F448120

General Info

Members Datasets Scaffolds Average Seq Length
458 240 916 152

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10225435|Ga0065715_102254351
Length 176
Sequence MRCFQCSARNLNLTLETQTMAAPRIRTDVQVMFFDTDCGGVVSNIAYLRFIEIARTHLAEELGLGLVEMAEKQTYPVVVRTEIDYRRAAKLGDRLVIEGWLDQVDRARFWCGFRITRPKDEVLIATCRQMLALVEMPSGKLLRLPEHWEEYRKGDSPQYPKGERQIGIVSGEKRIG

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
161 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
176 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
177 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
178 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
179 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
180 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
181 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
182 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
205 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
206 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
238 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 10.48
Rhizosphere 88.43
Stem 0
Stem Tuber 0
Unclassified 45.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10225435 3300005293 Unclassified 1254
2 SwRhRL2b_contig_1281604 2162886007 Bacteria 1082
3 JGI25404J52841_10027612 3300003659 Bacteria 1220
4 Ga0065704_10124424 3300005289 Bacteria 1718
5 Ga0065712_10003122 3300005290 Unclassified 3918
6 Ga0065712_10265798 3300005290 Unclassified 926
7 Ga0065715_10003886 3300005293 Bacteria 10812
8 Ga0065715_10004265 3300005293 Unclassified 3922
9 Ga0065715_10098700 3300005293 Unclassified 3506
10 Ga0065715_10453091 3300005293 Bacteria 824
11 Ga0065715_10712326 3300005293 Unclassified 647
12 Ga0065707_10060832 3300005295 Bacteria 747
13 Ga0065707_10370734 3300005295 Unclassified 888
14 Ga0070658_10229975 3300005327 Bacteria 1570
15 Ga0070676_10170480 3300005328 Unclassified 1407
16 Ga0070683_100020164 3300005329 Bacteria 5930
17 Ga0070690_100248268 3300005330 Archaea 1258
18 Ga0070690_101032064 3300005330 Unclassified 649
19 Ga0070670_100873091 3300005331 Unclassified 814
20 Ga0068869_100450993 3300005334 Bacteria 1066
21 Ga0070666_10126157 3300005335 Bacteria 1777
22 Ga0070666_10417322 3300005335 Unclassified 966
23 Ga0070680_100025811 3300005336 Bacteria 4698
24 Ga0070682_100022437 3300005337 Unclassified 3739
25 Ga0068868_100085286 3300005338 Unclassified 2538
26 Ga0070660_100048269 3300005339 Unclassified 3269
27 Ga0070660_100676394 3300005339 Bacteria 865
28 Ga0070689_100025093 3300005340 Bacteria 4476
29 Ga0070689_100035724 3300005340 Unclassified 3798
30 Ga0070689_100095458 3300005340 Unclassified 2348
31 Ga0070661_100028746 3300005344 Bacteria 4011
32 Ga0070661_100523786 3300005344 Bacteria 951
33 Ga0070668_100019131 3300005347 Bacteria 5150
34 Ga0070668_100165533 3300005347 Unclassified 1797
35 Ga0070675_100019544 3300005354 Bacteria 5400
36 Ga0070675_100030173 3300005354 Unclassified 4375
37 Ga0070675_100401712 3300005354 Unclassified 1222
38 Ga0070671_100001884 3300005355 Bacteria 16030
39 Ga0070671_100169588 3300005355 Unclassified 1846
40 Ga0070671_100190645 3300005355 Unclassified 1737
41 Ga0070671_100201673 3300005355 Bacteria 1687
42 Ga0070674_100894579 3300005356 Unclassified 773
43 Ga0070673_100051546 3300005364 Bacteria 3224
44 Ga0070673_100083985 3300005364 Unclassified 2588
45 Ga0070688_100007666 3300005365 Bacteria 5829
46 Ga0070688_100118759 3300005365 Bacteria 1768
47 Ga0070688_100289163 3300005365 Unclassified 1180
48 Ga0070688_100621281 3300005365 Viruses 829
49 Ga0070659_100015139 3300005366 Bacteria 5769
50 Ga0070659_100472668 3300005366 Bacteria 1066
51 Ga0070667_100042741 3300005367 Bacteria 3803
52 Ga0070667_100113988 3300005367 Unclassified 2347
53 Ga0070667_100443233 3300005367 Bacteria 1186
54 Ga0070709_10012964 3300005434 Unclassified 4675
55 Ga0070714_100069942 3300005435 Unclassified 3033
56 Ga0070714_100131253 3300005435 Unclassified 2239
57 Ga0070713_100032759 3300005436 Unclassified 4155
58 Ga0070713_100193511 3300005436 Bacteria 1834
59 Ga0070713_100907336 3300005436 Bacteria 848
60 Ga0070710_10038639 3300005437 Bacteria 2622
61 Ga0070711_100043709 3300005439 Unclassified 3036
62 Ga0070705_100149021 3300005440 Unclassified 1550
63 Ga0070705_100284083 3300005440 Unclassified 1178
64 Ga0070708_100284887 3300005445 Bacteria 1555
65 Ga0070663_100006749 3300005455 Bacteria 6933
66 Ga0070663_100306573 3300005455 Bacteria 1273
67 Ga0070678_100141419 3300005456 Bacteria 1926
68 Ga0070678_100191560 3300005456 Bacteria 1681
69 Ga0070678_100191619 3300005456 Bacteria 1681
70 Ga0070681_10018351 3300005458 Bacteria 6991
71 Ga0068867_100207402 3300005459 Bacteria 1572
72 Ga0068867_100718154 3300005459 Unclassified 883
73 Ga0068867_101561135 3300005459 Unclassified 616
74 Ga0070685_10050979 3300005466 Bacteria 2393
75 Ga0070685_10197491 3300005466 Bacteria 1306
76 Ga0070706_100160358 3300005467 Unclassified 2100
77 Ga0070707_100289012 3300005468 Unclassified 1593
78 Ga0070707_101312436 3300005468 Unclassified 690
79 Ga0070698_100663570 3300005471 Bacteria 984
80 Ga0070699_100361579 3300005518 Bacteria 1308
81 Ga0070699_100517336 3300005518 Unclassified 1085
82 Ga0070679_100122208 3300005530 Unclassified 2588
83 Ga0070679_101649857 3300005530 Unclassified 589
84 Ga0070684_100009698 3300005535 Bacteria 7596
85 Ga0070684_100113001 3300005535 Bacteria 2437
86 Ga0070684_100119156 3300005535 Bacteria 2373
87 Ga0070684_100324359 3300005535 Bacteria 1415
88 Ga0070684_101296371 3300005535 Viruses 685
89 Ga0070697_100015497 3300005536 Bacteria 5984
90 Ga0070697_100129219 3300005536 Unclassified 2118
91 Ga0070697_100347026 3300005536 Bacteria 1281
92 Ga0068853_100379874 3300005539 Unclassified 1319
93 Ga0070672_100944398 3300005543 Bacteria 763
94 Ga0070686_100174006 3300005544 Unclassified 1525
95 Ga0070686_100289198 3300005544 Bacteria 1212
96 Ga0070665_100026191 3300005548 Bacteria 5872
97 Ga0070665_100036501 3300005548 Unclassified 4944
98 Ga0070665_100083199 3300005548 Unclassified 3205
99 Ga0070665_100124870 3300005548 Bacteria 2576
100 Ga0070665_100196440 3300005548 Unclassified 2018
101 Ga0070704_100005200 3300005549 Bacteria 7569
102 Ga0070664_100080569 3300005564 Unclassified 2805
103 Ga0070664_100590046 3300005564 Bacteria 1030
104 Ga0068854_100435752 3300005578 Unclassified 1091
105 Ga0068856_100012418 3300005614 Bacteria 8247
106 Ga0070702_100332375 3300005615 Unclassified 1063
107 Ga0068852_101173753 3300005616 Unclassified 789
108 Ga0068864_100087170 3300005618 Unclassified 2748
109 Ga0068864_100828007 3300005618 Bacteria 911
110 Ga0068861_100416616 3300005719 Unclassified 1196
111 Ga0068863_100008058 3300005841 Bacteria 10289
112 Ga0068863_100035933 3300005841 Unclassified 4719
113 Ga0068863_100141932 3300005841 Bacteria 2296
114 Ga0068863_100282768 3300005841 Unclassified 1607
115 Ga0068858_100032263 3300005842 Unclassified 4865
116 Ga0068858_100055735 3300005842 Bacteria 3654
117 Ga0068858_100614501 3300005842 Bacteria 1055
118 Ga0068858_101227375 3300005842 Unclassified 737
119 Ga0068860_100014380 3300005843 Bacteria 7756
120 Ga0068860_100546093 3300005843 Unclassified 1161
121 Ga0081455_10001819 3300005937 Bacteria 25669
122 Ga0081455_10037765 3300005937 Bacteria 4283
123 Ga0081455_10151967 3300005937 Unclassified 1784
124 Ga0081540_1000010 3300005983 Bacteria 193206
125 Ga0081540_1031197 3300005983 Bacteria 2935
126 Ga0081539_10000511 3300005985 Bacteria 80587
127 Ga0081539_10100985 3300005985 Bacteria 1470
128 Ga0081539_10131985 3300005985 Bacteria 1225
129 Ga0070717_10027967 3300006028 Unclassified 4509
130 Ga0070717_10080950 3300006028 Bacteria 2726
131 Ga0070717_10322841 3300006028 Bacteria 1376
132 Ga0070717_10413842 3300006028 Bacteria 1212
133 Ga0075364_10408761 3300006051 Bacteria 926
134 Ga0070715_10023946 3300006163 Unclassified 2398
135 Ga0070716_100094150 3300006173 Unclassified 1820
136 Ga0070716_100830183 3300006173 Unclassified 718
137 Ga0070712_100050533 3300006175 Unclassified 2892
138 Ga0070712_100112702 3300006175 Bacteria 2032
139 Ga0070712_100164135 3300006175 Bacteria 1718
140 Ga0070712_101036664 3300006175 Unclassified 711
141 Ga0070712_101575742 3300006175 Unclassified 574
142 Ga0097621_100065202 3300006237 Bacteria 2996
143 Ga0097621_100258982 3300006237 Bacteria 1525
144 Ga0097621_100365659 3300006237 Bacteria 1286
145 Ga0097621_100745264 3300006237 Bacteria 904
146 Ga0068871_100009471 3300006358 Bacteria 7061
147 Ga0068871_100100796 3300006358 Bacteria 2419
148 Ga0068871_100166535 3300006358 Bacteria 1887
149 Ga0075428_100110565 3300006844 Unclassified 2994
150 Ga0075433_10349337 3300006852 Unclassified 1307
151 Ga0075433_10419691 3300006852 Unclassified 1180
152 Ga0075434_100225182 3300006871 Bacteria 1895
153 Ga0075434_100247542 3300006871 Bacteria 1802
154 Ga0068865_100310076 3300006881 Bacteria 1266
155 Ga0099795_10087648 3300007788 Bacteria 1202
156 Ga0111539_10257025 3300009094 Bacteria 2034
157 Ga0111539_10876216 3300009094 Unclassified 1044
158 Ga0111539_11073444 3300009094 Unclassified 936
159 Ga0105245_10100512 3300009098 Unclassified 2675
160 Ga0105245_10447147 3300009098 Unclassified 1300
161 Ga0105245_10667721 3300009098 Unclassified 1070
162 Ga0105247_10216997 3300009101 Archaea 1293
163 Ga0114129_10081723 3300009147 Unclassified 4491
164 Ga0114129_10101962 3300009147 Bacteria 3970
165 Ga0105243_10336123 3300009148 Unclassified 1382
166 Ga0105241_10375313 3300009174 Bacteria 1241
167 Ga0105242_11029466 3300009176 Bacteria 833
168 Ga0105242_11299457 3300009176 Unclassified 751
169 Ga0105248_10139466 3300009177 Bacteria 2735
170 Ga0105248_10359696 3300009177 Bacteria 1639
171 Ga0105238_10543948 3300009551 Bacteria 1165
172 Ga0105249_10008559 3300009553 Bacteria 8921
173 Ga0105249_10048298 3300009553 Unclassified 3880
174 Ga0105239_10115461 3300010375 Unclassified 2978
175 Ga0105239_10182403 3300010375 Bacteria 2349
176 Ga0105239_10413663 3300010375 Unclassified 1527
177 Ga0105239_12027392 3300010375 Bacteria 668
178 Ga0105246_10086197 3300011119 Unclassified 2251
179 Ga0157326_1063861 3300012513 Unclassified 569
180 Ga0157371_10099309 3300013102 Bacteria 2064
181 Ga0157369_10745843 3300013105 Bacteria 1007
182 Ga0157374_10075564 3300013296 Bacteria 3183
183 Ga0157374_10099171 3300013296 Bacteria 2790
184 Ga0157378_10016400 3300013297 Bacteria 6486
185 Ga0157378_10394266 3300013297 Unclassified 1362
186 Ga0157378_10464888 3300013297 Bacteria 1258
187 Ga0157378_10903369 3300013297 Unclassified 914
188 Ga0157378_11183086 3300013297 Unclassified 804
189 Ga0157378_12668432 3300013297 Unclassified 552
190 Ga0163162_10827105 3300013306 Unclassified 1042
191 Ga0163162_11182592 3300013306 Viruses 867
192 Ga0157372_10010274 3300013307 Bacteria 9943
193 Ga0157372_10280447 3300013307 Bacteria 1937
194 Ga0157375_10013261 3300013308 Bacteria 7329
195 Ga0157375_10016088 3300013308 Bacteria 6710
196 Ga0157375_10285284 3300013308 Bacteria 1814
197 Ga0157375_11061492 3300013308 Unclassified 947
198 Ga0157375_13178956 3300013308 Unclassified 548
199 Ga0163163_10090820 3300014325 Bacteria 3068
200 Ga0163163_11275589 3300014325 Bacteria 797
201 Ga0182008_10008039 3300014497 Bacteria 5781
202 Ga0157377_10657194 3300014745 Unclassified 755
203 Ga0157379_10021223 3300014968 Bacteria 5747
204 Ga0157379_10139995 3300014968 Unclassified 2181
205 Ga0157379_11380401 3300014968 Bacteria 682
206 Ga0157376_10011998 3300014969 Bacteria 6411
207 Ga0157376_10271513 3300014969 Unclassified 1593
208 Ga0157376_10479463 3300014969 Bacteria 1219
209 Ga0157376_10703236 3300014969 Bacteria 1016
210 Ga0207666_1000363 3300025271 Bacteria 6134
211 Ga0207666_1016957 3300025271 Unclassified 1048
212 Ga0207673_1000376 3300025290 Unclassified 4531
213 Ga0207697_10001283 3300025315 Bacteria 13782
214 Ga0207697_10003358 3300025315 Bacteria 7959
215 Ga0207697_10013470 3300025315 Unclassified 3411
216 Ga0207697_10041726 3300025315 Unclassified 1884
217 Ga0207697_10105560 3300025315 Bacteria 1203
218 Ga0207697_10236634 3300025315 Unclassified 807
219 Ga0207710_10088658 3300025900 Unclassified 1445
220 Ga0207680_10016649 3300025903 Bacteria 3865
221 Ga0207680_10247415 3300025903 Bacteria 1230
222 Ga0207680_10634308 3300025903 Unclassified 765
223 Ga0207647_10030213 3300025904 Unclassified 3498
224 Ga0207685_10024724 3300025905 Unclassified 2064
225 Ga0207685_10292917 3300025905 Unclassified 803
226 Ga0207645_10021751 3300025907 Unclassified 4179
227 Ga0207645_10103797 3300025907 Unclassified 1836
228 Ga0207705_10265936 3300025909 Bacteria 1310
229 Ga0207707_10057620 3300025912 Bacteria 3381
230 Ga0207695_10000061 3300025913 Bacteria 359827
231 Ga0207693_10019976 3300025915 Bacteria 5328
232 Ga0207693_10081867 3300025915 Unclassified 2528
233 Ga0207693_10134209 3300025915 Bacteria 1946
234 Ga0207693_10249343 3300025915 Bacteria 1393
235 Ga0207663_10192504 3300025916 Bacteria 1465
236 Ga0207663_11043309 3300025916 Unclassified 656
237 Ga0207660_10186775 3300025917 Bacteria 1612
238 Ga0207662_10256639 3300025918 Bacteria 1149
239 Ga0207657_10046769 3300025919 Unclassified 3789
240 Ga0207657_10151230 3300025919 Bacteria 1891
241 Ga0207649_10093161 3300025920 Unclassified 1976
242 Ga0207649_10146971 3300025920 Unclassified 1619
243 Ga0207646_10214895 3300025922 Bacteria 1737
244 Ga0207646_10242637 3300025922 Bacteria 1628
245 Ga0207646_10310774 3300025922 Bacteria 1424
246 Ga0207681_11400432 3300025923 Unclassified 587
247 Ga0207650_10034759 3300025925 Bacteria 3657
248 Ga0207650_10210497 3300025925 Unclassified 1561
249 Ga0207659_10057631 3300025926 Unclassified 2786
250 Ga0207659_10084764 3300025926 Unclassified 2352
251 Ga0207659_10148709 3300025926 Bacteria 1827
252 Ga0207687_10088631 3300025927 Bacteria 2251
253 Ga0207700_10000553 3300025928 Bacteria 21988
254 Ga0207700_11176847 3300025928 Bacteria 685
255 Ga0207664_10050357 3300025929 Unclassified 3284
256 Ga0207664_10136406 3300025929 Unclassified 2071
257 Ga0207644_10339844 3300025931 Unclassified 1217
258 Ga0207644_10389258 3300025931 Unclassified 1138
259 Ga0207644_10853378 3300025931 Bacteria 762
260 Ga0207706_10105581 3300025933 Bacteria 2478
261 Ga0207686_10140081 3300025934 Bacteria 1671
262 Ga0207709_10394864 3300025935 Bacteria 1056
263 Ga0207670_10007600 3300025936 Bacteria 6061
264 Ga0207670_10049538 3300025936 Bacteria 2811
265 Ga0207670_10104198 3300025936 Unclassified 2031
266 Ga0207669_10148672 3300025937 Unclassified 1638
267 Ga0207704_11165398 3300025938 Unclassified 656
268 Ga0207665_10016868 3300025939 Unclassified 4796
269 Ga0207665_10421939 3300025939 Bacteria 1019
270 Ga0207691_10068059 3300025940 Unclassified 3218
271 Ga0207691_10295087 3300025940 Unclassified 1394
272 Ga0207711_10963495 3300025941 Unclassified 792
273 Ga0207689_10387399 3300025942 Unclassified 1164
274 Ga0207661_10021287 3300025944 Bacteria 4857
275 Ga0207661_10070636 3300025944 Unclassified 2851
276 Ga0207651_10043246 3300025960 Bacteria 3005
277 Ga0207651_10044059 3300025960 Unclassified 2983
278 Ga0207712_10021414 3300025961 Unclassified 4244
279 Ga0207712_10023403 3300025961 Bacteria 4076
280 Ga0207668_10122127 3300025972 Unclassified 1974
281 Ga0207668_10228652 3300025972 Bacteria 1498
282 Ga0207640_10668044 3300025981 Unclassified 887
283 Ga0207658_10456149 3300025986 Bacteria 1132
284 Ga0207658_10477463 3300025986 Unclassified 1107
285 Ga0207677_10691100 3300026023 Bacteria 904
286 Ga0207703_10008636 3300026035 Bacteria 8038
287 Ga0207703_10684305 3300026035 Bacteria 975
288 Ga0207678_10020287 3300026067 Bacteria 5832
289 Ga0207678_10312228 3300026067 Bacteria 1352
290 Ga0207678_10779943 3300026067 Unclassified 843
291 Ga0207708_10075359 3300026075 Unclassified 2587
292 Ga0207702_10214120 3300026078 Bacteria 1792
293 Ga0207641_10052667 3300026088 Unclassified 3448
294 Ga0207641_11357434 3300026088 Unclassified 712
295 Ga0207641_11583962 3300026088 Unclassified 657
296 Ga0207676_10033913 3300026095 Unclassified 3862
297 Ga0207676_10706955 3300026095 Unclassified 977
298 Ga0207675_100073818 3300026118 Bacteria 3191
299 Ga0207683_10190974 3300026121 Bacteria 1859
300 Ga0207683_10192008 3300026121 Bacteria 1854
301 Ga0209179_1041031 3300027512 Bacteria 974
302 Ga0210002_1030487 3300027617 Unclassified 895
303 Ga0268266_10034703 3300028379 Unclassified 4290
304 Ga0268266_10138494 3300028379 Unclassified 2182
305 Ga0268266_10325467 3300028379 Unclassified 1440
306 Ga0268265_11355265 3300028380 Unclassified 713
307 Ga0268265_11397424 3300028380 Unclassified 702
308 Ga0268264_10023684 3300028381 Bacteria 5006
309 Ga0268264_10043378 3300028381 Unclassified 3727
310 Ga0373934_0056397 3300035086 Bacteria 1563
311 Ga0373923_0301459 3300035111 Unclassified 758
312 Ga0373923_0314105 3300035111 Unclassified 743
313 Ga0373936_0346943 3300035113 Unclassified 675
314 Ga0373936_0419893 3300035113 Unclassified 616
315 Ga0373945_0331752 3300035116 Unclassified 657
316 Ga0373953_0095794 3300035117 Unclassified 1245
317 Ga0373943_0070342 3300035170 Bacteria 1771
318 Ga0373943_0387202 3300035170 Bacteria 806
319 Ga0373946_0215569 3300035171 Bacteria 925
320 Ga0373946_0223358 3300035171 Bacteria 910
321 Ga0373955_0441538 3300035172 Bacteria 793
322 Ga0373955_0725487 3300035172 Unclassified 610
323 Ga0373942_0266125 3300035207 Unclassified 587
324 Ga0373935_0035970 3300035692 Bacteria 3093
325 Ga0373935_0266186 3300035692 Unclassified 1203
326 Ga0373927_0643397 3300035695 Unclassified 701
327 Ga0373947_0088116 3300035725 Unclassified 1931
328 Ga0373947_0226007 3300035725 Bacteria 1232
329 Ga0373947_0350596 3300035725 Unclassified 990
330 Ga0373947_0647703 3300035725 Unclassified 720
331 Ga0373937_0119692 3300036401 Bacteria 2453
332 Ga0373937_0430871 3300036401 Unclassified 1252
333 Ga0373937_0532862 3300036401 Bacteria 1116
334 Ga0373925_0067270 3300037068 Bacteria 2702
335 Ga0373925_0229111 3300037068 Bacteria 1485
336 Ga0395900_0160978 3300037418 Bacteria 2289
337 Ga0395900_0409784 3300037418 Bacteria 1318
338 Ga0395898_0138172 3300037466 Bacteria 2333
339 Ga0395905_0079727 3300037471 Bacteria 3069
340 Ga0395901_0064523 3300038443 Unclassified 3812
341 Ga0451807_2543954 3300041486 Bacteria 971
342 Ga0451833_0586111 3300041491 Bacteria 589
343 Ga0451839_1229292 3300041496 Unclassified 511
344 Ga0451849_0939203 3300041505 Bacteria 587
345 Ga0451853_0735220 3300041512 Bacteria 1047
346 Ga0439448_0168866 3300042005 Unclassified 763
347 Ga0439464_0003465 3300042439 Unclassified 3981
348 Ga0439460_0130896 3300042461 Unclassified 827
349 Ga0451576_0839190 3300045051 Unclassified 965
350 Ga0466967_0095176 3300045976 Unclassified 2714
351 Ga0466967_1029112 3300045976 Unclassified 820
352 Ga0495592_0013392 3300046454 Bacteria 6241
353 Ga0495629_0335621 3300046459 Bacteria 1032
354 Ga0495641_0055038 3300046461 Unclassified 1807
355 Ga0495651_0268890 3300046462 Unclassified 1157
356 Ga0495653_0344459 3300046463 Bacteria 960
357 Ga0495653_0678986 3300046463 Unclassified 627
358 Ga0495662_0094534 3300046476 Bacteria 1460
359 Ga0495664_0431492 3300046477 Bacteria 790
360 Ga0495618_0157619 3300046514 Bacteria 1448
361 Ga0495628_0013312 3300046516 Bacteria 6920
362 Ga0495628_0485792 3300046516 Bacteria 893
363 Ga0495630_0036344 3300046517 Bacteria 3682
364 Ga0495666_0512490 3300046526 Unclassified 536
365 Ga0495652_0039360 3300046529 Bacteria 4088
366 Ga0495665_0464573 3300046531 Unclassified 639
367 Ga0495586_0059522 3300046535 Unclassified 2075
368 Ga0495587_0019137 3300046536 Bacteria 4241
369 Ga0495587_0570245 3300046536 Unclassified 624
370 Ga0495645_0010072 3300046543 Bacteria 6623
371 Ga0495645_0811821 3300046543 Unclassified 560
372 Ga0495633_0164963 3300046558 Unclassified 1022
373 Ga0495667_0131866 3300046559 Bacteria 1612
374 Ga0495667_0173312 3300046559 Bacteria 1386
375 Ga0495634_0086582 3300046642 Unclassified 2040
376 Ga0495657_0090822 3300046675 Bacteria 1960
377 Ga0495657_0629430 3300046675 Bacteria 620
378 Ga0495599_0778187 3300046678 Unclassified 548
379 Ga0495623_0080211 3300046679 Bacteria 2020
380 Ga0495623_0165935 3300046679 Bacteria 1294
381 Ga0495646_0011787 3300046680 Bacteria 5559
382 Ga0495669_0113701 3300046684 Bacteria 1265
383 Ga0495613_0193213 3300046689 Bacteria 1438
384 Ga0495624_0559669 3300046690 Unclassified 683
385 Ga0495581_0783145 3300047315 Unclassified 548
386 Ga0495674_0199957 3300047319 Bacteria 1658
387 Ga0495674_0585250 3300047319 Unclassified 885
388 Ga0495674_0843831 3300047319 Bacteria 710
389 Ga0495680_0510544 3300047322 Unclassified 815
390 Ga0495675_0081708 3300047444 Unclassified 2035
391 Ga0495675_0567983 3300047444 Unclassified 646
392 Ga0495684_0020451 3300047471 Bacteria 5101
393 Ga0495684_0440240 3300047471 Bacteria 908
394 Ga0495602_0039071 3300048088 Bacteria 4376
395 Ga0495602_0407239 3300048088 Bacteria 969
396 Ga0495602_0682792 3300048088 Unclassified 698
397 Ga0496100_0056819 3300048903 Bacteria 2561
398 Ga0496100_0132036 3300048903 Bacteria 1760
399 Ga0496100_0323626 3300048903 Bacteria 1159
400 Ga0496100_1539902 3300048903 Unclassified 525
401 Ga0496101_0094507 3300048904 Bacteria 2228
402 Ga0496101_0186622 3300048904 Bacteria 1599
403 Ga0496101_0651233 3300048904 Unclassified 832
404 Ga0496101_0757867 3300048904 Unclassified 766
405 Ga0496102_0024133 3300048905 Bacteria 5405
406 Ga0496102_0275615 3300048905 Bacteria 1585
407 Ga0496102_0885390 3300048905 Bacteria 815
408 Ga0496103_0112866 3300048906 Unclassified 1727
409 Ga0496103_0173249 3300048906 Bacteria 1386
410 Ga0496104_0043598 3300048907 Unclassified 4213
411 Ga0496104_0101717 3300048907 Unclassified 2752
412 Ga0496104_0157949 3300048907 Unclassified 2176
413 Ga0496105_0431406 3300048908 Bacteria 1042
414 Ga0496105_0773716 3300048908 Unclassified 732
415 Ga0496106_0027161 3300048909 Unclassified 4263
416 Ga0496106_0161413 3300048909 Bacteria 1773
417 Ga0496107_0391515 3300048910 Bacteria 1034
418 Ga0496108_0004565 3300048911 Bacteria 11156
419 Ga0496108_0087915 3300048911 Unclassified 2640
420 Ga0496108_1269488 3300048911 Bacteria 620
421 Ga0496109_0001915 3300048912 Bacteria 17286
422 Ga0496109_0159744 3300048912 Bacteria 2112
423 Ga0496109_0174733 3300048912 Unclassified 2016
424 Ga0496109_0660095 3300048912 Unclassified 983
425 Ga0496110_0154286 3300048913 Unclassified 2080
426 Ga0496110_0512370 3300048913 Unclassified 1092
427 Ga0496111_0547765 3300048914 Unclassified 849
428 Ga0496112_0035655 3300048915 Unclassified 4848
429 Ga0496112_0055893 3300048915 Bacteria 3883
430 Ga0496112_0176485 3300048915 Bacteria 2101
431 Ga0496112_0250801 3300048915 Bacteria 1721
432 Ga0496112_0282901 3300048915 Unclassified 1605
433 Ga0496112_0840795 3300048915 Bacteria 842
434 Ga0496112_1064592 3300048915 Unclassified 727
435 Ga0496113_0067702 3300048916 Bacteria 2708
436 Ga0496113_0170455 3300048916 Bacteria 1724
437 Ga0496113_0292463 3300048916 Bacteria 1303
438 Ga0496114_0021731 3300048917 Bacteria 5222
439 Ga0496114_0468227 3300048917 Bacteria 1115
440 Ga0496115_0002200 3300048918 Bacteria 13959
441 Ga0496115_0082495 3300048918 Bacteria 2619
442 Ga0496115_0733981 3300048918 Bacteria 774
443 Ga0496115_0815514 3300048918 Bacteria 725
444 nmdc:mga05p37_1550631_c1 3300050507 Unclassified 656
445 nmdc:mga05p37_798553_c1 3300050507 Bacteria 1033
446 nmdc:mga08y16_225236_c1 3300050511 Bacteria 1940
447 nmdc:mga08y16_238399_c1 3300050511 Bacteria 1880
448 nmdc:mga0n895_344441_c1 3300050512 Bacteria 1509
449 Ga0495601_0023016 3300053077 Bacteria 3828
450 Ga0495601_0289315 3300053077 Bacteria 1068
451 Ga0495601_0451292 3300053077 Unclassified 832
452 Ga0495612_0055532 3300053078 Unclassified 1633
453 Ga0495655_0059792 3300053083 Unclassified 1036
454 Ga0495595_0167664 3300053084 Unclassified 1086
455 Ga0495595_0201029 3300053084 Bacteria 992
456 Ga0495619_0062042 3300053085 Unclassified 2488
457 Ga0495619_0280635 3300053085 Bacteria 1154
458 Ga0495619_0860651 3300053085 Bacteria 611
459 Ga0065715_10225435
460 SwRhRL2b_contig_1281604
461 JGI25404J52841_10027612
462 Ga0065704_10124424
463 Ga0065712_10003122
464 Ga0065712_10265798
465 Ga0065715_10003886
466 Ga0065715_10004265
467 Ga0065715_10098700
468 Ga0065715_10453091
469 Ga0065715_10712326
470 Ga0065707_10060832
471 Ga0065707_10370734
472 Ga0070658_10229975
473 Ga0070676_10170480
474 Ga0070683_100020164
475 Ga0070690_100248268
476 Ga0070690_101032064
477 Ga0070670_100873091
478 Ga0068869_100450993
479 Ga0070666_10126157
480 Ga0070666_10417322
481 Ga0070680_100025811
482 Ga0070682_100022437
483 Ga0068868_100085286
484 Ga0070660_100048269
485 Ga0070660_100676394
486 Ga0070689_100025093
487 Ga0070689_100035724
488 Ga0070689_100095458
489 Ga0070661_100028746
490 Ga0070661_100523786
491 Ga0070668_100019131
492 Ga0070668_100165533
493 Ga0070675_100019544
494 Ga0070675_100030173
495 Ga0070675_100401712
496 Ga0070671_100001884
497 Ga0070671_100169588
498 Ga0070671_100190645
499 Ga0070671_100201673
500 Ga0070674_100894579
501 Ga0070673_100051546
502 Ga0070673_100083985
503 Ga0070688_100007666
504 Ga0070688_100118759
505 Ga0070688_100289163
506 Ga0070688_100621281
507 Ga0070659_100015139
508 Ga0070659_100472668
509 Ga0070667_100042741
510 Ga0070667_100113988
511 Ga0070667_100443233
512 Ga0070709_10012964
513 Ga0070714_100069942
514 Ga0070714_100131253
515 Ga0070713_100032759
516 Ga0070713_100193511
517 Ga0070713_100907336
518 Ga0070710_10038639
519 Ga0070711_100043709
520 Ga0070705_100149021
521 Ga0070705_100284083
522 Ga0070708_100284887
523 Ga0070663_100006749
524 Ga0070663_100306573
525 Ga0070678_100141419
526 Ga0070678_100191560
527 Ga0070678_100191619
528 Ga0070681_10018351
529 Ga0068867_100207402
530 Ga0068867_100718154
531 Ga0068867_101561135
532 Ga0070685_10050979
533 Ga0070685_10197491
534 Ga0070706_100160358
535 Ga0070707_100289012
536 Ga0070707_101312436
537 Ga0070698_100663570
538 Ga0070699_100361579
539 Ga0070699_100517336
540 Ga0070679_100122208
541 Ga0070679_101649857
542 Ga0070684_100009698
543 Ga0070684_100113001
544 Ga0070684_100119156
545 Ga0070684_100324359
546 Ga0070684_101296371
547 Ga0070697_100015497
548 Ga0070697_100129219
549 Ga0070697_100347026
550 Ga0068853_100379874
551 Ga0070672_100944398
552 Ga0070686_100174006
553 Ga0070686_100289198
554 Ga0070665_100026191
555 Ga0070665_100036501
556 Ga0070665_100083199
557 Ga0070665_100124870
558 Ga0070665_100196440
559 Ga0070704_100005200
560 Ga0070664_100080569
561 Ga0070664_100590046
562 Ga0068854_100435752
563 Ga0068856_100012418
564 Ga0070702_100332375
565 Ga0068852_101173753
566 Ga0068864_100087170
567 Ga0068864_100828007
568 Ga0068861_100416616
569 Ga0068863_100008058
570 Ga0068863_100035933
571 Ga0068863_100141932
572 Ga0068863_100282768
573 Ga0068858_100032263
574 Ga0068858_100055735
575 Ga0068858_100614501
576 Ga0068858_101227375
577 Ga0068860_100014380
578 Ga0068860_100546093
579 Ga0081455_10001819
580 Ga0081455_10037765
581 Ga0081455_10151967
582 Ga0081540_1000010
583 Ga0081540_1031197
584 Ga0081539_10000511
585 Ga0081539_10100985
586 Ga0081539_10131985
587 Ga0070717_10027967
588 Ga0070717_10080950
589 Ga0070717_10322841
590 Ga0070717_10413842
591 Ga0075364_10408761
592 Ga0070715_10023946
593 Ga0070716_100094150
594 Ga0070716_100830183
595 Ga0070712_100050533
596 Ga0070712_100112702
597 Ga0070712_100164135
598 Ga0070712_101036664
599 Ga0070712_101575742
600 Ga0097621_100065202
601 Ga0097621_100258982
602 Ga0097621_100365659
603 Ga0097621_100745264
604 Ga0068871_100009471
605 Ga0068871_100100796
606 Ga0068871_100166535
607 Ga0075428_100110565
608 Ga0075433_10349337
609 Ga0075433_10419691
610 Ga0075434_100225182
611 Ga0075434_100247542
612 Ga0068865_100310076
613 Ga0099795_10087648
614 Ga0111539_10257025
615 Ga0111539_10876216
616 Ga0111539_11073444
617 Ga0105245_10100512
618 Ga0105245_10447147
619 Ga0105245_10667721
620 Ga0105247_10216997
621 Ga0114129_10081723
622 Ga0114129_10101962
623 Ga0105243_10336123
624 Ga0105241_10375313
625 Ga0105242_11029466
626 Ga0105242_11299457
627 Ga0105248_10139466
628 Ga0105248_10359696
629 Ga0105238_10543948
630 Ga0105249_10008559
631 Ga0105249_10048298
632 Ga0105239_10115461
633 Ga0105239_10182403
634 Ga0105239_10413663
635 Ga0105239_12027392
636 Ga0105246_10086197
637 Ga0157326_1063861
638 Ga0157371_10099309
639 Ga0157369_10745843
640 Ga0157374_10075564
641 Ga0157374_10099171
642 Ga0157378_10016400
643 Ga0157378_10394266
644 Ga0157378_10464888
645 Ga0157378_10903369
646 Ga0157378_11183086
647 Ga0157378_12668432
648 Ga0163162_10827105
649 Ga0163162_11182592
650 Ga0157372_10010274
651 Ga0157372_10280447
652 Ga0157375_10013261
653 Ga0157375_10016088
654 Ga0157375_10285284
655 Ga0157375_11061492
656 Ga0157375_13178956
657 Ga0163163_10090820
658 Ga0163163_11275589
659 Ga0182008_10008039
660 Ga0157377_10657194
661 Ga0157379_10021223
662 Ga0157379_10139995
663 Ga0157379_11380401
664 Ga0157376_10011998
665 Ga0157376_10271513
666 Ga0157376_10479463
667 Ga0157376_10703236
668 Ga0207666_1000363
669 Ga0207666_1016957
670 Ga0207673_1000376
671 Ga0207697_10001283
672 Ga0207697_10003358
673 Ga0207697_10013470
674 Ga0207697_10041726
675 Ga0207697_10105560
676 Ga0207697_10236634
677 Ga0207710_10088658
678 Ga0207680_10016649
679 Ga0207680_10247415
680 Ga0207680_10634308
681 Ga0207647_10030213
682 Ga0207685_10024724
683 Ga0207685_10292917
684 Ga0207645_10021751
685 Ga0207645_10103797
686 Ga0207705_10265936
687 Ga0207707_10057620
688 Ga0207695_10000061
689 Ga0207693_10019976
690 Ga0207693_10081867
691 Ga0207693_10134209
692 Ga0207693_10249343
693 Ga0207663_10192504
694 Ga0207663_11043309
695 Ga0207660_10186775
696 Ga0207662_10256639
697 Ga0207657_10046769
698 Ga0207657_10151230
699 Ga0207649_10093161
700 Ga0207649_10146971
701 Ga0207646_10214895
702 Ga0207646_10242637
703 Ga0207646_10310774
704 Ga0207681_11400432
705 Ga0207650_10034759
706 Ga0207650_10210497
707 Ga0207659_10057631
708 Ga0207659_10084764
709 Ga0207659_10148709
710 Ga0207687_10088631
711 Ga0207700_10000553
712 Ga0207700_11176847
713 Ga0207664_10050357
714 Ga0207664_10136406
715 Ga0207644_10339844
716 Ga0207644_10389258
717 Ga0207644_10853378
718 Ga0207706_10105581
719 Ga0207686_10140081
720 Ga0207709_10394864
721 Ga0207670_10007600
722 Ga0207670_10049538
723 Ga0207670_10104198
724 Ga0207669_10148672
725 Ga0207704_11165398
726 Ga0207665_10016868
727 Ga0207665_10421939
728 Ga0207691_10068059
729 Ga0207691_10295087
730 Ga0207711_10963495
731 Ga0207689_10387399
732 Ga0207661_10021287
733 Ga0207661_10070636
734 Ga0207651_10043246
735 Ga0207651_10044059
736 Ga0207712_10021414
737 Ga0207712_10023403
738 Ga0207668_10122127
739 Ga0207668_10228652
740 Ga0207640_10668044
741 Ga0207658_10456149
742 Ga0207658_10477463
743 Ga0207677_10691100
744 Ga0207703_10008636
745 Ga0207703_10684305
746 Ga0207678_10020287
747 Ga0207678_10312228
748 Ga0207678_10779943
749 Ga0207708_10075359
750 Ga0207702_10214120
751 Ga0207641_10052667
752 Ga0207641_11357434
753 Ga0207641_11583962
754 Ga0207676_10033913
755 Ga0207676_10706955
756 Ga0207675_100073818
757 Ga0207683_10190974
758 Ga0207683_10192008
759 Ga0209179_1041031
760 Ga0210002_1030487
761 Ga0268266_10034703
762 Ga0268266_10138494
763 Ga0268266_10325467
764 Ga0268265_11355265
765 Ga0268265_11397424
766 Ga0268264_10023684
767 Ga0268264_10043378
768 Ga0373934_0056397
769 Ga0373923_0301459
770 Ga0373923_0314105
771 Ga0373936_0346943
772 Ga0373936_0419893
773 Ga0373945_0331752
774 Ga0373953_0095794
775 Ga0373943_0070342
776 Ga0373943_0387202
777 Ga0373946_0215569
778 Ga0373946_0223358
779 Ga0373955_0441538
780 Ga0373955_0725487
781 Ga0373942_0266125
782 Ga0373935_0035970
783 Ga0373935_0266186
784 Ga0373927_0643397
785 Ga0373947_0088116
786 Ga0373947_0226007
787 Ga0373947_0350596
788 Ga0373947_0647703
789 Ga0373937_0119692
790 Ga0373937_0430871
791 Ga0373937_0532862
792 Ga0373925_0067270
793 Ga0373925_0229111
794 Ga0395900_0160978
795 Ga0395900_0409784
796 Ga0395898_0138172
797 Ga0395905_0079727
798 Ga0395901_0064523
799 Ga0451807_2543954
800 Ga0451833_0586111
801 Ga0451839_1229292
802 Ga0451849_0939203
803 Ga0451853_0735220
804 Ga0439448_0168866
805 Ga0439464_0003465
806 Ga0439460_0130896
807 Ga0451576_0839190
808 Ga0466967_0095176
809 Ga0466967_1029112
810 Ga0495592_0013392
811 Ga0495629_0335621
812 Ga0495641_0055038
813 Ga0495651_0268890
814 Ga0495653_0344459
815 Ga0495653_0678986
816 Ga0495662_0094534
817 Ga0495664_0431492
818 Ga0495618_0157619
819 Ga0495628_0013312
820 Ga0495628_0485792
821 Ga0495630_0036344
822 Ga0495666_0512490
823 Ga0495652_0039360
824 Ga0495665_0464573
825 Ga0495586_0059522
826 Ga0495587_0019137
827 Ga0495587_0570245
828 Ga0495645_0010072
829 Ga0495645_0811821
830 Ga0495633_0164963
831 Ga0495667_0131866
832 Ga0495667_0173312
833 Ga0495634_0086582
834 Ga0495657_0090822
835 Ga0495657_0629430
836 Ga0495599_0778187
837 Ga0495623_0080211
838 Ga0495623_0165935
839 Ga0495646_0011787
840 Ga0495669_0113701
841 Ga0495613_0193213
842 Ga0495624_0559669
843 Ga0495581_0783145
844 Ga0495674_0199957
845 Ga0495674_0585250
846 Ga0495674_0843831
847 Ga0495680_0510544
848 Ga0495675_0081708
849 Ga0495675_0567983
850 Ga0495684_0020451
851 Ga0495684_0440240
852 Ga0495602_0039071
853 Ga0495602_0407239
854 Ga0495602_0682792
855 Ga0496100_0056819
856 Ga0496100_0132036
857 Ga0496100_0323626
858 Ga0496100_1539902
859 Ga0496101_0094507
860 Ga0496101_0186622
861 Ga0496101_0651233
862 Ga0496101_0757867
863 Ga0496102_0024133
864 Ga0496102_0275615
865 Ga0496102_0885390
866 Ga0496103_0112866
867 Ga0496103_0173249
868 Ga0496104_0043598
869 Ga0496104_0101717
870 Ga0496104_0157949
871 Ga0496105_0431406
872 Ga0496105_0773716
873 Ga0496106_0027161
874 Ga0496106_0161413
875 Ga0496107_0391515
876 Ga0496108_0004565
877 Ga0496108_0087915
878 Ga0496108_1269488
879 Ga0496109_0001915
880 Ga0496109_0159744
881 Ga0496109_0174733
882 Ga0496109_0660095
883 Ga0496110_0154286
884 Ga0496110_0512370
885 Ga0496111_0547765
886 Ga0496112_0035655
887 Ga0496112_0055893
888 Ga0496112_0176485
889 Ga0496112_0250801
890 Ga0496112_0282901
891 Ga0496112_0840795
892 Ga0496112_1064592
893 Ga0496113_0067702
894 Ga0496113_0170455
895 Ga0496113_0292463
896 Ga0496114_0021731
897 Ga0496114_0468227
898 Ga0496115_0002200
899 Ga0496115_0082495
900 Ga0496115_0733981
901 Ga0496115_0815514
902 nmdc:mga05p37_1550631_c1
903 nmdc:mga05p37_798553_c1
904 nmdc:mga08y16_225236_c1
905 nmdc:mga08y16_238399_c1
906 nmdc:mga0n895_344441_c1
907 Ga0495601_0023016
908 Ga0495601_0289315
909 Ga0495601_0451292
910 Ga0495612_0055532
911 Ga0495655_0059792
912 Ga0495595_0167664
913 Ga0495595_0201029
914 Ga0495619_0062042
915 Ga0495619_0280635
916 Ga0495619_0860651

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13279

4HBT_2

Thioesterase-like superfamily

31

150

0.97

PF03061

4HBT

Thioesterase superfamily

39

124

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tyt-assembly1.cif.gz_B crystal and molecular structure of crithidia fasciculata trypanothione reductase at 2.6 angstroms resolution 0.8228 62 98
1typ-assembly1.cif.gz_B substrate interactions between trypanothione reductase and n1-glutathionylspermidine disulphide at 0.28-nm resolution 0.7769 62 98
2h4u-assembly1.cif.gz_D crystal structure of human thioesterase superfamily member 2 0.7319 46 103
4ord-assembly1.cif.gz_A crystal structure of zebra fish thioesterase superfamily member 2 0.7311 46 103
2h4u-assembly1.cif.gz_A crystal structure of human thioesterase superfamily member 2 0.7264 46 103
ID Description Score Start End Superfamily
af_A0A0A8P3N1_23_166_2.60.40.770 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8883 77 103 2.60.40.770
af_O02106_45_230_2.70.220.10 Mainly Beta;Distorted Sandwich;Ganglioside M2 Activator Protein; Chain: A,;Ganglioside GM2 activator 0.7864 77 103 2.70.220.10
af_A0A0R4IY13_78_434_3.30.497.10 Alpha Beta;2-Layer Sandwich;Antithrombin; Chain I, domain 2;Antithrombin, subunit I, domain 2 0.7718 79 97 3.30.497.10
1zkiB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.744 43 103 3.10.129.10
1yqzA03 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;FAD/NAD-linked reductase, C-terminal dimerisation domain 0.7418 49 99 3.30.390.30
ID Description Score Start End GO Terms
AF-A0A4Q9NGY3-F1-model_v4 deleted 0.7359 8 106
AF-A0A1Y1NBY9-F1-model_v4 Thioesterase domain-containing protein 0.7128 43 103 GO:0047617
AF-A0A2G5BJY0-F1-model_v4 Thioesterase domain-containing protein 0.7053 9 100
AF-A0A7J6ZRD5-F1-model_v4 deleted 0.7014 45 105
AF-A0A397XJ30-F1-model_v4 Acyl-[acyl-carrier-protein] hydrolase (EC 3.1.2.-) 0.6974 38 114 GO:0006633
GO:0009507
GO:0016297

Map