F448163

General Info

Members Datasets Scaffolds Average Seq Length
458 185 906 883

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10012706|Ga0075364_100127062
Length 1023
Sequence MPQHDPRVIAVFESAVLHEATGRSAFVREACADDADLRRQVESLLADAEQPIVIDRPVDEVIAALIADDDLPHMIGTQVGAFHVESLLGAGGMGAVYRATDTVLRRQVAIKVLPADLADDPDRVARFRREAEALAALNHPNIGAIYGLEPIDGGASPAFALVLELVEGPTLAETLARGPLPVEDALAIAEQLAEALDAAHQQGIVHRDLKPGNLKVRDDGTVKVLDFGVASARRSERHAGRDDDAGTILGTPAYMSPEQAAGKPVTRTTDIWAFGCVLYEMLTGRTPFTPDGGTLASAPTVRGEPDYDRLPASTPAGIRTLLRHCLQKDPRRRWPDAGSLRIAIEDARTAPADVLTPPAISRATWRWRLAIAAAIVSAAAVSILAXXRLARQPPAGVVTRVLVPVSPASRIALTLDFPNARPFRTAIALSPDGQSLVFVGARPEGAAPPVAQPSDASQLATTRARQLYLRLMDRLQAMPIPGTEGAESPFFSPDGQWVGFWQAGADQGGPSALGVLRKVPLAGGPIVTICRSALPAGISWGTNGRIVFANHAGGGLWQVADAGGNPETLTTPDPAKGELAHRLPHVLPDGRAVLYTVQRSPGGWDDTQVVVRSLVTGAQTLLVDDAADARYVPSGHVVYARMGTLLAQPFDVTRLAPTGQPVGVVDDVMQDVNSRFTIGNSGAAQFSVASNGTLAYLTGGVAPEGDYVPVWRDRSGVETDVGIPARSGASRPRIAPDGRRIAFPSLEGIGIFDTTRQTFQLLTSPAWGSPTRRSAPELRFVAWHPDGERVTFTGVDGGLYWMRADGSGPAERLAPADDATASPRLRVPLSWTPDGRTLLFTQRLGSAASVNRDVWALALGGSAPAARPFLASDADEPAAEISPDGRYIAYESAQSGRSEVYVQPFPGSGRREPISIDGGGQPAWSRSGRELFYRAPGPGAMMRMMSVDVRLGDTFTAGRPREVWRDLRNRYPGGTGGRTYDVAPDGRRFLMIQQRDPVPQPPIEHVVLVENWLDELTRLVPTH

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
108 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
127 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
181 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
182 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
183 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.53
Nodule 0
Rhizoplane 3.06
Rhizosphere 95.41
Stem 0
Stem Tuber 0
Unclassified 0.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10012706 3300006051 Bacteria 5161
2 JGI24746J21847_1001464 3300001977 Bacteria 3751
3 Ga0065704_10075900 3300005289 Bacteria 5363
4 Ga0065712_10001112 3300005290 Bacteria 6792
5 Ga0065712_10067865 3300005290 Bacteria 24437
6 Ga0065707_10001581 3300005295 Bacteria 6797
7 Ga0065707_10001785 3300005295 Bacteria 7412
8 Ga0065707_10085558 3300005295 Bacteria 6066
9 Ga0070683_100002196 3300005329 Bacteria 15452
10 Ga0070690_100012828 3300005330 Unclassified 4937
11 Ga0070690_100023842 3300005330 Bacteria 3758
12 Ga0070670_100001419 3300005331 Bacteria 19255
13 Ga0070670_100003441 3300005331 Bacteria 13134
14 Ga0070670_100008626 3300005331 Bacteria 8700
15 Ga0070670_100010434 3300005331 Bacteria 7928
16 Ga0070670_100033323 3300005331 Bacteria 4436
17 Ga0070670_100042889 3300005331 Bacteria 3890
18 Ga0068869_100003100 3300005334 Bacteria 10134
19 Ga0068869_100015208 3300005334 Bacteria 5156
20 Ga0070666_10010543 3300005335 Bacteria 5781
21 Ga0070661_100005596 3300005344 Bacteria 8658
22 Ga0070669_100000287 3300005353 Bacteria 39695
23 Ga0070669_100004632 3300005353 Bacteria 9925
24 Ga0070669_100004834 3300005353 Bacteria 9724
25 Ga0070669_100005382 3300005353 Bacteria 9235
26 Ga0070669_100007174 3300005353 Bacteria 8008
27 Ga0070669_100018014 3300005353 Bacteria 5046
28 Ga0070669_100029454 3300005353 Bacteria 3957
29 Ga0070675_100001769 3300005354 Bacteria 15927
30 Ga0070675_100002096 3300005354 Bacteria 14768
31 Ga0070675_100002880 3300005354 Bacteria 12967
32 Ga0070675_100004235 3300005354 Bacteria 10914
33 Ga0070675_100007379 3300005354 Bacteria 8491
34 Ga0070675_100009049 3300005354 Bacteria 7736
35 Ga0070675_100009308 3300005354 Bacteria 7638
36 Ga0070675_100011748 3300005354 Bacteria 6858
37 Ga0070675_100015553 3300005354 Bacteria 6019
38 Ga0070671_100042557 3300005355 Bacteria 3776
39 Ga0070673_100009551 3300005364 Bacteria 6515
40 Ga0070673_100020175 3300005364 Bacteria 4803
41 Ga0070673_100028595 3300005364 Bacteria 4147
42 Ga0070688_100010693 3300005365 Bacteria 5070
43 Ga0070688_100012772 3300005365 Unclassified 4716
44 Ga0070659_100059868 3300005366 Bacteria 3007
45 Ga0070667_100017523 3300005367 Bacteria 5937
46 Ga0070701_10002409 3300005438 Bacteria 7202
47 Ga0070700_100015259 3300005441 Bacteria 4354
48 Ga0070681_10063777 3300005458 Bacteria 3657
49 Ga0068867_100002742 3300005459 Bacteria 12412
50 Ga0070685_10004096 3300005466 Bacteria 7364
51 Ga0070685_10016528 3300005466 Bacteria 3933
52 Ga0070698_100052287 3300005471 Bacteria 4156
53 Ga0070699_100032334 3300005518 Bacteria 4517
54 Ga0070684_100000401 3300005535 Bacteria 29645
55 Ga0070672_100002270 3300005543 Bacteria 12131
56 Ga0070672_100010917 3300005543 Bacteria 6319
57 Ga0070672_100017417 3300005543 Bacteria 5171
58 Ga0070672_100039327 3300005543 Bacteria 3622
59 Ga0070686_100023147 3300005544 Bacteria 3709
60 Ga0070695_100014081 3300005545 Bacteria 4816
61 Ga0070665_100078691 3300005548 Bacteria 3303
62 Ga0070704_100000625 3300005549 Bacteria 17057
63 Ga0068857_100004653 3300005577 Bacteria 11629
64 Ga0068857_100024310 3300005577 Bacteria 5332
65 Ga0068857_100031765 3300005577 Bacteria 4666
66 Ga0068859_100002208 3300005617 Bacteria 19742
67 Ga0068859_100002454 3300005617 Bacteria 18885
68 Ga0068859_100055473 3300005617 Bacteria 3987
69 Ga0068859_100076181 3300005617 Bacteria 3395
70 Ga0068859_100081693 3300005617 Bacteria 3274
71 Ga0068859_100083624 3300005617 Bacteria 3235
72 Ga0068864_100017925 3300005618 Bacteria 5907
73 Ga0068864_100044441 3300005618 Bacteria 3808
74 Ga0068864_100074782 3300005618 Bacteria 2956
75 Ga0068861_100000670 3300005719 Bacteria 20384
76 Ga0068863_100000788 3300005841 Bacteria 31845
77 Ga0068863_100005640 3300005841 Bacteria 12294
78 Ga0068863_100011663 3300005841 Bacteria 8502
79 Ga0068863_100056799 3300005841 Bacteria 3705
80 Ga0068858_100005590 3300005842 Bacteria 12294
81 Ga0068858_100006857 3300005842 Bacteria 11070
82 Ga0068862_100001192 3300005844 Bacteria 24513
83 Ga0068862_100003313 3300005844 Bacteria 13924
84 Ga0068862_100020216 3300005844 Bacteria 5560
85 Ga0068862_100021269 3300005844 Bacteria 5421
86 Ga0068862_100033407 3300005844 Bacteria 4349
87 Ga0068862_100060932 3300005844 Bacteria 3243
88 Ga0081539_10000017 3300005985 Bacteria 375107
89 Ga0081539_10000826 3300005985 Bacteria 59787
90 Ga0081539_10009127 3300005985 Bacteria 8381
91 Ga0075366_10000071 3300006195 Bacteria 39250
92 Ga0097621_100005525 3300006237 Bacteria 8905
93 Ga0075370_10002982 3300006353 Bacteria 7961
94 Ga0068871_100010454 3300006358 Bacteria 6774
95 Ga0075428_100000354 3300006844 Bacteria 45507
96 Ga0075428_100000705 3300006844 Bacteria 34552
97 Ga0075428_100001026 3300006844 Bacteria 29570
98 Ga0075428_100009851 3300006844 Bacteria 10620
99 Ga0075428_100013545 3300006844 Bacteria 9079
100 Ga0075428_100015567 3300006844 Bacteria 8430
101 Ga0075428_100016678 3300006844 Bacteria 8111
102 Ga0075428_100026102 3300006844 Bacteria 6469
103 Ga0075428_100026997 3300006844 Bacteria 6358
104 Ga0075428_100051112 3300006844 Bacteria 4532
105 Ga0075430_100000309 3300006846 Bacteria 34631
106 Ga0075430_100001402 3300006846 Bacteria 19600
107 Ga0075430_100009109 3300006846 Bacteria 8385
108 Ga0075430_100015746 3300006846 Bacteria 6441
109 Ga0075430_100041548 3300006846 Bacteria 3890
110 Ga0075431_100002374 3300006847 Bacteria 18099
111 Ga0075431_100008907 3300006847 Bacteria 10056
112 Ga0075431_100012409 3300006847 Bacteria 8599
113 Ga0075431_100012570 3300006847 Bacteria 8543
114 Ga0075433_10000034 3300006852 Bacteria 55071
115 Ga0075433_10008731 3300006852 Bacteria 8084
116 Ga0075434_100000059 3300006871 Bacteria 55358
117 Ga0075434_100003879 3300006871 Bacteria 13385
118 Ga0075434_100009829 3300006871 Bacteria 8943
119 Ga0075434_100038679 3300006871 Bacteria 4725
120 Ga0075429_100000895 3300006880 Bacteria 23546
121 Ga0075429_100021743 3300006880 Bacteria 5563
122 Ga0075429_100027592 3300006880 Bacteria 4928
123 Ga0075436_100003830 3300006914 Bacteria 10317
124 Ga0075436_100010203 3300006914 Bacteria 6432
125 Ga0097620_100002208 3300006931 Bacteria 19742
126 Ga0097620_100002454 3300006931 Bacteria 18885
127 Ga0097620_100055469 3300006931 Bacteria 3987
128 Ga0097620_100076180 3300006931 Bacteria 3395
129 Ga0097620_100081694 3300006931 Bacteria 3274
130 Ga0097620_100083624 3300006931 Bacteria 3235
131 Ga0075435_100001462 3300007076 Bacteria 15181
132 Ga0105240_10041958 3300009093 Bacteria 5834
133 Ga0105240_10092827 3300009093 Bacteria 3685
134 Ga0111539_10000291 3300009094 Bacteria 60553
135 Ga0111539_10000436 3300009094 Bacteria 52673
136 Ga0111539_10000604 3300009094 Bacteria 46424
137 Ga0111539_10000640 3300009094 Bacteria 45232
138 Ga0111539_10000780 3300009094 Bacteria 41428
139 Ga0111539_10002238 3300009094 Bacteria 25817
140 Ga0111539_10003047 3300009094 Bacteria 22201
141 Ga0111539_10003979 3300009094 Bacteria 19418
142 Ga0111539_10004287 3300009094 Bacteria 18652
143 Ga0111539_10004568 3300009094 Bacteria 18095
144 Ga0111539_10005445 3300009094 Bacteria 16466
145 Ga0111539_10006263 3300009094 Bacteria 15360
146 Ga0111539_10006626 3300009094 Bacteria 14918
147 Ga0111539_10008865 3300009094 Bacteria 12741
148 Ga0111539_10016074 3300009094 Bacteria 9288
149 Ga0111539_10020348 3300009094 Bacteria 8174
150 Ga0111539_10020865 3300009094 Bacteria 8067
151 Ga0111539_10025190 3300009094 Bacteria 7293
152 Ga0111539_10031166 3300009094 Bacteria 6480
153 Ga0111539_10034606 3300009094 Bacteria 6122
154 Ga0111539_10054351 3300009094 Bacteria 4765
155 Ga0105245_10035525 3300009098 Bacteria 4423
156 Ga0114129_10000180 3300009147 Bacteria 70105
157 Ga0114129_10000374 3300009147 Bacteria 52129
158 Ga0114129_10000827 3300009147 Bacteria 39985
159 Ga0114129_10000924 3300009147 Bacteria 38328
160 Ga0114129_10003159 3300009147 Bacteria 23109
161 Ga0114129_10004302 3300009147 Bacteria 20120
162 Ga0114129_10018244 3300009147 Bacteria 9992
163 Ga0114129_10018727 3300009147 Bacteria 9861
164 Ga0114129_10079978 3300009147 Bacteria 4544
165 Ga0114129_10084275 3300009147 Bacteria 4413
166 Ga0114129_10084908 3300009147 Bacteria 4394
167 Ga0114129_10142046 3300009147 Bacteria 3290
168 Ga0114129_10225754 3300009147 Bacteria 2524
169 Ga0105243_10010502 3300009148 Bacteria 7030
170 Ga0105243_10023281 3300009148 Bacteria 4714
171 Ga0105248_10003158 3300009177 Bacteria 18241
172 Ga0105248_10005543 3300009177 Bacteria 13869
173 Ga0105248_10060013 3300009177 Bacteria 4271
174 Ga0105248_10076077 3300009177 Bacteria 3773
175 Ga0105248_10086079 3300009177 Bacteria 3536
176 Ga0105249_10001194 3300009553 Bacteria 22907
177 Ga0105249_10002129 3300009553 Bacteria 17165
178 Ga0105249_10013499 3300009553 Bacteria 7215
179 Ga0105249_10051162 3300009553 Bacteria 3767
180 Ga0105249_10081631 3300009553 Bacteria 3006
181 Ga0105239_10024254 3300010375 Bacteria 6680
182 Ga0163162_10009176 3300013306 Bacteria 9626
183 Ga0163162_10015769 3300013306 Bacteria 7386
184 Ga0157375_10014613 3300013308 Bacteria 7011
185 Ga0157375_10075810 3300013308 Bacteria 3388
186 Ga0163163_10000011 3300014325 Bacteria 264399
187 Ga0163163_10000137 3300014325 Bacteria 75320
188 Ga0163163_10002164 3300014325 Bacteria 16602
189 Ga0157380_10001839 3300014326 Bacteria 14028
190 Ga0157380_10005598 3300014326 Bacteria 8775
191 Ga0157380_10020843 3300014326 Bacteria 4907
192 Ga0157380_10021478 3300014326 Bacteria 4841
193 Ga0157380_10030028 3300014326 Bacteria 4160
194 Ga0157377_10008726 3300014745 Bacteria 4954
195 Ga0157379_10009124 3300014968 Bacteria 8637
196 Ga0207697_10000591 3300025315 Bacteria 20636
197 Ga0207697_10000826 3300025315 Bacteria 17560
198 Ga0207697_10004514 3300025315 Bacteria 6637
199 Ga0207682_10000645 3300025893 Bacteria 16278
200 Ga0207688_10000440 3300025901 Bacteria 19702
201 Ga0207645_10002612 3300025907 Bacteria 14043
202 Ga0207645_10021268 3300025907 Bacteria 4233
203 Ga0207643_10001762 3300025908 Bacteria 12085
204 Ga0207707_10075101 3300025912 Bacteria 2949
205 Ga0207649_10007292 3300025920 Bacteria 6015
206 Ga0207681_10005936 3300025923 Bacteria 7486
207 Ga0207681_10008677 3300025923 Bacteria 6205
208 Ga0207681_10009094 3300025923 Bacteria 6070
209 Ga0207681_10010755 3300025923 Bacteria 5618
210 Ga0207681_10012244 3300025923 Bacteria 5288
211 Ga0207681_10023251 3300025923 Bacteria 3962
212 Ga0207650_10007552 3300025925 Bacteria 7412
213 Ga0207650_10040775 3300025925 Bacteria 3400
214 Ga0207659_10002197 3300025926 Bacteria 11599
215 Ga0207659_10002592 3300025926 Bacteria 10766
216 Ga0207659_10007989 3300025926 Bacteria 6541
217 Ga0207659_10016000 3300025926 Bacteria 4874
218 Ga0207659_10020362 3300025926 Bacteria 4384
219 Ga0207659_10030367 3300025926 Bacteria 3691
220 Ga0207644_10009072 3300025931 Bacteria 6521
221 Ga0207644_10010638 3300025931 Bacteria 6067
222 Ga0207706_10001140 3300025933 Bacteria 27070
223 Ga0207669_10000190 3300025937 Bacteria 27891
224 Ga0207691_10010344 3300025940 Bacteria 8948
225 Ga0207691_10016278 3300025940 Bacteria 7060
226 Ga0207691_10025575 3300025940 Bacteria 5541
227 Ga0207691_10042838 3300025940 Bacteria 4172
228 Ga0207691_10056036 3300025940 Bacteria 3592
229 Ga0207691_10058221 3300025940 Bacteria 3515
230 Ga0207711_10008835 3300025941 Bacteria 8421
231 Ga0207711_10011634 3300025941 Bacteria 7311
232 Ga0207711_10030307 3300025941 Bacteria 4562
233 Ga0207689_10004271 3300025942 Bacteria 13002
234 Ga0207689_10051057 3300025942 Bacteria 3409
235 Ga0207679_10022418 3300025945 Bacteria 4300
236 Ga0207651_10008120 3300025960 Bacteria 5644
237 Ga0207712_10032619 3300025961 Bacteria 3515
238 Ga0207658_10011338 3300025986 Bacteria 6066
239 Ga0207658_10015816 3300025986 Bacteria 5180
240 Ga0207703_10037876 3300026035 Bacteria 3844
241 Ga0207678_10035900 3300026067 Unclassified 4316
242 Ga0207708_10025698 3300026075 Bacteria 4456
243 Ga0207641_10016146 3300026088 Bacteria 6115
244 Ga0207641_10017886 3300026088 Bacteria 5806
245 Ga0207641_10037613 3300026088 Bacteria 4043
246 Ga0207648_10000720 3300026089 Bacteria 37073
247 Ga0207648_10018181 3300026089 Bacteria 6367
248 Ga0207676_10005436 3300026095 Bacteria 9011
249 Ga0207676_10024917 3300026095 Bacteria 4434
250 Ga0207674_10019459 3300026116 Bacteria 7352
251 Ga0207674_10023487 3300026116 Bacteria 6603
252 Ga0207674_10047535 3300026116 Bacteria 4397
253 Ga0207675_100000211 3300026118 Bacteria 54453
254 Ga0207675_100002489 3300026118 Bacteria 18239
255 Ga0207675_100010616 3300026118 Bacteria 8625
256 Ga0207675_100022362 3300026118 Bacteria 5889
257 Ga0209998_10002639 3300027717 Bacteria 4056
258 Ga0207428_10000005 3300027907 Bacteria 520045
259 Ga0207428_10000257 3300027907 Bacteria 72841
260 Ga0207428_10000351 3300027907 Bacteria 59538
261 Ga0207428_10000423 3300027907 Bacteria 52600
262 Ga0207428_10000972 3300027907 Bacteria 31764
263 Ga0207428_10001006 3300027907 Bacteria 31269
264 Ga0207428_10001800 3300027907 Bacteria 21956
265 Ga0207428_10002196 3300027907 Bacteria 19612
266 Ga0207428_10002702 3300027907 Bacteria 17684
267 Ga0207428_10003235 3300027907 Bacteria 15899
268 Ga0207428_10009948 3300027907 Bacteria 8515
269 Ga0207428_10013618 3300027907 Bacteria 7094
270 Ga0207428_10014281 3300027907 Bacteria 6911
271 Ga0207428_10015731 3300027907 Bacteria 6533
272 Ga0207428_10030224 3300027907 Bacteria 4480
273 Ga0207428_10040861 3300027907 Bacteria 3757
274 Ga0268265_10003607 3300028380 Bacteria 11058
275 Ga0268265_10004182 3300028380 Bacteria 10105
276 Ga0268265_10019924 3300028380 Bacteria 4672
277 Ga0268265_10024168 3300028380 Bacteria 4295
278 Ga0307408_100004366 3300031548 Bacteria 9610
279 Ga0307408_100035347 3300031548 Bacteria 3506
280 Ga0307413_10034989 3300031824 Bacteria 2877
281 Ga0307412_10007475 3300031911 Bacteria 6199
282 Ga0307412_10058240 3300031911 Bacteria 2583
283 Ga0307409_100005128 3300031995 Bacteria 7480
284 Ga0307409_100010402 3300031995 Bacteria 5783
285 Ga0307416_100002299 3300032002 Bacteria 10906
286 Ga0307411_10010023 3300032005 Bacteria 5024
287 Ga0307411_10010414 3300032005 Bacteria 4956
288 Ga0307415_100014115 3300032126 Bacteria 4684
289 Ga0373956_0015972 3300035119 Bacteria 3149
290 Ga0373943_0002410 3300035170 Bacteria 8476
291 Ga0373946_0006466 3300035171 Bacteria 4248
292 Ga0373946_0010795 3300035171 Bacteria 3392
293 Ga0373955_0003421 3300035172 Bacteria 6975
294 Ga0373955_0027329 3300035172 Bacteria 2948
295 Ga0373935_0020208 3300035692 Bacteria 4066
296 Ga0373935_0031809 3300035692 Bacteria 3277
297 Ga0373927_0000145 3300035695 Bacteria 55702
298 Ga0373933_0001008 3300035724 Bacteria 17133
299 Ga0373947_0000055 3300035725 Bacteria 56308
300 Ga0373947_0001777 3300035725 Bacteria 13189
301 Ga0373947_0022971 3300035725 Bacteria 3624
302 Ga0373937_0000109 3300036401 Bacteria 78815
303 Ga0373937_0000815 3300036401 Bacteria 26681
304 Ga0373937_0031088 3300036401 Bacteria 4835
305 Ga0373925_0000365 3300037068 Bacteria 47103
306 Ga0373925_0017209 3300037068 Bacteria 5235
307 Ga0373925_0022149 3300037068 Bacteria 4633
308 Ga0439464_0001535 3300042439 Bacteria 5468
309 Ga0451577_0019768 3300042876 Bacteria 6188
310 Ga0451576_0004572 3300045051 Bacteria 17875
311 Ga0451576_0023393 3300045051 Bacteria 6689
312 Ga0451576_0026367 3300045051 Bacteria 6252
313 Ga0495629_0000003 3300046459 Bacteria 529162
314 Ga0495629_0001411 3300046459 Bacteria 18947
315 Ga0495651_0003596 3300046462 Bacteria 11888
316 Ga0495608_0005067 3300046511 Bacteria 9416
317 Ga0495630_0014079 3300046517 Bacteria 5821
318 Ga0495666_0001308 3300046526 Bacteria 12040
319 Ga0495652_0011471 3300046529 Bacteria 8016
320 Ga0495587_0000990 3300046536 Bacteria 18657
321 Ga0495645_0004324 3300046543 Bacteria 9704
322 Ga0495622_0002326 3300046557 Bacteria 9254
323 Ga0495656_0002217 3300046615 Bacteria 6419
324 Ga0495658_0000712 3300046683 Bacteria 18000
325 Ga0495613_0003920 3300046689 Bacteria 11141
326 Ga0495613_0009465 3300046689 Bacteria 7227
327 Ga0495613_0041797 3300046689 Bacteria 3394
328 Ga0495604_0018461 3300047317 Bacteria 5585
329 Ga0495680_0005856 3300047322 Bacteria 11505
330 Ga0495675_0001885 3300047444 Bacteria 12498
331 Ga0495675_0003908 3300047444 Bacteria 9024
332 Ga0495684_0000311 3300047471 Bacteria 39844
333 Ga0495602_0001780 3300048088 Bacteria 21543
334 Ga0495602_0038618 3300048088 Bacteria 4412
335 Ga0496101_0000851 3300048904 Bacteria 17998
336 Ga0496104_0016370 3300048907 Bacteria 6734
337 Ga0496104_0035724 3300048907 Bacteria 4642
338 Ga0496105_0067409 3300048908 Bacteria 2955
339 Ga0496111_0023545 3300048914 Unclassified 4325
340 Ga0496112_0003246 3300048915 Bacteria 13404
341 Ga0496112_0039060 3300048915 Bacteria 4636
342 Ga0496112_0082319 3300048915 Bacteria 3183
343 Ga0496114_0002424 3300048917 Bacteria 14227
344 Ga0496114_0057008 3300048917 Bacteria 3261
345 Ga0501032_0036719 3300049569 Bacteria 3344
346 Ga0501033_0002360 3300049570 Bacteria 16107
347 Ga0501034_0016417 3300049571 Bacteria 7600
348 Ga0501036_0011529 3300049572 Bacteria 7323
349 Ga0501037_0008139 3300049573 Bacteria 7682
350 Ga0501037_0045842 3300049573 Bacteria 3208
351 Ga0501038_0020699 3300049574 Bacteria 5913
352 Ga0501039_0038327 3300049575 Bacteria 3702
353 Ga0501040_0001271 3300049576 Bacteria 16030
354 Ga0501040_0015989 3300049576 Bacteria 4962
355 Ga0501041_0008828 3300049577 Bacteria 5930
356 Ga0501042_0017866 3300049578 Bacteria 4901
357 Ga0501042_0040555 3300049578 Bacteria 3310
358 Ga0501043_0008789 3300049579 Bacteria 7950
359 Ga0501046_0010236 3300049580 Bacteria 8070
360 Ga0501046_0015414 3300049580 Bacteria 6421
361 Ga0501046_0069188 3300049580 Bacteria 2747
362 Ga0501048_0016870 3300049582 Bacteria 5384
363 Ga0501071_0011106 3300049587 Bacteria 6054
364 Ga0501071_0023293 3300049587 Bacteria 4325
365 Ga0501071_0043411 3300049587 Bacteria 3223
366 Ga0501072_0019279 3300049588 Bacteria 5270
367 Ga0501072_0033436 3300049588 Bacteria 4029
368 Ga0501072_0048444 3300049588 Bacteria 3347
369 Ga0501075_0012034 3300049591 Bacteria 6142
370 Ga0501075_0014721 3300049591 Bacteria 5605
371 Ga0501075_0020946 3300049591 Bacteria 4764
372 Ga0501076_0007881 3300049592 Bacteria 7766
373 Ga0501076_0030767 3300049592 Bacteria 4183
374 Ga0501079_0015083 3300049741 Bacteria 5892
375 Ga0501079_0019835 3300049741 Bacteria 5137
376 Ga0501079_0033010 3300049741 Bacteria 3982
377 Ga0501079_0053301 3300049741 Bacteria 3120
378 Ga0501080_0032983 3300049742 Bacteria 4831
379 Ga0501081_0002165 3300049743 Bacteria 12327
380 Ga0501081_0009506 3300049743 Bacteria 6340
381 Ga0501083_0005398 3300049744 Bacteria 9048
382 Ga0501035_0006170 3300049822 Bacteria 11282
383 Ga0501045_0004383 3300049824 Bacteria 9730
384 nmdc:mga0yw44_2418_c1 3300050492 Bacteria 7949
385 nmdc:mga0k408_1295_c1 3300050493 Bacteria 13536
386 nmdc:mga06z11_3450_c1 3300050494 Bacteria 6117
387 nmdc:mga05p37_127086_c1 3300050507 Bacteria 3130
388 nmdc:mga05p37_1315_c1 3300050507 Bacteria 28920
389 nmdc:mga05p37_26436_c1 3300050507 Bacteria 7060
390 nmdc:mga05p37_34_c1 3300050507 Bacteria 111954
391 nmdc:mga05p37_4276_c1 3300050507 Bacteria 16681
392 nmdc:mga05p37_4471_c1 3300050507 Bacteria 16336
393 nmdc:mga05p37_487_c1 3300050507 Bacteria 43488
394 nmdc:mga05p37_53425_c1 3300050507 Bacteria 4968
395 nmdc:mga05p37_72726_c1 3300050507 Bacteria 4231
396 nmdc:mga05p37_75200_c1 3300050507 Bacteria 4158
397 nmdc:mga09592_16101_c1 3300050508 Bacteria 6111
398 nmdc:mga09592_19656_c1 3300050508 Bacteria 5547
399 nmdc:mga09592_28323_c1 3300050508 Bacteria 4654
400 nmdc:mga09592_32331_c1 3300050508 Bacteria 4362
401 nmdc:mga0qj67_5637_c1 3300050509 Bacteria 9157
402 nmdc:mga0qj67_70_c1 3300050509 Bacteria 73245
403 nmdc:mga0qj67_76209_c1 3300050509 Bacteria 2682
404 nmdc:mga06r32_1415_c1 3300050510 Bacteria 21648
405 nmdc:mga06r32_20382_c1 3300050510 Bacteria 6105
406 nmdc:mga06r32_30766_c1 3300050510 Bacteria 5037
407 nmdc:mga06r32_49162_c1 3300050510 Bacteria 4032
408 nmdc:mga06r32_54110_c1 3300050510 Bacteria 3848
409 nmdc:mga06r32_85912_c1 3300050510 Bacteria 3068
410 nmdc:mga08y16_10785_c1 3300050511 Bacteria 9592
411 nmdc:mga08y16_1091_c1 3300050511 Bacteria 26752
412 nmdc:mga08y16_12670_c1 3300050511 Bacteria 8870
413 nmdc:mga08y16_16486_c1 3300050511 Bacteria 7771
414 nmdc:mga08y16_17890_c1 3300050511 Bacteria 7466
415 nmdc:mga08y16_1798_c1 3300050511 Bacteria 21741
416 nmdc:mga08y16_2251_c1 3300050511 Bacteria 19787
417 nmdc:mga08y16_23687_c1 3300050511 Bacteria 6483
418 nmdc:mga08y16_24686_c1 3300050511 Bacteria 6344
419 nmdc:mga08y16_2722_c1 3300050511 Bacteria 18130
420 nmdc:mga08y16_32516_c1 3300050511 Bacteria 5483
421 nmdc:mga08y16_4391_c1 3300050511 Bacteria 14743
422 nmdc:mga08y16_5078_c1 3300050511 Bacteria 13756
423 nmdc:mga08y16_59093_c1 3300050511 Bacteria 4006
424 nmdc:mga08y16_7054_c1 3300050511 Bacteria 11794
425 nmdc:mga08y16_8717_c1 3300050511 Bacteria 10634
426 nmdc:mga08y16_9_c1 3300050511 Bacteria 566088
427 nmdc:mga0n895_12222_c1 3300050512 Bacteria 7694
428 nmdc:mga0n895_1740_c1 3300050512 Bacteria 16472
429 nmdc:mga0n895_2030_c1 3300050512 Bacteria 15576
430 nmdc:mga0n895_3188_c1 3300050512 Bacteria 13110
431 nmdc:mga0n895_5919_c1 3300050512 Bacteria 10282
432 nmdc:mga0rr50_945_c1 3300050513 Bacteria 15711
433 nmdc:mga08x19_5124_c1 3300050514 Bacteria 7750
434 nmdc:mga08x19_598_c1 3300050514 Bacteria 23411
435 nmdc:mga0a205_12668_c1 3300050515 Bacteria 7810
436 nmdc:mga0a205_176_c1 3300050515 Bacteria 43310
437 nmdc:mga0a205_1964_c1 3300050515 Bacteria 17906
438 nmdc:mga0a205_3887_c1 3300050515 Bacteria 13374
439 nmdc:mga0a205_7381_c1 3300050515 Bacteria 9954
440 Ga0495601_0006847 3300053077 Bacteria 6678
441 Ga0495619_0004290 3300053085 Bacteria 9089
442 Ga0495619_0039114 3300053085 Bacteria 3096
443 Ga0500645_000044 3300053730 Bacteria 109705
444 Ga0501084_0004434 3300054114 Bacteria 11454
445 Ga0501084_0022131 3300054114 Bacteria 5303
446 Ga0501084_0062009 3300054114 Bacteria 3130
447 Ga0590071_000460 3300059421 Bacteria 11857
448 Ga0590074_000572 3300059423 Bacteria 5531
449 Ga0590075_000421 3300059424 Bacteria 11473
450 Ga0590077_000158 3300059426 Bacteria 19101
451 Ga0501082_0004041 3300060353 Bacteria 12801
452 Ga0501082_0009923 3300060353 Bacteria 8209
453 Ga0530510_0002875 3300061734 Bacteria 11837
454 Ga0075364_10012706
455 JGI24746J21847_1001464
456 Ga0065704_10075900
457 Ga0065712_10001112
458 Ga0065712_10067865
459 Ga0065707_10001581
460 Ga0065707_10001785
461 Ga0065707_10085558
462 Ga0070683_100002196
463 Ga0070690_100012828
464 Ga0070690_100023842
465 Ga0070670_100001419
466 Ga0070670_100003441
467 Ga0070670_100008626
468 Ga0070670_100010434
469 Ga0070670_100033323
470 Ga0070670_100042889
471 Ga0068869_100003100
472 Ga0068869_100015208
473 Ga0070666_10010543
474 Ga0070661_100005596
475 Ga0070669_100000287
476 Ga0070669_100004632
477 Ga0070669_100004834
478 Ga0070669_100005382
479 Ga0070669_100007174
480 Ga0070669_100018014
481 Ga0070669_100029454
482 Ga0070675_100001769
483 Ga0070675_100002096
484 Ga0070675_100002880
485 Ga0070675_100004235
486 Ga0070675_100007379
487 Ga0070675_100009049
488 Ga0070675_100009308
489 Ga0070675_100011748
490 Ga0070675_100015553
491 Ga0070671_100042557
492 Ga0070673_100009551
493 Ga0070673_100020175
494 Ga0070673_100028595
495 Ga0070688_100010693
496 Ga0070688_100012772
497 Ga0070659_100059868
498 Ga0070667_100017523
499 Ga0070701_10002409
500 Ga0070700_100015259
501 Ga0070681_10063777
502 Ga0068867_100002742
503 Ga0070685_10004096
504 Ga0070685_10016528
505 Ga0070698_100052287
506 Ga0070699_100032334
507 Ga0070684_100000401
508 Ga0070672_100002270
509 Ga0070672_100010917
510 Ga0070672_100017417
511 Ga0070672_100039327
512 Ga0070686_100023147
513 Ga0070695_100014081
514 Ga0070665_100078691
515 Ga0070704_100000625
516 Ga0068857_100004653
517 Ga0068857_100024310
518 Ga0068857_100031765
519 Ga0068859_100002208
520 Ga0068859_100002454
521 Ga0068859_100055473
522 Ga0068859_100076181
523 Ga0068859_100081693
524 Ga0068859_100083624
525 Ga0068864_100017925
526 Ga0068864_100044441
527 Ga0068864_100074782
528 Ga0068861_100000670
529 Ga0068863_100000788
530 Ga0068863_100005640
531 Ga0068863_100011663
532 Ga0068863_100056799
533 Ga0068858_100005590
534 Ga0068858_100006857
535 Ga0068862_100001192
536 Ga0068862_100003313
537 Ga0068862_100020216
538 Ga0068862_100021269
539 Ga0068862_100033407
540 Ga0068862_100060932
541 Ga0081539_10000017
542 Ga0081539_10000826
543 Ga0081539_10009127
544 Ga0075366_10000071
545 Ga0097621_100005525
546 Ga0075370_10002982
547 Ga0068871_100010454
548 Ga0075428_100000354
549 Ga0075428_100000705
550 Ga0075428_100001026
551 Ga0075428_100009851
552 Ga0075428_100013545
553 Ga0075428_100015567
554 Ga0075428_100016678
555 Ga0075428_100026102
556 Ga0075428_100026997
557 Ga0075428_100051112
558 Ga0075430_100000309
559 Ga0075430_100001402
560 Ga0075430_100009109
561 Ga0075430_100015746
562 Ga0075430_100041548
563 Ga0075431_100002374
564 Ga0075431_100008907
565 Ga0075431_100012409
566 Ga0075431_100012570
567 Ga0075433_10000034
568 Ga0075433_10008731
569 Ga0075434_100000059
570 Ga0075434_100003879
571 Ga0075434_100009829
572 Ga0075434_100038679
573 Ga0075429_100000895
574 Ga0075429_100021743
575 Ga0075429_100027592
576 Ga0075436_100003830
577 Ga0075436_100010203
578 Ga0097620_100002208
579 Ga0097620_100002454
580 Ga0097620_100055469
581 Ga0097620_100076180
582 Ga0097620_100081694
583 Ga0097620_100083624
584 Ga0075435_100001462
585 Ga0105240_10041958
586 Ga0105240_10092827
587 Ga0111539_10000291
588 Ga0111539_10000436
589 Ga0111539_10000604
590 Ga0111539_10000640
591 Ga0111539_10000780
592 Ga0111539_10002238
593 Ga0111539_10003047
594 Ga0111539_10003979
595 Ga0111539_10004287
596 Ga0111539_10004568
597 Ga0111539_10005445
598 Ga0111539_10006263
599 Ga0111539_10006626
600 Ga0111539_10008865
601 Ga0111539_10016074
602 Ga0111539_10020348
603 Ga0111539_10020865
604 Ga0111539_10025190
605 Ga0111539_10031166
606 Ga0111539_10034606
607 Ga0111539_10054351
608 Ga0105245_10035525
609 Ga0114129_10000180
610 Ga0114129_10000374
611 Ga0114129_10000827
612 Ga0114129_10000924
613 Ga0114129_10003159
614 Ga0114129_10004302
615 Ga0114129_10018244
616 Ga0114129_10018727
617 Ga0114129_10079978
618 Ga0114129_10084275
619 Ga0114129_10084908
620 Ga0114129_10142046
621 Ga0114129_10225754
622 Ga0105243_10010502
623 Ga0105243_10023281
624 Ga0105248_10003158
625 Ga0105248_10005543
626 Ga0105248_10060013
627 Ga0105248_10076077
628 Ga0105248_10086079
629 Ga0105249_10001194
630 Ga0105249_10002129
631 Ga0105249_10013499
632 Ga0105249_10051162
633 Ga0105249_10081631
634 Ga0105239_10024254
635 Ga0163162_10009176
636 Ga0163162_10015769
637 Ga0157375_10014613
638 Ga0157375_10075810
639 Ga0163163_10000011
640 Ga0163163_10000137
641 Ga0163163_10002164
642 Ga0157380_10001839
643 Ga0157380_10005598
644 Ga0157380_10020843
645 Ga0157380_10021478
646 Ga0157380_10030028
647 Ga0157377_10008726
648 Ga0157379_10009124
649 Ga0207697_10000591
650 Ga0207697_10000826
651 Ga0207697_10004514
652 Ga0207682_10000645
653 Ga0207688_10000440
654 Ga0207645_10002612
655 Ga0207645_10021268
656 Ga0207643_10001762
657 Ga0207707_10075101
658 Ga0207649_10007292
659 Ga0207681_10005936
660 Ga0207681_10008677
661 Ga0207681_10009094
662 Ga0207681_10010755
663 Ga0207681_10012244
664 Ga0207681_10023251
665 Ga0207650_10007552
666 Ga0207650_10040775
667 Ga0207659_10002197
668 Ga0207659_10002592
669 Ga0207659_10007989
670 Ga0207659_10016000
671 Ga0207659_10020362
672 Ga0207659_10030367
673 Ga0207644_10009072
674 Ga0207644_10010638
675 Ga0207706_10001140
676 Ga0207669_10000190
677 Ga0207691_10010344
678 Ga0207691_10016278
679 Ga0207691_10025575
680 Ga0207691_10042838
681 Ga0207691_10056036
682 Ga0207691_10058221
683 Ga0207711_10008835
684 Ga0207711_10011634
685 Ga0207711_10030307
686 Ga0207689_10004271
687 Ga0207689_10051057
688 Ga0207679_10022418
689 Ga0207651_10008120
690 Ga0207712_10032619
691 Ga0207658_10011338
692 Ga0207658_10015816
693 Ga0207703_10037876
694 Ga0207678_10035900
695 Ga0207708_10025698
696 Ga0207641_10016146
697 Ga0207641_10017886
698 Ga0207641_10037613
699 Ga0207648_10000720
700 Ga0207648_10018181
701 Ga0207676_10005436
702 Ga0207676_10024917
703 Ga0207674_10019459
704 Ga0207674_10023487
705 Ga0207674_10047535
706 Ga0207675_100000211
707 Ga0207675_100002489
708 Ga0207675_100010616
709 Ga0207675_100022362
710 Ga0209998_10002639
711 Ga0207428_10000005
712 Ga0207428_10000257
713 Ga0207428_10000351
714 Ga0207428_10000423
715 Ga0207428_10000972
716 Ga0207428_10001006
717 Ga0207428_10001800
718 Ga0207428_10002196
719 Ga0207428_10002702
720 Ga0207428_10003235
721 Ga0207428_10009948
722 Ga0207428_10013618
723 Ga0207428_10014281
724 Ga0207428_10015731
725 Ga0207428_10030224
726 Ga0207428_10040861
727 Ga0268265_10003607
728 Ga0268265_10004182
729 Ga0268265_10019924
730 Ga0268265_10024168
731 Ga0307408_100004366
732 Ga0307408_100035347
733 Ga0307413_10034989
734 Ga0307412_10007475
735 Ga0307412_10058240
736 Ga0307409_100005128
737 Ga0307409_100010402
738 Ga0307416_100002299
739 Ga0307411_10010023
740 Ga0307411_10010414
741 Ga0307415_100014115
742 Ga0373956_0015972
743 Ga0373943_0002410
744 Ga0373946_0006466
745 Ga0373946_0010795
746 Ga0373955_0003421
747 Ga0373955_0027329
748 Ga0373935_0020208
749 Ga0373935_0031809
750 Ga0373927_0000145
751 Ga0373933_0001008
752 Ga0373947_0000055
753 Ga0373947_0001777
754 Ga0373947_0022971
755 Ga0373937_0000109
756 Ga0373937_0000815
757 Ga0373937_0031088
758 Ga0373925_0000365
759 Ga0373925_0017209
760 Ga0373925_0022149
761 Ga0439464_0001535
762 Ga0451577_0019768
763 Ga0451576_0004572
764 Ga0451576_0023393
765 Ga0451576_0026367
766 Ga0495629_0000003
767 Ga0495629_0001411
768 Ga0495651_0003596
769 Ga0495608_0005067
770 Ga0495630_0014079
771 Ga0495666_0001308
772 Ga0495652_0011471
773 Ga0495587_0000990
774 Ga0495645_0004324
775 Ga0495622_0002326
776 Ga0495656_0002217
777 Ga0495658_0000712
778 Ga0495613_0003920
779 Ga0495613_0009465
780 Ga0495613_0041797
781 Ga0495604_0018461
782 Ga0495680_0005856
783 Ga0495675_0001885
784 Ga0495675_0003908
785 Ga0495684_0000311
786 Ga0495602_0001780
787 Ga0495602_0038618
788 Ga0496101_0000851
789 Ga0496104_0016370
790 Ga0496104_0035724
791 Ga0496105_0067409
792 Ga0496111_0023545
793 Ga0496112_0003246
794 Ga0496112_0039060
795 Ga0496112_0082319
796 Ga0496114_0002424
797 Ga0496114_0057008
798 Ga0501032_0036719
799 Ga0501033_0002360
800 Ga0501034_0016417
801 Ga0501036_0011529
802 Ga0501037_0008139
803 Ga0501037_0045842
804 Ga0501038_0020699
805 Ga0501039_0038327
806 Ga0501040_0001271
807 Ga0501040_0015989
808 Ga0501041_0008828
809 Ga0501042_0017866
810 Ga0501042_0040555
811 Ga0501043_0008789
812 Ga0501046_0010236
813 Ga0501046_0015414
814 Ga0501046_0069188
815 Ga0501048_0016870
816 Ga0501071_0011106
817 Ga0501071_0023293
818 Ga0501071_0043411
819 Ga0501072_0019279
820 Ga0501072_0033436
821 Ga0501072_0048444
822 Ga0501075_0012034
823 Ga0501075_0014721
824 Ga0501075_0020946
825 Ga0501076_0007881
826 Ga0501076_0030767
827 Ga0501079_0015083
828 Ga0501079_0019835
829 Ga0501079_0033010
830 Ga0501079_0053301
831 Ga0501080_0032983
832 Ga0501081_0002165
833 Ga0501081_0009506
834 Ga0501083_0005398
835 Ga0501035_0006170
836 Ga0501045_0004383
837 nmdc:mga0yw44_2418_c1
838 nmdc:mga0k408_1295_c1
839 nmdc:mga06z11_3450_c1
840 nmdc:mga05p37_127086_c1
841 nmdc:mga05p37_1315_c1
842 nmdc:mga05p37_26436_c1
843 nmdc:mga05p37_34_c1
844 nmdc:mga05p37_4276_c1
845 nmdc:mga05p37_4471_c1
846 nmdc:mga05p37_487_c1
847 nmdc:mga05p37_53425_c1
848 nmdc:mga05p37_72726_c1
849 nmdc:mga05p37_75200_c1
850 nmdc:mga09592_16101_c1
851 nmdc:mga09592_19656_c1
852 nmdc:mga09592_28323_c1
853 nmdc:mga09592_32331_c1
854 nmdc:mga0qj67_5637_c1
855 nmdc:mga0qj67_70_c1
856 nmdc:mga0qj67_76209_c1
857 nmdc:mga06r32_1415_c1
858 nmdc:mga06r32_20382_c1
859 nmdc:mga06r32_30766_c1
860 nmdc:mga06r32_49162_c1
861 nmdc:mga06r32_54110_c1
862 nmdc:mga06r32_85912_c1
863 nmdc:mga08y16_10785_c1
864 nmdc:mga08y16_1091_c1
865 nmdc:mga08y16_12670_c1
866 nmdc:mga08y16_16486_c1
867 nmdc:mga08y16_17890_c1
868 nmdc:mga08y16_1798_c1
869 nmdc:mga08y16_2251_c1
870 nmdc:mga08y16_23687_c1
871 nmdc:mga08y16_24686_c1
872 nmdc:mga08y16_2722_c1
873 nmdc:mga08y16_32516_c1
874 nmdc:mga08y16_4391_c1
875 nmdc:mga08y16_5078_c1
876 nmdc:mga08y16_59093_c1
877 nmdc:mga08y16_7054_c1
878 nmdc:mga08y16_8717_c1
879 nmdc:mga08y16_9_c1
880 nmdc:mga0n895_12222_c1
881 nmdc:mga0n895_1740_c1
882 nmdc:mga0n895_2030_c1
883 nmdc:mga0n895_3188_c1
884 nmdc:mga0n895_5919_c1
885 nmdc:mga0rr50_945_c1
886 nmdc:mga08x19_5124_c1
887 nmdc:mga08x19_598_c1
888 nmdc:mga0a205_12668_c1
889 nmdc:mga0a205_176_c1
890 nmdc:mga0a205_1964_c1
891 nmdc:mga0a205_3887_c1
892 nmdc:mga0a205_7381_c1
893 Ga0495601_0006847
894 Ga0495619_0004290
895 Ga0495619_0039114
896 Ga0500645_000044
897 Ga0501084_0004434
898 Ga0501084_0022131
899 Ga0501084_0062009
900 Ga0590071_000460
901 Ga0590074_000572
902 Ga0590075_000421
903 Ga0590077_000158
904 Ga0501082_0004041
905 Ga0501082_0009923
906 Ga0530510_0002875

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07676

PD40

WD40-like Beta Propeller Repeat

879

902

0.96

PF00069

Pkinase

Protein kinase domain

82

340

0.92

PF07676

PD40

WD40-like Beta Propeller Repeat

422

447

0.85

PF07714

PK_Tyr_Ser-Thr

Protein tyrosine and serine/threonine kinase

82

340

0.83

PF07676

PD40

WD40-like Beta Propeller Repeat

478

500

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ow8-assembly1.cif.gz_A-2 crystal structure of kinase domain of pkna from mtb 0.806 3 252
2fum-assembly3.cif.gz_C catalytic domain of protein kinase pknb from mycobacterium tuberculosis in complex with mitoxantrone 0.8028 8 268
4eqm-assembly6.cif.gz_F structural analysis of staphylococcus aureus serine/threonine kinase pknb 0.8013 3 281
4eqm-assembly6.cif.gz_F structural analysis of staphylococcus aureus serine/threonine kinase pknb 0.7985 3 281
6b2q-assembly1.cif.gz_D dual inhibition of the essential protein kinases a and b in mycobacterium tuberculosis 0.7983 3 253
ID Description Score Start End Superfamily
af_P9WI63_8_98_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9528 10 91 3.30.200.20
5owqB01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9025 11 91 3.30.200.20
af_Q91ZR4_1_82_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.8863 10 91 3.30.200.20
af_Q54HS0_1_82_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.8846 11 91 3.30.200.20
af_Q54XL6_85_174_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.8818 8 90 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A838GTA6-F1-model_v4 deleted 0.9637 576 838
AF-A0A2V6NLU3-F1-model_v4 Protein kinase 0.9513 1 107 GO:0004674
GO:0005524
AF-A0A7V1I3V7-F1-model_v4 Tol-Pal system beta propeller repeat protein TolB 0.9327 593 678 GO:0006508
AF-A0A2V9WX32-F1-model_v4 Uncharacterized protein 0.9326 620 838
AF-A0A849QR78-F1-model_v4 DUF5050 domain-containing protein 0.9315 603 711 GO:0016020

Map