F448200

General Info

Members Datasets Scaffolds Average Seq Length
458 247 916 124

Family's Representative Sequence

Representative Sequence 3300025893|Ga0207682_10049395|Ga0207682_100493952
Length 143
Sequence VIGGRSRTADRFMMRTMSAAPDRNVLGGMLAPCSMSPRTGFFRDGCCNTGPDDVGLHVVCCRVTSPFLRFAKAQGNDLVTPAPEYKFAGLKPGDQWCVCAATWRQAYEAGVAPPVVLAATHEETLAVVPLSALKELAVDLPGR

Samples

Sample ID Description Type Environment
1 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
168 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
169 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
184 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
185 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
197 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
198 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
199 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
200 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
201 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
202 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
208 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
211 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 2643221652 Acidovorax sp. Root402 Isolate Unclassified
246 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
247 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.28
Rhizosphere 95.63
Stem 0
Stem Tuber 0
Unclassified 4.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207682_10049395 3300025893 Bacteria 1737
2 JGI24752J21851_1005866 3300001976 Bacteria 1605
3 JGI24742J22300_10072951 3300002244 Bacteria 642
4 Ga0065712_10085850 3300005290 Unclassified 2670
5 Ga0065715_10368494 3300005293 Bacteria 924
6 Ga0070658_10443006 3300005327 Bacteria 1119
7 Ga0070676_10002776 3300005328 Bacteria 9049
8 Ga0070676_11122835 3300005328 Bacteria 595
9 Ga0070690_100045926 3300005330 Bacteria 2776
10 Ga0070690_100164416 3300005330 Bacteria 1523
11 Ga0070670_100036600 3300005331 Bacteria 4224
12 Ga0070670_100525789 3300005331 Bacteria 1054
13 Ga0070670_100539444 3300005331 Bacteria 1040
14 Ga0070677_10013682 3300005333 Bacteria 2842
15 Ga0070677_10014573 3300005333 Bacteria 2770
16 Ga0068869_100002836 3300005334 Bacteria 10504
17 Ga0068869_100025479 3300005334 Bacteria 4107
18 Ga0070666_10014440 3300005335 Bacteria 5029
19 Ga0070666_10187253 3300005335 Bacteria 1453
20 Ga0068868_100000976 3300005338 Bacteria 19492
21 Ga0068868_101793859 3300005338 Bacteria 579
22 Ga0070660_100001365 3300005339 Bacteria 16588
23 Ga0070660_100091441 3300005339 Bacteria 2400
24 Ga0070660_100567880 3300005339 Unclassified 947
25 Ga0070687_100198052 3300005343 Bacteria 1215
26 Ga0070661_100000629 3300005344 Bacteria 26232
27 Ga0070661_100010659 3300005344 Bacteria 6394
28 Ga0070661_100158968 3300005344 Bacteria 1711
29 Ga0070692_10226164 3300005345 Bacteria 1108
30 Ga0070668_100003626 3300005347 Bacteria 11382
31 Ga0070668_100045290 3300005347 Unclassified 3376
32 Ga0070668_100179162 3300005347 Bacteria 1730
33 Ga0070668_100304194 3300005347 Bacteria 1338
34 Ga0070669_100038532 3300005353 Bacteria 3470
35 Ga0070669_100626541 3300005353 Bacteria 903
36 Ga0070675_100127734 3300005354 Bacteria 2164
37 Ga0070675_100258352 3300005354 Bacteria 1526
38 Ga0070675_100440863 3300005354 Bacteria 1167
39 Ga0070671_100009890 3300005355 Bacteria 7658
40 Ga0070671_100353202 3300005355 Bacteria 1255
41 Ga0070674_100007363 3300005356 Bacteria 6489
42 Ga0070673_100013880 3300005364 Bacteria 5592
43 Ga0070673_100741613 3300005364 Bacteria 904
44 Ga0070688_100239824 3300005365 Bacteria 1286
45 Ga0070659_100192267 3300005366 Bacteria 1678
46 Ga0070667_100003078 3300005367 Bacteria 14332
47 Ga0070667_100013445 3300005367 Bacteria 6767
48 Ga0070667_100434957 3300005367 Bacteria 1197
49 Ga0070667_100603311 3300005367 Bacteria 1012
50 Ga0070714_100014317 3300005435 Bacteria 6370
51 Ga0070713_100043394 3300005436 Bacteria 3676
52 Ga0070713_100336341 3300005436 Bacteria 1398
53 Ga0070713_101479899 3300005436 Bacteria 659
54 Ga0070701_10073675 3300005438 Bacteria 1832
55 Ga0070705_100229706 3300005440 Bacteria 1290
56 Ga0070705_101259010 3300005440 Bacteria 612
57 Ga0070700_100079764 3300005441 Bacteria 2110
58 Ga0070708_100111556 3300005445 Bacteria 2514
59 Ga0070663_100073668 3300005455 Bacteria 2491
60 Ga0070663_100143213 3300005455 Bacteria 1827
61 Ga0070663_100199398 3300005455 Bacteria 1561
62 Ga0070678_100047715 3300005456 Bacteria 3079
63 Ga0070678_100153754 3300005456 Unclassified 1856
64 Ga0070662_100078174 3300005457 Bacteria 2457
65 Ga0070681_10015563 3300005458 Bacteria 7575
66 Ga0070681_10036612 3300005458 Bacteria 4927
67 Ga0068867_100000817 3300005459 Bacteria 21028
68 Ga0068867_100122745 3300005459 Bacteria 2009
69 Ga0068867_101223583 3300005459 Bacteria 691
70 Ga0070685_10200235 3300005466 Bacteria 1297
71 Ga0070706_100294118 3300005467 Bacteria 1515
72 Ga0070706_100369321 3300005467 Bacteria 1336
73 Ga0070707_101039321 3300005468 Bacteria 785
74 Ga0070698_100448029 3300005471 Bacteria 1226
75 Ga0070698_101248940 3300005471 Bacteria 692
76 Ga0070699_100629654 3300005518 Bacteria 979
77 Ga0070679_100097322 3300005530 Bacteria 2930
78 Ga0070684_100004019 3300005535 Bacteria 11129
79 Ga0070697_100884705 3300005536 Unclassified 792
80 Ga0068853_100111608 3300005539 Bacteria 2429
81 Ga0068853_100427195 3300005539 Bacteria 1243
82 Ga0068853_100489013 3300005539 Bacteria 1161
83 Ga0068853_101797411 3300005539 Bacteria 594
84 Ga0070672_100050891 3300005543 Bacteria 3228
85 Ga0070672_101121190 3300005543 Bacteria 699
86 Ga0070686_100093997 3300005544 Bacteria 2011
87 Ga0070686_101020054 3300005544 Bacteria 679
88 Ga0070696_100372723 3300005546 Bacteria 1111
89 Ga0070665_100011271 3300005548 Bacteria 9041
90 Ga0070665_100962748 3300005548 Unclassified 866
91 Ga0068855_100364604 3300005563 Bacteria 1589
92 Ga0068855_100716994 3300005563 Bacteria 1069
93 Ga0070664_100002907 3300005564 Bacteria 13860
94 Ga0070664_100060119 3300005564 Bacteria 3235
95 Ga0068857_100006558 3300005577 Bacteria 9990
96 Ga0068857_100036847 3300005577 Bacteria 4333
97 Ga0068854_100003221 3300005578 Bacteria 10185
98 Ga0068854_100116825 3300005578 Unclassified 2019
99 Ga0068856_100364623 3300005614 Bacteria 1463
100 Ga0070702_100054823 3300005615 Bacteria 2296
101 Ga0070702_100084133 3300005615 Bacteria 1913
102 Ga0068852_100254284 3300005616 Bacteria 1684
103 Ga0068852_100413089 3300005616 Bacteria 1330
104 Ga0068852_100424695 3300005616 Bacteria 1312
105 Ga0068852_100457395 3300005616 Bacteria 1265
106 Ga0068852_100480455 3300005616 Bacteria 1235
107 Ga0068852_100901863 3300005616 Bacteria 901
108 Ga0068859_100006776 3300005617 Bacteria 11637
109 Ga0068859_100026695 3300005617 Bacteria 5792
110 Ga0068859_100085595 3300005617 Bacteria 3198
111 Ga0068859_100463502 3300005617 Unclassified 1363
112 Ga0068864_100009746 3300005618 Bacteria 7923
113 Ga0068864_100013188 3300005618 Bacteria 6842
114 Ga0068864_100478912 3300005618 Bacteria 1194
115 Ga0068866_10069661 3300005718 Bacteria 1854
116 Ga0068861_100141436 3300005719 Bacteria 1964
117 Ga0068861_100306289 3300005719 Bacteria 1378
118 Ga0068861_102272407 3300005719 Bacteria 544
119 Ga0068851_10045912 3300005834 Bacteria 2209
120 Ga0068851_10908481 3300005834 Bacteria 552
121 Ga0068870_10042358 3300005840 Bacteria 2370
122 Ga0068863_100035842 3300005841 Bacteria 4724
123 Ga0068863_100415334 3300005841 Bacteria 1317
124 Ga0068863_100501763 3300005841 Bacteria 1195
125 Ga0068858_100024360 3300005842 Bacteria 5639
126 Ga0068858_100048711 3300005842 Bacteria 3925
127 Ga0068860_100011157 3300005843 Bacteria 8855
128 Ga0068860_100068132 3300005843 Bacteria 3381
129 Ga0068860_100127028 3300005843 Bacteria 2444
130 Ga0068862_100099407 3300005844 Bacteria 2543
131 Ga0081455_10284986 3300005937 Bacteria 1192
132 Ga0081539_10003009 3300005985 Bacteria 21962
133 Ga0097621_100010893 3300006237 Bacteria 6674
134 Ga0068871_100006339 3300006358 Bacteria 8361
135 Ga0068871_100137518 3300006358 Bacteria 2075
136 Ga0068871_100440063 3300006358 Bacteria 1167
137 Ga0075428_100024812 3300006844 Bacteria 6632
138 Ga0075428_101611240 3300006844 Bacteria 679
139 Ga0075433_10089181 3300006852 Bacteria 2726
140 Ga0075434_100131106 3300006871 Bacteria 2525
141 Ga0075434_100317618 3300006871 Bacteria 1578
142 Ga0075434_100365275 3300006871 Bacteria 1464
143 Ga0075434_100365833 3300006871 Bacteria 1463
144 Ga0075434_102064773 3300006871 Bacteria 575
145 Ga0068865_100019747 3300006881 Bacteria 4363
146 Ga0068865_100291045 3300006881 Bacteria 1304
147 Ga0068865_101174351 3300006881 Bacteria 678
148 Ga0075436_100207663 3300006914 Bacteria 1388
149 Ga0097620_100006776 3300006931 Bacteria 11637
150 Ga0097620_100026695 3300006931 Bacteria 5792
151 Ga0097620_100085597 3300006931 Bacteria 3198
152 Ga0097620_100463554 3300006931 Unclassified 1363
153 Ga0075435_100077441 3300007076 Bacteria 2726
154 Ga0105244_10204634 3300009036 Bacteria 930
155 Ga0105240_10002432 3300009093 Bacteria 29938
156 Ga0111539_10165293 3300009094 Bacteria 2587
157 Ga0105245_12055933 3300009098 Bacteria 625
158 Ga0105247_10204043 3300009101 Bacteria 1330
159 Ga0105247_10242500 3300009101 Bacteria 1229
160 Ga0114129_10232311 3300009147 Bacteria 2484
161 Ga0114129_10380102 3300009147 Bacteria 1865
162 Ga0105243_10280133 3300009148 Bacteria 1501
163 Ga0105243_10593942 3300009148 Bacteria 1065
164 Ga0105242_10025306 3300009176 Bacteria 4696
165 Ga0105242_10353876 3300009176 Bacteria 1357
166 Ga0105248_10033910 3300009177 Bacteria 5705
167 Ga0105248_10346259 3300009177 Bacteria 1673
168 Ga0105248_10660737 3300009177 Bacteria 1179
169 Ga0105248_11411904 3300009177 Bacteria 788
170 Ga0105237_11541913 3300009545 Bacteria 671
171 Ga0105238_10000865 3300009551 Bacteria 31282
172 Ga0105238_10379434 3300009551 Bacteria 1405
173 Ga0105249_10103060 3300009553 Bacteria 2687
174 Ga0105249_10251422 3300009553 Bacteria 1752
175 Ga0105239_10356081 3300010375 Bacteria 1652
176 Ga0157371_10260548 3300013102 Bacteria 1250
177 Ga0157370_10013669 3300013104 Bacteria 8347
178 Ga0157370_10078308 3300013104 Bacteria 3113
179 Ga0157370_10257607 3300013104 Bacteria 1613
180 Ga0157369_10023215 3300013105 Bacteria 6910
181 Ga0157374_10006640 3300013296 Bacteria 9826
182 Ga0157374_10105333 3300013296 Bacteria 2709
183 Ga0157378_10527876 3300013297 Bacteria 1183
184 Ga0157378_11590752 3300013297 Bacteria 699
185 Ga0163162_10017011 3300013306 Bacteria 7115
186 Ga0163162_10409944 3300013306 Bacteria 1488
187 Ga0163162_11745161 3300013306 Bacteria 711
188 Ga0157372_10007305 3300013307 Bacteria 11762
189 Ga0157372_10339231 3300013307 Bacteria 1750
190 Ga0157372_10841931 3300013307 Bacteria 1065
191 Ga0157375_10052291 3300013308 Bacteria 4015
192 Ga0157375_12227971 3300013308 Bacteria 653
193 Ga0157375_12328469 3300013308 Bacteria 639
194 Ga0157375_12352249 3300013308 Bacteria 636
195 Ga0163163_10115547 3300014325 Bacteria 2715
196 Ga0157380_10016864 3300014326 Bacteria 5393
197 Ga0157380_10071789 3300014326 Bacteria 2801
198 Ga0157380_10200729 3300014326 Bacteria 1769
199 Ga0157380_11226449 3300014326 Bacteria 795
200 Ga0157377_10000479 3300014745 Bacteria 17223
201 Ga0157379_10002422 3300014968 Bacteria 15607
202 Ga0157379_10017242 3300014968 Bacteria 6361
203 Ga0157379_10047131 3300014968 Bacteria 3845
204 Ga0157379_10344052 3300014968 Bacteria 1364
205 Ga0157379_10849679 3300014968 Bacteria 864
206 Ga0157376_10006479 3300014969 Bacteria 8272
207 Ga0157376_10850559 3300014969 Bacteria 928
208 Ga0157376_11758899 3300014969 Bacteria 656
209 Ga0163161_10045651 3300017792 Bacteria 3160
210 Ga0163161_10062454 3300017792 Bacteria 2714
211 Ga0163161_10094508 3300017792 Bacteria 2216
212 Ga0207666_1006981 3300025271 Bacteria 1476
213 Ga0207673_1005392 3300025290 Bacteria 1559
214 Ga0207697_10000793 3300025315 Bacteria 17916
215 Ga0207682_10000479 3300025893 Bacteria 18513
216 Ga0207682_10020525 3300025893 Bacteria 2594
217 Ga0207642_10245237 3300025899 Bacteria 1014
218 Ga0207642_10260246 3300025899 Bacteria 989
219 Ga0207710_10160481 3300025900 Bacteria 1095
220 Ga0207688_10004005 3300025901 Bacteria 8024
221 Ga0207680_10057518 3300025903 Bacteria 2353
222 Ga0207647_10656083 3300025904 Bacteria 575
223 Ga0207645_10000039 3300025907 Bacteria 88205
224 Ga0207645_10041463 3300025907 Bacteria 2946
225 Ga0207643_10000327 3300025908 Bacteria 32670
226 Ga0207705_10530033 3300025909 Bacteria 915
227 Ga0207705_10690842 3300025909 Bacteria 793
228 Ga0207684_10358823 3300025910 Bacteria 1254
229 Ga0207707_10318739 3300025912 Bacteria 1342
230 Ga0207707_10982871 3300025912 Bacteria 693
231 Ga0207660_10885689 3300025917 Bacteria 728
232 Ga0207662_10151304 3300025918 Bacteria 1476
233 Ga0207657_10003553 3300025919 Bacteria 16648
234 Ga0207657_10102347 3300025919 Bacteria 2376
235 Ga0207649_10280078 3300025920 Bacteria 1212
236 Ga0207649_10650791 3300025920 Bacteria 814
237 Ga0207649_11287629 3300025920 Unclassified 578
238 Ga0207652_10258066 3300025921 Bacteria 1572
239 Ga0207652_11320889 3300025921 Bacteria 624
240 Ga0207646_10097208 3300025922 Bacteria 2638
241 Ga0207646_10401318 3300025922 Bacteria 1238
242 Ga0207646_11916657 3300025922 Bacteria 505
243 Ga0207681_10451824 3300025923 Bacteria 1045
244 Ga0207681_10510162 3300025923 Bacteria 986
245 Ga0207681_10852000 3300025923 Bacteria 762
246 Ga0207681_10891880 3300025923 Bacteria 744
247 Ga0207694_10005113 3300025924 Bacteria 10126
248 Ga0207650_10006374 3300025925 Bacteria 8036
249 Ga0207650_10069157 3300025925 Bacteria 2653
250 Ga0207650_10286972 3300025925 Bacteria 1341
251 Ga0207659_10312489 3300025926 Bacteria 1294
252 Ga0207659_10582600 3300025926 Bacteria 953
253 Ga0207700_10989298 3300025928 Bacteria 753
254 Ga0207700_11521673 3300025928 Bacteria 593
255 Ga0207664_10400234 3300025929 Bacteria 1221
256 Ga0207644_10088017 3300025931 Bacteria 2309
257 Ga0207644_10476240 3300025931 Bacteria 1028
258 Ga0207690_10030561 3300025932 Bacteria 3437
259 Ga0207706_10001560 3300025933 Bacteria 22717
260 Ga0207706_10074149 3300025933 Bacteria 2993
261 Ga0207686_10322661 3300025934 Bacteria 1154
262 Ga0207686_10378915 3300025934 Bacteria 1072
263 Ga0207670_10550845 3300025936 Bacteria 942
264 Ga0207669_10026475 3300025937 Bacteria 3155
265 Ga0207669_10196473 3300025937 Bacteria 1460
266 Ga0207704_10032692 3300025938 Bacteria 2948
267 Ga0207704_10109841 3300025938 Bacteria 1861
268 Ga0207665_11397927 3300025939 Bacteria 557
269 Ga0207691_10000027 3300025940 Bacteria 126502
270 Ga0207691_11034783 3300025940 Bacteria 684
271 Ga0207691_11144047 3300025940 Bacteria 646
272 Ga0207711_10058151 3300025941 Bacteria 3326
273 Ga0207711_10073937 3300025941 Bacteria 2963
274 Ga0207711_10585927 3300025941 Bacteria 1040
275 Ga0207711_10644766 3300025941 Bacteria 988
276 Ga0207689_10000387 3300025942 Bacteria 41370
277 Ga0207689_10013069 3300025942 Bacteria 7090
278 Ga0207661_10011403 3300025944 Bacteria 6439
279 Ga0207661_11066004 3300025944 Bacteria 744
280 Ga0207679_10006768 3300025945 Bacteria 7262
281 Ga0207679_10150869 3300025945 Bacteria 1891
282 Ga0207679_10728149 3300025945 Bacteria 901
283 Ga0207667_10492758 3300025949 Bacteria 1243
284 Ga0207667_10525392 3300025949 Unclassified 1199
285 Ga0207667_10530547 3300025949 Bacteria 1192
286 Ga0207651_10066793 3300025960 Bacteria 2528
287 Ga0207651_10078967 3300025960 Unclassified 2362
288 Ga0207651_10425207 3300025960 Bacteria 1135
289 Ga0207712_10127244 3300025961 Bacteria 1936
290 Ga0207712_10143668 3300025961 Bacteria 1834
291 Ga0207668_10011931 3300025972 Bacteria 5301
292 Ga0207668_10034748 3300025972 Bacteria 3350
293 Ga0207668_10082702 3300025972 Bacteria 2334
294 Ga0207668_10087307 3300025972 Bacteria 2281
295 Ga0207668_10326277 3300025972 Unclassified 1275
296 Ga0207640_11954333 3300025981 Bacteria 531
297 Ga0207658_10004431 3300025986 Bacteria 9766
298 Ga0207658_10008875 3300025986 Bacteria 6823
299 Ga0207658_10205223 3300025986 Bacteria 1648
300 Ga0207658_10558261 3300025986 Bacteria 1025
301 Ga0207677_10395126 3300026023 Bacteria 1171
302 Ga0207677_10662792 3300026023 Bacteria 922
303 Ga0207703_10007413 3300026035 Bacteria 8715
304 Ga0207639_11032867 3300026041 Bacteria 770
305 Ga0207639_11193374 3300026041 Bacteria 714
306 Ga0207678_10111213 3300026067 Bacteria 2337
307 Ga0207678_10264512 3300026067 Bacteria 1474
308 Ga0207678_10368022 3300026067 Bacteria 1241
309 Ga0207708_10003210 3300026075 Bacteria 12048
310 Ga0207708_10799859 3300026075 Bacteria 812
311 Ga0207702_10611189 3300026078 Bacteria 1070
312 Ga0207641_10057250 3300026088 Bacteria 3314
313 Ga0207641_10332337 3300026088 Bacteria 1444
314 Ga0207641_10513348 3300026088 Bacteria 1165
315 Ga0207641_11240714 3300026088 Bacteria 745
316 Ga0207648_10002944 3300026089 Bacteria 18026
317 Ga0207648_10011528 3300026089 Bacteria 8323
318 Ga0207648_10300639 3300026089 Bacteria 1439
319 Ga0207676_10006023 3300026095 Bacteria 8550
320 Ga0207676_10266414 3300026095 Bacteria 1549
321 Ga0207676_10585386 3300026095 Bacteria 1070
322 Ga0207674_10000465 3300026116 Bacteria 53128
323 Ga0207674_10001083 3300026116 Bacteria 35406
324 Ga0207674_10082946 3300026116 Plasmid 3205
325 Ga0207675_100000626 3300026118 Bacteria 34619
326 Ga0207675_100115878 3300026118 Bacteria 2532
327 Ga0207675_100348243 3300026118 Bacteria 1451
328 Ga0207675_101953039 3300026118 Bacteria 605
329 Ga0207683_10000061 3300026121 Bacteria 81399
330 Ga0207683_10005814 3300026121 Bacteria 10577
331 Ga0207683_10381513 3300026121 Bacteria 1295
332 Ga0207698_10215933 3300026142 Bacteria 1729
333 Ga0207698_10298710 3300026142 Bacteria 1498
334 Ga0207698_10704546 3300026142 Bacteria 1005
335 Ga0207698_11027316 3300026142 Bacteria 836
336 Ga0207698_11030648 3300026142 Bacteria 834
337 Ga0207698_11253491 3300026142 Bacteria 756
338 Ga0209983_1060269 3300027665 Bacteria 838
339 Ga0268266_10302847 3300028379 Unclassified 1492
340 Ga0268266_12093882 3300028379 Bacteria 539
341 Ga0268265_10029089 3300028380 Bacteria 3963
342 Ga0268265_10155289 3300028380 Bacteria 1935
343 Ga0268265_10625378 3300028380 Bacteria 1032
344 Ga0268264_10016514 3300028381 Bacteria 6044
345 Ga0268264_10174831 3300028381 Unclassified 1945
346 Ga0268264_10587319 3300028381 Bacteria 1096
347 Ga0316575_10036487 3300031665 Bacteria 1934
348 Ga0316579_10085039 3300031691 Bacteria 1509
349 Ga0316578_10159145 3300031728 Bacteria 1361
350 Ga0307405_10163515 3300031731 Bacteria 1579
351 Ga0307405_10244892 3300031731 Bacteria 1330
352 Ga0316577_10393023 3300031733 Bacteria 788
353 Ga0307413_10047553 3300031824 Bacteria 2559
354 Ga0307413_11349945 3300031824 Bacteria 625
355 Ga0307410_10009688 3300031852 Bacteria 5418
356 Ga0307410_10030010 3300031852 Bacteria 3470
357 Ga0307410_10133593 3300031852 Unclassified 1826
358 Ga0307410_10137324 3300031852 Bacteria 1804
359 Ga0307406_10031169 3300031901 Bacteria 3244
360 Ga0307406_10139323 3300031901 Bacteria 1715
361 Ga0307407_10008985 3300031903 Bacteria 4626
362 Ga0307407_10063731 3300031903 Unclassified 2164
363 Ga0307412_10029479 3300031911 Bacteria 3444
364 Ga0307412_10046478 3300031911 Bacteria 2845
365 Ga0307409_100065291 3300031995 Bacteria 2863
366 Ga0307409_100066958 3300031995 Bacteria 2834
367 Ga0307409_100089641 3300031995 Unclassified 2515
368 Ga0307409_100876329 3300031995 Bacteria 910
369 Ga0307416_100025017 3300032002 Bacteria 4369
370 Ga0307416_100103147 3300032002 Bacteria 2489
371 Ga0307416_100912697 3300032002 Bacteria 979
372 Ga0307414_10301158 3300032004 Bacteria 1356
373 Ga0307414_10763267 3300032004 Bacteria 880
374 Ga0307411_10031380 3300032005 Bacteria 3269
375 Ga0307411_10093867 3300032005 Bacteria 2102
376 Ga0307415_100017470 3300032126 Bacteria 4303
377 Ga0307415_100107519 3300032126 Bacteria 2061
378 Ga0373936_0084703 3300035113 Bacteria 1323
379 Ga0373939_0142656 3300035114 Bacteria 865
380 Ga0373956_0125572 3300035119 Bacteria 1200
381 Ga0373957_0322230 3300035120 Bacteria 657
382 Ga0373943_0027760 3300035170 Bacteria 2662
383 Ga0373946_0007846 3300035171 Bacteria 3917
384 Ga0373946_0481626 3300035171 Bacteria 635
385 Ga0373955_0050804 3300035172 Bacteria 2256
386 Ga0373931_0330213 3300035691 Bacteria 950
387 Ga0373931_0830126 3300035691 Bacteria 618
388 Ga0373935_1338782 3300035692 Bacteria 535
389 Ga0373927_0011789 3300035695 Bacteria 5822
390 Ga0373947_0032066 3300035725 Bacteria 3095
391 Ga0373937_0154190 3300036401 Unclassified 2153
392 Ga0373937_1367743 3300036401 Bacteria 656
393 Ga0316582_0076555 3300036647 Bacteria 2176
394 Ga0373925_0178404 3300037068 Bacteria 1680
395 Ga0451802_1938011 3300041460 Unclassified 506
396 Ga0451839_0997633 3300041496 Bacteria 785
397 Ga0451845_0575832 3300041501 Bacteria 585
398 Ga0451853_1537311 3300041512 Bacteria 995
399 Ga0439441_003698 3300042001 Bacteria 2274
400 Ga0439441_054211 3300042001 Bacteria 832
401 Ga0450891_022835 3300042129 Bacteria 622
402 Ga0439435_0095756 3300042436 Bacteria 907
403 Ga0451576_2021056 3300045051 Bacteria 594
404 Ga0495603_0442935 3300046455 Bacteria 744
405 Ga0495629_0421789 3300046459 Bacteria 905
406 Ga0495608_0040709 3300046511 Bacteria 3112
407 Ga0495608_0571900 3300046511 Bacteria 680
408 Ga0495642_0355659 3300046528 Bacteria 644
409 Ga0495652_0663019 3300046529 Bacteria 705
410 Ga0495586_0170274 3300046535 Bacteria 1231
411 Ga0495598_0102166 3300046537 Bacteria 950
412 Ga0495621_0050821 3300046539 Bacteria 1482
413 Ga0495621_0225249 3300046539 Bacteria 760
414 Ga0495667_0068519 3300046559 Bacteria 2317
415 Ga0496100_0098221 3300048903 Bacteria 2012
416 Ga0496101_0114743 3300048904 Bacteria 2031
417 Ga0496103_0252152 3300048906 Bacteria 1136
418 Ga0496104_0135680 3300048907 Bacteria 2364
419 Ga0496106_0079635 3300048909 Bacteria 2515
420 Ga0496107_0085936 3300048910 Bacteria 2295
421 Ga0496108_0370958 3300048911 Bacteria 1249
422 Ga0496109_0144568 3300048912 Bacteria 2224
423 Ga0496109_0163144 3300048912 Bacteria 2088
424 Ga0496110_0010776 3300048913 Bacteria 7451
425 Ga0496110_0125899 3300048913 Bacteria 2312
426 Ga0496111_0036070 3300048914 Bacteria 3536
427 Ga0496111_0176716 3300048914 Bacteria 1587
428 Ga0496114_0081720 3300048917 Bacteria 2730
429 Ga0501038_1185825 3300049574 Bacteria 555
430 Ga0501040_1442884 3300049576 Bacteria 500
431 Ga0501041_0297484 3300049577 Bacteria 1017
432 Ga0501042_0093116 3300049578 Bacteria 2164
433 Ga0501042_0386933 3300049578 Bacteria 1013
434 Ga0501067_0140019 3300049583 Bacteria 1347
435 Ga0501069_0970611 3300049585 Bacteria 518
436 Ga0501071_1556566 3300049587 Bacteria 510
437 Ga0501072_0088056 3300049588 Bacteria 2464
438 Ga0501075_0178400 3300049591 Bacteria 1621
439 Ga0501075_0935887 3300049591 Bacteria 659
440 Ga0501079_0720705 3300049741 Bacteria 785
441 Ga0501081_1067248 3300049743 Bacteria 611
442 Ga0501081_1515479 3300049743 Bacteria 509
443 Ga0501045_0161896 3300049824 Bacteria 1666
444 nmdc:mga05p37_1286573_c1 3300050507 Unclassified 747
445 nmdc:mga05p37_750703_c1 3300050507 Bacteria 1075
446 nmdc:mga0qj67_1178856_c1 3300050509 Bacteria 596
447 nmdc:mga08y16_40028_c1 3300050511 Bacteria 4915
448 nmdc:mga0n895_1286151_c1 3300050512 Bacteria 703
449 nmdc:mga0n895_449436_c1 3300050512 Bacteria 1301
450 nmdc:mga0n895_917598_c1 3300050512 Bacteria 860
451 nmdc:mga08x19_314927_c1 3300050514 Bacteria 1088
452 nmdc:mga0a205_167864_c1 3300050515 Bacteria 2090
453 Ga0495601_0329476 3300053077 Bacteria 994
454 Ga0495619_1165243 3300053085 Bacteria 511
455 Ga0501082_0496367 3300060353 Bacteria 1067
456 2644292336 2643221652 Bacteria 5140275
457 2688392594 2687453341 Bacteria 6534136
458 8055227635 8055225921 Bacteria 3341787
459 Ga0207682_10049395
460 JGI24752J21851_1005866
461 JGI24742J22300_10072951
462 Ga0065712_10085850
463 Ga0065715_10368494
464 Ga0070658_10443006
465 Ga0070676_10002776
466 Ga0070676_11122835
467 Ga0070690_100045926
468 Ga0070690_100164416
469 Ga0070670_100036600
470 Ga0070670_100525789
471 Ga0070670_100539444
472 Ga0070677_10013682
473 Ga0070677_10014573
474 Ga0068869_100002836
475 Ga0068869_100025479
476 Ga0070666_10014440
477 Ga0070666_10187253
478 Ga0068868_100000976
479 Ga0068868_101793859
480 Ga0070660_100001365
481 Ga0070660_100091441
482 Ga0070660_100567880
483 Ga0070687_100198052
484 Ga0070661_100000629
485 Ga0070661_100010659
486 Ga0070661_100158968
487 Ga0070692_10226164
488 Ga0070668_100003626
489 Ga0070668_100045290
490 Ga0070668_100179162
491 Ga0070668_100304194
492 Ga0070669_100038532
493 Ga0070669_100626541
494 Ga0070675_100127734
495 Ga0070675_100258352
496 Ga0070675_100440863
497 Ga0070671_100009890
498 Ga0070671_100353202
499 Ga0070674_100007363
500 Ga0070673_100013880
501 Ga0070673_100741613
502 Ga0070688_100239824
503 Ga0070659_100192267
504 Ga0070667_100003078
505 Ga0070667_100013445
506 Ga0070667_100434957
507 Ga0070667_100603311
508 Ga0070714_100014317
509 Ga0070713_100043394
510 Ga0070713_100336341
511 Ga0070713_101479899
512 Ga0070701_10073675
513 Ga0070705_100229706
514 Ga0070705_101259010
515 Ga0070700_100079764
516 Ga0070708_100111556
517 Ga0070663_100073668
518 Ga0070663_100143213
519 Ga0070663_100199398
520 Ga0070678_100047715
521 Ga0070678_100153754
522 Ga0070662_100078174
523 Ga0070681_10015563
524 Ga0070681_10036612
525 Ga0068867_100000817
526 Ga0068867_100122745
527 Ga0068867_101223583
528 Ga0070685_10200235
529 Ga0070706_100294118
530 Ga0070706_100369321
531 Ga0070707_101039321
532 Ga0070698_100448029
533 Ga0070698_101248940
534 Ga0070699_100629654
535 Ga0070679_100097322
536 Ga0070684_100004019
537 Ga0070697_100884705
538 Ga0068853_100111608
539 Ga0068853_100427195
540 Ga0068853_100489013
541 Ga0068853_101797411
542 Ga0070672_100050891
543 Ga0070672_101121190
544 Ga0070686_100093997
545 Ga0070686_101020054
546 Ga0070696_100372723
547 Ga0070665_100011271
548 Ga0070665_100962748
549 Ga0068855_100364604
550 Ga0068855_100716994
551 Ga0070664_100002907
552 Ga0070664_100060119
553 Ga0068857_100006558
554 Ga0068857_100036847
555 Ga0068854_100003221
556 Ga0068854_100116825
557 Ga0068856_100364623
558 Ga0070702_100054823
559 Ga0070702_100084133
560 Ga0068852_100254284
561 Ga0068852_100413089
562 Ga0068852_100424695
563 Ga0068852_100457395
564 Ga0068852_100480455
565 Ga0068852_100901863
566 Ga0068859_100006776
567 Ga0068859_100026695
568 Ga0068859_100085595
569 Ga0068859_100463502
570 Ga0068864_100009746
571 Ga0068864_100013188
572 Ga0068864_100478912
573 Ga0068866_10069661
574 Ga0068861_100141436
575 Ga0068861_100306289
576 Ga0068861_102272407
577 Ga0068851_10045912
578 Ga0068851_10908481
579 Ga0068870_10042358
580 Ga0068863_100035842
581 Ga0068863_100415334
582 Ga0068863_100501763
583 Ga0068858_100024360
584 Ga0068858_100048711
585 Ga0068860_100011157
586 Ga0068860_100068132
587 Ga0068860_100127028
588 Ga0068862_100099407
589 Ga0081455_10284986
590 Ga0081539_10003009
591 Ga0097621_100010893
592 Ga0068871_100006339
593 Ga0068871_100137518
594 Ga0068871_100440063
595 Ga0075428_100024812
596 Ga0075428_101611240
597 Ga0075433_10089181
598 Ga0075434_100131106
599 Ga0075434_100317618
600 Ga0075434_100365275
601 Ga0075434_100365833
602 Ga0075434_102064773
603 Ga0068865_100019747
604 Ga0068865_100291045
605 Ga0068865_101174351
606 Ga0075436_100207663
607 Ga0097620_100006776
608 Ga0097620_100026695
609 Ga0097620_100085597
610 Ga0097620_100463554
611 Ga0075435_100077441
612 Ga0105244_10204634
613 Ga0105240_10002432
614 Ga0111539_10165293
615 Ga0105245_12055933
616 Ga0105247_10204043
617 Ga0105247_10242500
618 Ga0114129_10232311
619 Ga0114129_10380102
620 Ga0105243_10280133
621 Ga0105243_10593942
622 Ga0105242_10025306
623 Ga0105242_10353876
624 Ga0105248_10033910
625 Ga0105248_10346259
626 Ga0105248_10660737
627 Ga0105248_11411904
628 Ga0105237_11541913
629 Ga0105238_10000865
630 Ga0105238_10379434
631 Ga0105249_10103060
632 Ga0105249_10251422
633 Ga0105239_10356081
634 Ga0157371_10260548
635 Ga0157370_10013669
636 Ga0157370_10078308
637 Ga0157370_10257607
638 Ga0157369_10023215
639 Ga0157374_10006640
640 Ga0157374_10105333
641 Ga0157378_10527876
642 Ga0157378_11590752
643 Ga0163162_10017011
644 Ga0163162_10409944
645 Ga0163162_11745161
646 Ga0157372_10007305
647 Ga0157372_10339231
648 Ga0157372_10841931
649 Ga0157375_10052291
650 Ga0157375_12227971
651 Ga0157375_12328469
652 Ga0157375_12352249
653 Ga0163163_10115547
654 Ga0157380_10016864
655 Ga0157380_10071789
656 Ga0157380_10200729
657 Ga0157380_11226449
658 Ga0157377_10000479
659 Ga0157379_10002422
660 Ga0157379_10017242
661 Ga0157379_10047131
662 Ga0157379_10344052
663 Ga0157379_10849679
664 Ga0157376_10006479
665 Ga0157376_10850559
666 Ga0157376_11758899
667 Ga0163161_10045651
668 Ga0163161_10062454
669 Ga0163161_10094508
670 Ga0207666_1006981
671 Ga0207673_1005392
672 Ga0207697_10000793
673 Ga0207682_10000479
674 Ga0207682_10020525
675 Ga0207642_10245237
676 Ga0207642_10260246
677 Ga0207710_10160481
678 Ga0207688_10004005
679 Ga0207680_10057518
680 Ga0207647_10656083
681 Ga0207645_10000039
682 Ga0207645_10041463
683 Ga0207643_10000327
684 Ga0207705_10530033
685 Ga0207705_10690842
686 Ga0207684_10358823
687 Ga0207707_10318739
688 Ga0207707_10982871
689 Ga0207660_10885689
690 Ga0207662_10151304
691 Ga0207657_10003553
692 Ga0207657_10102347
693 Ga0207649_10280078
694 Ga0207649_10650791
695 Ga0207649_11287629
696 Ga0207652_10258066
697 Ga0207652_11320889
698 Ga0207646_10097208
699 Ga0207646_10401318
700 Ga0207646_11916657
701 Ga0207681_10451824
702 Ga0207681_10510162
703 Ga0207681_10852000
704 Ga0207681_10891880
705 Ga0207694_10005113
706 Ga0207650_10006374
707 Ga0207650_10069157
708 Ga0207650_10286972
709 Ga0207659_10312489
710 Ga0207659_10582600
711 Ga0207700_10989298
712 Ga0207700_11521673
713 Ga0207664_10400234
714 Ga0207644_10088017
715 Ga0207644_10476240
716 Ga0207690_10030561
717 Ga0207706_10001560
718 Ga0207706_10074149
719 Ga0207686_10322661
720 Ga0207686_10378915
721 Ga0207670_10550845
722 Ga0207669_10026475
723 Ga0207669_10196473
724 Ga0207704_10032692
725 Ga0207704_10109841
726 Ga0207665_11397927
727 Ga0207691_10000027
728 Ga0207691_11034783
729 Ga0207691_11144047
730 Ga0207711_10058151
731 Ga0207711_10073937
732 Ga0207711_10585927
733 Ga0207711_10644766
734 Ga0207689_10000387
735 Ga0207689_10013069
736 Ga0207661_10011403
737 Ga0207661_11066004
738 Ga0207679_10006768
739 Ga0207679_10150869
740 Ga0207679_10728149
741 Ga0207667_10492758
742 Ga0207667_10525392
743 Ga0207667_10530547
744 Ga0207651_10066793
745 Ga0207651_10078967
746 Ga0207651_10425207
747 Ga0207712_10127244
748 Ga0207712_10143668
749 Ga0207668_10011931
750 Ga0207668_10034748
751 Ga0207668_10082702
752 Ga0207668_10087307
753 Ga0207668_10326277
754 Ga0207640_11954333
755 Ga0207658_10004431
756 Ga0207658_10008875
757 Ga0207658_10205223
758 Ga0207658_10558261
759 Ga0207677_10395126
760 Ga0207677_10662792
761 Ga0207703_10007413
762 Ga0207639_11032867
763 Ga0207639_11193374
764 Ga0207678_10111213
765 Ga0207678_10264512
766 Ga0207678_10368022
767 Ga0207708_10003210
768 Ga0207708_10799859
769 Ga0207702_10611189
770 Ga0207641_10057250
771 Ga0207641_10332337
772 Ga0207641_10513348
773 Ga0207641_11240714
774 Ga0207648_10002944
775 Ga0207648_10011528
776 Ga0207648_10300639
777 Ga0207676_10006023
778 Ga0207676_10266414
779 Ga0207676_10585386
780 Ga0207674_10000465
781 Ga0207674_10001083
782 Ga0207674_10082946
783 Ga0207675_100000626
784 Ga0207675_100115878
785 Ga0207675_100348243
786 Ga0207675_101953039
787 Ga0207683_10000061
788 Ga0207683_10005814
789 Ga0207683_10381513
790 Ga0207698_10215933
791 Ga0207698_10298710
792 Ga0207698_10704546
793 Ga0207698_11027316
794 Ga0207698_11030648
795 Ga0207698_11253491
796 Ga0209983_1060269
797 Ga0268266_10302847
798 Ga0268266_12093882
799 Ga0268265_10029089
800 Ga0268265_10155289
801 Ga0268265_10625378
802 Ga0268264_10016514
803 Ga0268264_10174831
804 Ga0268264_10587319
805 Ga0316575_10036487
806 Ga0316579_10085039
807 Ga0316578_10159145
808 Ga0307405_10163515
809 Ga0307405_10244892
810 Ga0316577_10393023
811 Ga0307413_10047553
812 Ga0307413_11349945
813 Ga0307410_10009688
814 Ga0307410_10030010
815 Ga0307410_10133593
816 Ga0307410_10137324
817 Ga0307406_10031169
818 Ga0307406_10139323
819 Ga0307407_10008985
820 Ga0307407_10063731
821 Ga0307412_10029479
822 Ga0307412_10046478
823 Ga0307409_100065291
824 Ga0307409_100066958
825 Ga0307409_100089641
826 Ga0307409_100876329
827 Ga0307416_100025017
828 Ga0307416_100103147
829 Ga0307416_100912697
830 Ga0307414_10301158
831 Ga0307414_10763267
832 Ga0307411_10031380
833 Ga0307411_10093867
834 Ga0307415_100017470
835 Ga0307415_100107519
836 Ga0373936_0084703
837 Ga0373939_0142656
838 Ga0373956_0125572
839 Ga0373957_0322230
840 Ga0373943_0027760
841 Ga0373946_0007846
842 Ga0373946_0481626
843 Ga0373955_0050804
844 Ga0373931_0330213
845 Ga0373931_0830126
846 Ga0373935_1338782
847 Ga0373927_0011789
848 Ga0373947_0032066
849 Ga0373937_0154190
850 Ga0373937_1367743
851 Ga0316582_0076555
852 Ga0373925_0178404
853 Ga0451802_1938011
854 Ga0451839_0997633
855 Ga0451845_0575832
856 Ga0451853_1537311
857 Ga0439441_003698
858 Ga0439441_054211
859 Ga0450891_022835
860 Ga0439435_0095756
861 Ga0451576_2021056
862 Ga0495603_0442935
863 Ga0495629_0421789
864 Ga0495608_0040709
865 Ga0495608_0571900
866 Ga0495642_0355659
867 Ga0495652_0663019
868 Ga0495586_0170274
869 Ga0495598_0102166
870 Ga0495621_0050821
871 Ga0495621_0225249
872 Ga0495667_0068519
873 Ga0496100_0098221
874 Ga0496101_0114743
875 Ga0496103_0252152
876 Ga0496104_0135680
877 Ga0496106_0079635
878 Ga0496107_0085936
879 Ga0496108_0370958
880 Ga0496109_0144568
881 Ga0496109_0163144
882 Ga0496110_0010776
883 Ga0496110_0125899
884 Ga0496111_0036070
885 Ga0496111_0176716
886 Ga0496114_0081720
887 Ga0501038_1185825
888 Ga0501040_1442884
889 Ga0501041_0297484
890 Ga0501042_0093116
891 Ga0501042_0386933
892 Ga0501067_0140019
893 Ga0501069_0970611
894 Ga0501071_1556566
895 Ga0501072_0088056
896 Ga0501075_0178400
897 Ga0501075_0935887
898 Ga0501079_0720705
899 Ga0501081_1067248
900 Ga0501081_1515479
901 Ga0501045_0161896
902 nmdc:mga05p37_1286573_c1
903 nmdc:mga05p37_750703_c1
904 nmdc:mga0qj67_1178856_c1
905 nmdc:mga08y16_40028_c1
906 nmdc:mga0n895_1286151_c1
907 nmdc:mga0n895_449436_c1
908 nmdc:mga0n895_917598_c1
909 nmdc:mga08x19_314927_c1
910 nmdc:mga0a205_167864_c1
911 Ga0495601_0329476
912 Ga0495619_1165243
913 Ga0501082_0496367
914 2644292336
915 2688392594
916 8055227635

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09996

DUF2237

Uncharacterized protein conserved in bacteria (DUF2237)

23

137

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ush-assembly1.cif.gz_A crystal structure of the q2s0r5 protein from salinibacter ruber, northeast structural genomics consortium target srr207 0.8819 6 122
3ush-assembly1.cif.gz_A crystal structure of the q2s0r5 protein from salinibacter ruber, northeast structural genomics consortium target srr207 0.868 6 122
4ioh-assembly1.cif.gz_A-2 crystal structure of the tll1086 protein from thermosynechococcus elongatus, northeast structural genomics consortium target ter258 0.7609 1 121
4ioh-assembly1.cif.gz_A-2 crystal structure of the tll1086 protein from thermosynechococcus elongatus, northeast structural genomics consortium target ter258 0.7489 1 121
3anw-assembly1.cif.gz_B a protein complex essential initiation of dna replication 0.6778 38 94
ID Description Score Start End Superfamily
3ushA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.8726 6 122 3.30.56.110
3ushA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.8584 6 122 3.30.56.110
4iohA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.7767 6 121 3.30.56.110
4iohA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.7586 6 121 3.30.56.110
3anwB00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6778 38 94 1.20.58.2050
ID Description Score Start End GO Terms
AF-A0A348WHA5-F1-model_v4 DUF2237 domain-containing protein 1.005 72 120
AF-A0A383B302-F1-model_v4 DUF2237 domain-containing protein 0.9973 46 114
AF-A0A6P0XT53-F1-model_v4 DUF2237 domain-containing protein 0.9972 60 121
AF-F5Z6E1-F1-model_v4 DUF2237 domain-containing protein 0.9971 43 122
AF-A0A353DFF3-F1-model_v4 DUF2237 domain-containing protein 0.9963 50 121

Map