	Ga0114129_100588925	204
126	3300009147	Ga0114129_10431361	Ga0114129_104313612	204
127	3300009147	Ga0114129_10498200	Ga0114129_104982002	204
128	3300009147	Ga0114129_10656261	Ga0114129_106562612	204
129	3300009148	Ga0105243_10578989	Ga0105243_105789892	204
130	3300009174	Ga0105241_10552244	Ga0105241_105522441	204
131	3300009176	Ga0105242_10105382	Ga0105242_101053824	204
132	3300009177	Ga0105248_10018739	Ga0105248_100187393	204
133	3300009551	Ga0105238_10393186	Ga0105238_103931862	204
134	3300009553	Ga0105249_10002247	Ga0105249_100022472	204
135	3300010375	Ga0105239_10038354	Ga0105239_100383543	204
136	3300010375	Ga0105239_11245466	Ga0105239_112454661	204
137	3300011119	Ga0105246_10423240	Ga0105246_104232402	204
138	3300013296	Ga0157374_10553500	Ga0157374_105535002	204
139	3300013306	Ga0163162_10226305	Ga0163162_102263052	204
140	3300013308	Ga0157375_10027400	Ga0157375_100274006	204
141	3300014325	Ga0163163_10017916	Ga0163163_100179167	204
142	3300014326	Ga0157380_10050949	Ga0157380_100509495	204
143	3300014745	Ga0157377_10002990	Ga0157377_100029904	204
144	3300014968	Ga0157379_10100401	Ga0157379_101004012	204
145	3300017792	Ga0163161_10318894	Ga0163161_103188942	204
146	3300025901	Ga0207688_10007898	Ga0207688_100078987	204
147	3300025908	Ga0207643_10003512	Ga0207643_1000351210	204
148	3300025910	Ga0207684_10014082	Ga0207684_100140828	204
149	3300025918	Ga0207662_10010504	Ga0207662_100105046	204
150	3300025922	Ga0207646_10015719	Ga0207646_100157198	204
151	3300025922	Ga0207646_10324336	Ga0207646_103243362	204
152	3300025926	Ga0207659_10258552	Ga0207659_102585523	204
153	3300025927	Ga0207687_10061518	Ga0207687_100615182	204
154	3300025931	Ga0207644_10806894	Ga0207644_108068941	204
155	3300025933	Ga0207706_10008131	Ga0207706_100081318	204
156	3300025934	Ga0207686_10173675	Ga0207686_101736752	204
157	3300025935	Ga0207709_10019682	Ga0207709_100196822	204
158	3300025935	Ga0207709_10828031	Ga0207709_108280311	204
159	3300025936	Ga0207670_10024276	Ga0207670_100242764	204
160	3300025937	Ga0207669_10081458	Ga0207669_100814582	204
161	3300025960	Ga0207651_10718334	Ga0207651_107183342	204
162	3300025981	Ga0207640_10370279	Ga0207640_103702792	204
163	3300026035	Ga0207703_10354414	Ga0207703_103544143	204
164	3300026067	Ga0207678_10009511	Ga0207678_100095116	204
165	3300026075	Ga0207708_10000493	Ga0207708_100004937	204
166	3300026075	Ga0207708_10395029	Ga0207708_103950292	204
167	3300026089	Ga0207648_10008425	Ga0207648_100084252	204
168	3300026116	Ga0207674_10004737	Ga0207674_100047373	204
169	3300026142	Ga0207698_10180260	Ga0207698_101802603	204
170	3300027907	Ga0207428_10070295	Ga0207428_100702952	204
171	3300027907	Ga0207428_10298242	Ga0207428_102982422	204
172	3300028381	Ga0268264_10062053	Ga0268264_100620534	204
173	3300031548	Ga0307408_100509003	Ga0307408_1005090032	204
174	3300031731	Ga0307405_10120914	Ga0307405_101209141	204
175	3300031901	Ga0307406_10009083	Ga0307406_100090832	204
176	3300032002	Ga0307416_100021974	Ga0307416_1000219744	204
177	3300032126	Ga0307415_100049530	Ga0307415_1000495302	204
178	3300035084	Ga0373928_0033934	Ga0373928_0033934_484_1098	204
179	3300035115	Ga0373941_0091365	Ga0373941_0091365_335_949	204
180	3300035691	Ga0373931_0113232	Ga0373931_0113232_570_1184	204
181	3300041512	Ga0451853_1970243	Ga0451853_1970243_38_652	204
182	3300042147	Ga0450910_020706	Ga0450910_020706_153_767	204
183	3300044673	Ga0453683_0107329	Ga0453683_0107329_38_670	204
184	3300046516	Ga0495628_0453903	Ga0495628_0453903_238_909	204
185	3300048905	Ga0496102_0036203	Ga0496102_0036203_1640_2254	204
186	3300048910	Ga0496107_0127846	Ga0496107_0127846_1120_1734	204
187	3300048911	Ga0496108_0015006	Ga0496108_0015006_5232_5846	204
188	3300048912	Ga0496109_0056798	Ga0496109_0056798_2246_2860	204
189	3300048913	Ga0496110_0011573	Ga0496110_0011573_1615_2229	204
190	3300048915	Ga0496112_0150113	Ga0496112_0150113_943_1557	204
191	3300048916	Ga0496113_0089421	Ga0496113_0089421_159_773	204
192	3300048917	Ga0496114_0034666	Ga0496114_0034666_3436_4050	204
193	3300049569	Ga0501032_0173402	Ga0501032_0173402_415_1029	204
194	3300049569	Ga0501032_0458908	Ga0501032_0458908_127_741	204
195	3300049570	Ga0501033_0462095	Ga0501033_0462095_213_827	204
196	3300049572	Ga0501036_0220134	Ga0501036_0220134_395_1009	204
197	3300049574	Ga0501038_0099231	Ga0501038_0099231_1737_2351	204
198	3300049574	Ga0501038_0179491	Ga0501038_0179491_877_1491	204
199	3300049575	Ga0501039_0095395	Ga0501039_0095395_62_676	204
200	3300049575	Ga0501039_0106556	Ga0501039_0106556_1220_1834	204
201	3300049576	Ga0501040_0041543	Ga0501040_0041543_2221_2835	204
202	3300049576	Ga0501040_0102397	Ga0501040_0102397_784_1398	204
203	3300049576	Ga0501040_0102825	Ga0501040_0102825_412_1026	204
204	3300049576	Ga0501040_0537542	Ga0501040_0537542_28_642	204
205	3300049577	Ga0501041_0043524	Ga0501041_0043524_1931_2545	204
206	3300049577	Ga0501041_0149195	Ga0501041_0149195_756_1370	204
207	3300049577	Ga0501041_0181376	Ga0501041_0181376_317_931	204
208	3300049577	Ga0501041_0580085	Ga0501041_0580085_17_631	204
209	3300049578	Ga0501042_0096863	Ga0501042_0096863_587_1201	204
210	3300049578	Ga0501042_0123251	Ga0501042_0123251_930_1544	204
211	3300049580	Ga0501046_0106535	Ga0501046_0106535_1303_1917	204
212	3300049580	Ga0501046_0123341	Ga0501046_0123341_23_637	204
213	3300049580	Ga0501046_0190109	Ga0501046_0190109_869_1483	204
214	3300049582	Ga0501048_0108423	Ga0501048_0108423_849_1463	204
215	3300049585	Ga0501069_0307184	Ga0501069_0307184_98_712	204
216	3300049586	Ga0501070_0124684	Ga0501070_0124684_153_767	204
217	3300049586	Ga0501070_0252081	Ga0501070_0252081_54_668	204
218	3300049587	Ga0501071_0033208	Ga0501071_0033208_2439_3053	204
219	3300049587	Ga0501071_0244461	Ga0501071_0244461_173_787	204
220	3300049588	Ga0501072_0311514	Ga0501072_0311514_242_856	204
221	3300049588	Ga0501072_0724150	Ga0501072_0724150_19_633	204
222	3300049590	Ga0501074_0079670	Ga0501074_0079670_728_1342	204
223	3300049591	Ga0501075_0040171	Ga0501075_0040171_896_1510	204
224	3300049591	Ga0501075_0127633	Ga0501075_0127633_343_957	204
225	3300049591	Ga0501075_0153598	Ga0501075_0153598_235_849	204
226	3300049592	Ga0501076_0157484	Ga0501076_0157484_580_1203	204
227	3300049593	Ga0501077_0027549	Ga0501077_0027549_47_661	204
228	3300049593	Ga0501077_0237001	Ga0501077_0237001_301_915	204
229	3300049593	Ga0501077_0244195	Ga0501077_0244195_350_964	204
230	3300049593	Ga0501077_0348170	Ga0501077_0348170_296_919	204
231	3300049741	Ga0501079_0037378	Ga0501079_0037378_1597_2211	204
232	3300049741	Ga0501079_0045761	Ga0501079_0045761_1778_2392	204
233	3300049741	Ga0501079_0123142	Ga0501079_0123142_199_822	204
234	3300049741	Ga0501079_0149887	Ga0501079_0149887_289_903	204
235	3300049741	Ga0501079_0151495	Ga0501079_0151495_744_1358	204
236	3300049741	Ga0501079_0504161	Ga0501079_0504161_128_742	204
237	3300049742	Ga0501080_0200204	Ga0501080_0200204_1054_1668	204
238	3300049742	Ga0501080_0333543	Ga0501080_0333543_34_648	204
239	3300049743	Ga0501081_0023574	Ga0501081_0023574_1792_2406	204
240	3300049743	Ga0501081_0077044	Ga0501081_0077044_850_1464	204
241	3300049743	Ga0501081_0134294	Ga0501081_0134294_220_834	204
242	3300049822	Ga0501035_0047115	Ga0501035_0047115_276_890	204
243	3300049824	Ga0501045_0014627	Ga0501045_0014627_4045_4659	204
244	3300049824	Ga0501045_0048533	Ga0501045_0048533_340_954	204
245	3300049824	Ga0501045_0053863	Ga0501045_0053863_123_737	204
246	3300049824	Ga0501045_0072539	Ga0501045_0072539_919_1533	204
247	3300049824	Ga0501045_0444739	Ga0501045_0444739_85_708	204
248	3300050492	nmdc:mga0yw44_286520_c1	nmdc:mga0yw44_286520_c1_217_831	204
249	3300050507	nmdc:mga05p37_254172_c1	nmdc:mga05p37_254172_c1_1252_1866	204
250	3300050507	nmdc:mga05p37_57891_c1	nmdc:mga05p37_57891_c1_2202_2816	204
251	3300050507	nmdc:mga05p37_58437_c1	nmdc:mga05p37_58437_c1_2123_2737	204
252	3300050507	nmdc:mga05p37_664640_c1	nmdc:mga05p37_664640_c1_294_908	204
253	3300050511	nmdc:mga08y16_31919_c1	nmdc:mga08y16_31919_c1_1193_1807	204
254	3300050512	nmdc:mga0n895_266322_c1	nmdc:mga0n895_266322_c1_101_715	204
255	3300050512	nmdc:mga0n895_327594_c1	nmdc:mga0n895_327594_c1_656_1270	204
256	3300050515	nmdc:mga0a205_259804_c1	nmdc:mga0a205_259804_c1_139_753	204
257	3300054114	Ga0501084_0542658	Ga0501084_0542658_98_712	204
258	3300060353	Ga0501082_0048832	Ga0501082_0048832_1438_2052	204
259	3300060353	Ga0501082_0105078	Ga0501082_0105078_896_1510	204
260	3300061734	Ga0530510_0028344	Ga0530510_0028344_2401_3015	204
261	3300061734	Ga0530510_0088713	Ga0530510_0088713_1182_1796	204
262	3300061734	Ga0530510_0111470	Ga0530510_0111470_1253_1867	204
263	3300061734	Ga0530510_0119813	Ga0530510_0119813_962_1576	204
264	3300009553	Ga0105249_10582615	Ga0105249_105826152	205
265	3300014326	Ga0157380_10161908	Ga0157380_101619082	205
266	3300025933	Ga0207706_10201380	Ga0207706_102013802	205
267	3300031995	Ga0307409_100103413	Ga0307409_1001034132	205
268	3300049573	Ga0501037_0025616	Ga0501037_0025616_2802_3422	205
269	3300049575	Ga0501039_0758786	Ga0501039_0758786_94_714	205
270	3300049576	Ga0501040_0033052	Ga0501040_0033052_2675_3295	205
271	3300049578	Ga0501042_0076152	Ga0501042_0076152_1108_1728	205
272	3300049580	Ga0501046_0091696	Ga0501046_0091696_1532_2152	205
273	3300049582	Ga0501048_0022619	Ga0501048_0022619_2019_2639	205
274	3300049584	Ga0501068_0056970	Ga0501068_0056970_239_859	205
275	3300049587	Ga0501071_0033273	Ga0501071_0033273_2105_2725	205
276	3300049588	Ga0501072_0594595	Ga0501072_0594595_186_806	205
277	3300049593	Ga0501077_0010514	Ga0501077_0010514_2520_3140	205
278	3300049824	Ga0501045_0040125	Ga0501045_0040125_2657_3277	205
279	3300050507	nmdc:mga05p37_236501_c1	nmdc:mga05p37_236501_c1_364_984	205
280	3300050511	nmdc:mga08y16_874113_c1	nmdc:mga08y16_874113_c1_197_817	205
281	3300005459	Ga0068867_100124769	Ga0068867_1001247692	206
282	3300005468	Ga0070707_100106472	Ga0070707_1001064724	206
283	3300005546	Ga0070696_100081140	Ga0070696_1000811401	206
284	3300005547	Ga0070693_100443821	Ga0070693_1004438212	206
285	3300006871	Ga0075434_100165889	Ga0075434_1001658892	206
286	3300009098	Ga0105245_10323952	Ga0105245_103239522	206
287	3300009098	Ga0105245_10433097	Ga0105245_104330972	206
288	3300009553	Ga0105249_11064085	Ga0105249_110640852	206
289	3300010375	Ga0105239_10024546	Ga0105239_100245468	206
290	3300025933	Ga0207706_10618577	Ga0207706_106185772	206
291	3300025981	Ga0207640_10805436	Ga0207640_108054361	206
292	3300026089	Ga0207648_10118228	Ga0207648_101182282	206
293	3300036401	Ga0373937_0652726	Ga0373937_0652726_53_673	206
294	3300046455	Ga0495603_0048174	Ga0495603_0048174_370_990	206
295	3300046674	Ga0495588_0120059	Ga0495588_0120059_348_968	206
296	3300048905	Ga0496102_0679770	Ga0496102_0679770_236_856	206
297	3300048910	Ga0496107_0066985	Ga0496107_0066985_481_1107	206
298	3300048911	Ga0496108_0933509	Ga0496108_0933509_53_682	206
299	3300050512	nmdc:mga0n895_170914_c1	nmdc:mga0n895_170914_c1_882_1502	206
300	3300050515	nmdc:mga0a205_597744_c1	nmdc:mga0a205_597744_c1_167_799	206
301	3300005343	Ga0070687_100018919	Ga0070687_1000189194	207
302	3300005459	Ga0068867_100791233	Ga0068867_1007912332	207
303	3300009553	Ga0105249_10525873	Ga0105249_105258732	207
304	3300025926	Ga0207659_10675744	Ga0207659_106757441	207
305	3300026075	Ga0207708_10049586	Ga0207708_100495863	207
306	3300026089	Ga0207648_10629845	Ga0207648_106298452	207
307	3300005546	Ga0070696_100078550	Ga0070696_1000785504	208
308	3300006847	Ga0075431_100190719	Ga0075431_1001907193	208
309	3300009147	Ga0114129_10047397	Ga0114129_100473975	208
310	3300014326	Ga0157380_10790064	Ga0157380_107900641	208
311	3300014497	Ga0182008_10020237	Ga0182008_100202375	208
312	3300025917	Ga0207660_10000003	Ga0207660_1000000335	208
313	3300028563	Ga0265319_1021236	Ga0265319_10212362	208
314	3300028577	Ga0265318_10071876	Ga0265318_100718762	208
315	3300028800	Ga0265338_10230799	Ga0265338_102307992	208
316	3300031249	Ga0265339_10043132	Ga0265339_100431322	208
317	3300031344	Ga0265316_10350151	Ga0265316_103501512	208
318	3300049742	Ga0501080_0447670	Ga0501080_0447670_101_727	208
319	3300050507	nmdc:mga05p37_4500_c1	nmdc:mga05p37_4500_c1_2550_3176	208
320	3300050510	nmdc:mga06r32_76371_c1	nmdc:mga06r32_76371_c1_1340_1966	208
321	3300005471	Ga0070698_100067344	Ga0070698_1000673444	209
322	3300005518	Ga0070699_100004678	Ga0070699_10000467810	209
323	3300005841	Ga0068863_100028855	Ga0068863_1000288556	209
324	3300014325	Ga0163163_10071624	Ga0163163_100716242	209
325	3300049587	Ga0501071_0428345	Ga0501071_0428345_367_996	209
326	3300049591	Ga0501075_0928287	Ga0501075_0928287_16_645	209
327	3300061734	Ga0530510_0453851	Ga0530510_0453851_165_794	209
328	3300005406	Ga0070703_10071393	Ga0070703_100713931	210
329	3300005440	Ga0070705_100304535	Ga0070705_1003045352	210
330	3300005445	Ga0070708_100124717	Ga0070708_1001247174	210
331	3300005467	Ga0070706_100017266	Ga0070706_1000172663	210
332	3300005467	Ga0070706_100572069	Ga0070706_1005720692	210
333	3300005468	Ga0070707_100439089	Ga0070707_1004390892	210
334	3300005536	Ga0070697_100016532	Ga0070697_1000165324	210
335	3300005536	Ga0070697_100052112	Ga0070697_1000521124	210
336	3300005546	Ga0070696_100034345	Ga0070696_1000343454	210
337	3300005549	Ga0070704_100044793	Ga0070704_1000447933	210
338	3300005578	Ga0068854_100219970	Ga0068854_1002199703	210
339	3300005618	Ga0068864_100063682	Ga0068864_1000636824	210
340	3300005842	Ga0068858_100565672	Ga0068858_1005656721	210
341	3300006173	Ga0070716_100491724	Ga0070716_1004917242	210
342	3300010159	Ga0099796_10056612	Ga0099796_100566122	210
343	3300014325	Ga0163163_10302627	Ga0163163_103026272	210
344	3300014968	Ga0157379_10023454	Ga0157379_100234547	210
345	3300025910	Ga0207684_10023218	Ga0207684_100232187	210
346	3300025910	Ga0207684_10121349	Ga0207684_101213493	210
347	3300025922	Ga0207646_10022068	Ga0207646_100220687	210
348	3300026095	Ga0207676_10274612	Ga0207676_102746122	210
349	3300045976	Ga0466967_1069952	Ga0466967_1069952_67_708	210
350	3300048905	Ga0496102_0056780	Ga0496102_0056780_1474_2124	210
351	3300048906	Ga0496103_0042159	Ga0496103_0042159_1902_2552	210
352	3300048909	Ga0496106_0330879	Ga0496106_0330879_338_988	210
353	3300028577	Ga0265318_10083044	Ga0265318_100830443	211
354	3300031240	Ga0265320_10007662	Ga0265320_100076626	211
355	3300031241	Ga0265325_10110709	Ga0265325_101107092	211
356	3300031242	Ga0265329_10013528	Ga0265329_100135283	211
357	3300031250	Ga0265331_10028559	Ga0265331_100285593	211
358	3300031711	Ga0265314_10047592	Ga0265314_100475923	211
359	3300032005	Ga0307411_10279648	Ga0307411_102796482	211
360	3300032126	Ga0307415_100987877	Ga0307415_1009878771	211
361	3300053078	Ga0495612_0000036	Ga0495612_0000036_21918_22580	211
362	3300005339	Ga0070660_100240715	Ga0070660_1002407153	212
363	3300005444	Ga0070694_100305217	Ga0070694_1003052172	212
364	3300005467	Ga0070706_100000360	Ga0070706_10000036047	212
365	3300005468	Ga0070707_100419922	Ga0070707_1004199222	212
366	3300005468	Ga0070707_100671542	Ga0070707_1006715422	212
367	3300005549	Ga0070704_100015228	Ga0070704_1000152286	212
368	3300005563	Ga0068855_100212362	Ga0068855_1002123622	212
369	3300005843	Ga0068860_100033945	Ga0068860_1000339457	212
370	3300006175	Ga0070712_100505848	Ga0070712_1005058481	212
371	3300009553	Ga0105249_10009004	Ga0105249_100090042	212
372	3300013306	Ga0163162_10571190	Ga0163162_105711902	212
373	3300020070	Ga0206356_11218727	Ga0206356_112187272	212
374	3300025910	Ga0207684_10000143	Ga0207684_1000014346	212
375	3300025916	Ga0207663_10324911	Ga0207663_103249111	212
376	3300025922	Ga0207646_10001168	Ga0207646_100011685	212
377	3300025949	Ga0207667_10042924	Ga0207667_100429243	212
378	3300028380	Ga0268265_10109546	Ga0268265_101095464	212
379	3300028577	Ga0265318_10005715	Ga0265318_100057155	212
380	3300031241	Ga0265325_10030533	Ga0265325_100305333	212
381	3300031249	Ga0265339_10157616	Ga0265339_101576161	212
382	3300031711	Ga0265314_10348320	Ga0265314_103483202	212
383	3300045051	Ga0451576_0459308	Ga0451576_0459308_370_1035	212
384	3300045051	Ga0451576_0761829	Ga0451576_0761829_49_690	212
385	3300046461	Ga0495641_0053919	Ga0495641_0053919_974_1624	212
386	3300046517	Ga0495630_0526909	Ga0495630_0526909_169_837	212
387	3300046683	Ga0495658_0217380	Ga0495658_0217380_160_810	212
388	3300048903	Ga0496100_0344127	Ga0496100_0344127_272_940	212
389	3300048907	Ga0496104_0054904	Ga0496104_0054904_1763_2431	212
390	3300048909	Ga0496106_0381637	Ga0496106_0381637_154_819	212
391	3300048911	Ga0496108_0317798	Ga0496108_0317798_548_1216	212
392	3300048912	Ga0496109_0063933	Ga0496109_0063933_2183_2851	212
393	3300053077	Ga0495601_0119392	Ga0495601_0119392_186_836	212
394	3300053077	Ga0495601_0143042	Ga0495601_0143042_325_993	212
395	3300053085	Ga0495619_0515157	Ga0495619_0515157_73_723	212
396	3300005329	Ga0070683_100171931	Ga0070683_1001719312	213
397	3300005334	Ga0068869_100382427	Ga0068869_1003824272	213
398	3300005338	Ga0068868_100536901	Ga0068868_1005369011	213
399	3300005440	Ga0070705_100156631	Ga0070705_1001566312	213
400	3300005445	Ga0070708_100384944	Ga0070708_1003849442	213
401	3300005445	Ga0070708_100623128	Ga0070708_1006231282	213
402	3300005456	Ga0070678_100548934	Ga0070678_1005489342	213
403	3300005468	Ga0070707_100002910	Ga0070707_1000029107	213
404	3300005518	Ga0070699_100000514	Ga0070699_10000051417	213
405	3300005535	Ga0070684_100103335	Ga0070684_1001033353	213
406	3300005545	Ga0070695_100001526	Ga0070695_1000015263	213
407	3300005546	Ga0070696_100009517	Ga0070696_1000095175	213
408	3300005546	Ga0070696_100047079	Ga0070696_1000470794	213
409	3300005549	Ga0070704_100021900	Ga0070704_1000219002	213
410	3300005564	Ga0070664_100671437	Ga0070664_1006714372	213
411	3300005615	Ga0070702_100660647	Ga0070702_1006606471	213
412	3300005841	Ga0068863_100160159	Ga0068863_1001601592	213
413	3300009101	Ga0105247_10369470	Ga0105247_103694702	213
414	3300009176	Ga0105242_10192933	Ga0105242_101929332	213
415	3300009177	Ga0105248_10262189	Ga0105248_102621893	213
416	3300009177	Ga0105248_10576985	Ga0105248_105769852	213
417	3300010375	Ga0105239_10700739	Ga0105239_107007392	213
418	3300013306	Ga0163162_10226629	Ga0163162_102266292	213
419	3300013308	Ga0157375_10076032	Ga0157375_100760323	213
420	3300014325	Ga0163163_10442651	Ga0163163_104426512	213
421	3300014968	Ga0157379_10286051	Ga0157379_102860512	213
422	3300025885	Ga0207653_10034618	Ga0207653_100346182	213
423	3300025912	Ga0207707_10205398	Ga0207707_102053983	213
424	3300025921	Ga0207652_10229573	Ga0207652_102295732	213
425	3300025922	Ga0207646_10001479	Ga0207646_100014799	213
426	3300025926	Ga0207659_10110943	Ga0207659_101109433	213
427	3300025935	Ga0207709_10459461	Ga0207709_104594612	213
428	3300025941	Ga0207711_10148765	Ga0207711_101487652	213
429	3300026088	Ga0207641_10500742	Ga0207641_105007421	213
430	3300026095	Ga0207676_10693839	Ga0207676_106938392	213
431	3300026142	Ga0207698_10429830	Ga0207698_104298301	213
432	3300028381	Ga0268264_10538239	Ga0268264_105382392	213
433	3300028573	Ga0265334_10020341	Ga0265334_100203412	213
434	3300028666	Ga0265336_10009746	Ga0265336_100097462	213
435	3300031238	Ga0265332_10057222	Ga0265332_100572221	213
436	3300031247	Ga0265340_10015432	Ga0265340_100154325	213
437	3300031249	Ga0265339_10040427	Ga0265339_100404272	213
438	3300031250	Ga0265331_10093068	Ga0265331_100930682	213
439	3300031711	Ga0265314_10136054	Ga0265314_101360542	213
440	3300042876	Ga0451577_0102513	Ga0451577_0102513_768_1430	213
441	3300044712	Ga0453684_0423386	Ga0453684_0423386_274_936	213
442	3300046517	Ga0495630_0300444	Ga0495630_0300444_356_1018	213
443	3300048903	Ga0496100_0403423	Ga0496100_0403423_149_790	213
444	3300048904	Ga0496101_0323540	Ga0496101_0323540_273_914	213
445	3300048904	Ga0496101_0782258	Ga0496101_0782258_22_711	213
446	3300048905	Ga0496102_0077512	Ga0496102_0077512_758_1426	213
447	3300048908	Ga0496105_0015209	Ga0496105_0015209_2925_3566	213
448	3300048910	Ga0496107_0263807	Ga0496107_0263807_310_951	213
449	3300048912	Ga0496109_0011799	Ga0496109_0011799_5274_5915	213
450	3300048912	Ga0496109_0169463	Ga0496109_0169463_808_1449	213
451	3300048912	Ga0496109_0552562	Ga0496109_0552562_228_875	213
452	3300048913	Ga0496110_0009543	Ga0496110_0009543_3977_4618	213
453	3300048915	Ga0496112_0016398	Ga0496112_0016398_2302_2943	213
454	3300048915	Ga0496112_0401335	Ga0496112_0401335_387_1028	213
455	3300048916	Ga0496113_0018109	Ga0496113_0018109_1252_1893	213
456	3300048917	Ga0496114_0328988	Ga0496114_0328988_237_887	213
457	3300054114	Ga0501084_0104172	Ga0501084_0104172_543_1202	213
458	3300060353	Ga0501082_0401128	Ga0501082_0401128_14_673	213

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14803

Nudix_N_2

Nudix N-terminal

55

88

0.98 PF00293

NUDIX

NUDIX domain

89

212

0.76 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5zrl-assembly2.cif.gz_B	m. smegmatis antimutator protein mutt2 in complex with cdp	0.8894	76	199
5zrc-assembly1.cif.gz_A	structural insights into the catalysis mechanism of m. smegmatis antimutator protein mutt2	0.8866	76	199
5xd4-assembly1.cif.gz_A	crystal structure of mycobacterium smegmatis mutt1 in complex with atp (ii)	0.8618	76	199
5zrc-assembly1.cif.gz_A	structural insights into the catalysis mechanism of m. smegmatis antimutator protein mutt2	0.8539	76	199
6m72-assembly1.cif.gz_A	crystal structure of mycobacterium smegmatis mutt1 in complex with 8-oxo-dgdp	0.8488	76	199

ID	Description	Score	Start	End	Superfamily
3cngB02	Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase	0.9038	73	201	3.90.79.10
5zrcA00	Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase	0.8866	76	199	3.90.79.10
af_E7FAS2_11_192_3.90.79.10	Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase	0.8792	76	177	3.90.79.10
af_Q92350_85_273_3.90.79.10	Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase	0.8705	76	174	3.90.79.10
af_Q58549_37_166_3.90.79.10	Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase	0.8647	70	198	3.90.79.10

ID	Description	Score	Start	End	GO Terms
AF-A0A0B2SLY1-F1-model_v4	Nudix hydrolase 23, chloroplastic	0.9434	77	203	GO:0016787 GO:0046872
AF-A0A7C2BDP8-F1-model_v4	NUDIX hydrolase	0.9355	76	196	GO:0016787
AF-K6VTC1-F1-model_v4	Putative hydrolase	0.9313	76	199	GO:0016787
AF-A0A7J9XVJ8-F1-model_v4	NUDIX domain-containing protein	0.9229	76	195	GO:0016787
AF-D5VF10-F1-model_v4	NUDIX hydrolase	0.922	76	201	GO:0016787

Feature Viewer

pLDDT	pTM	Quality
85.03	0.78	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F448259

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF14803

Nudix_N_2

Nudix N-terminal

55

88

0.98

PF00293

NUDIX

NUDIX domain

89

212

0.76

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map