F448112

General Info

Members Datasets Scaffolds Average Seq Length
458 185 916 153

Family's Representative Sequence

Representative Sequence 3300001991|JGI24743J22301_10087379|JGI24743J22301_100873791
Length 172
Sequence MEQSFSLMDYAPIGVMFLVAIGFAASQILVTQLIGPRKRTAVKLMPYECGKDPVGSARDRYSIKFYSVAVIFLLFDIEVLFMVPFAVAXKYLIEQQKITGISFGXVALLEILVFISTLIVGYIYVWQKGVFDWGLQARVEARTQAKEMARKNREIKISGQPVLATSRQAEII

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
148 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
159 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
160 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
161 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
162 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
163 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
164 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
165 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
166 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
167 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
168 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
169 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
170 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
171 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
172 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
173 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
174 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
175 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
176 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
177 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
178 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
179 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
182 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 1.09
Rhizosphere 98.25
Stem 0
Stem Tuber 0
Unclassified 15.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10087379 3300001991 Bacteria 662
2 MBSR1b_contig_11253465 2162886012 Bacteria 2226
3 Ga0065712_10138912 3300005290 Bacteria 1464
4 Ga0065712_10471599 3300005290 Bacteria 670
5 Ga0065715_10274269 3300005293 Bacteria 1103
6 Ga0065715_10532556 3300005293 Bacteria 703
7 Ga0065715_10556072 3300005293 Bacteria 737
8 Ga0070658_10007452 3300005327 Bacteria 8833
9 Ga0070658_10152136 3300005327 Bacteria 1938
10 Ga0070676_10171943 3300005328 Unclassified 1402
11 Ga0070676_10210799 3300005328 Bacteria 1278
12 Ga0070676_10383889 3300005328 Bacteria 973
13 Ga0070676_10411350 3300005328 Bacteria 943
14 Ga0070683_100229093 3300005329 Bacteria 1766
15 Ga0070683_100506898 3300005329 Bacteria 1153
16 Ga0070683_100695500 3300005329 Bacteria 974
17 Ga0070683_100922251 3300005329 Unclassified 838
18 Ga0070670_100009024 3300005331 Bacteria 8518
19 Ga0070670_100258990 3300005331 Bacteria 1516
20 Ga0070670_100261353 3300005331 Bacteria 1509
21 Ga0070670_100305208 3300005331 Bacteria 1393
22 Ga0070677_10021293 3300005333 Unclassified 2377
23 Ga0068869_100193622 3300005334 Bacteria 1600
24 Ga0068869_100269133 3300005334 Bacteria 1367
25 Ga0070666_10053318 3300005335 Bacteria 2727
26 Ga0070680_100146475 3300005336 Bacteria 1981
27 Ga0070680_100465895 3300005336 Bacteria 1080
28 Ga0070680_100724752 3300005336 Unclassified 856
29 Ga0070682_100303177 3300005337 Bacteria 1173
30 Ga0070682_100427427 3300005337 Bacteria 1008
31 Ga0070660_100028449 3300005339 Bacteria 4182
32 Ga0070689_100005300 3300005340 Bacteria 8790
33 Ga0070689_100100318 3300005340 Unclassified 2291
34 Ga0070687_100135933 3300005343 Bacteria 1425
35 Ga0070661_100009734 3300005344 Bacteria 6665
36 Ga0070661_100146153 3300005344 Bacteria 1785
37 Ga0070692_10563514 3300005345 Unclassified 748
38 Ga0070668_100212394 3300005347 Bacteria 1592
39 Ga0070668_100409407 3300005347 Bacteria 1159
40 Ga0070675_100069700 3300005354 Bacteria 2913
41 Ga0070675_100338411 3300005354 Unclassified 1332
42 Ga0070671_100051285 3300005355 Bacteria 3431
43 Ga0070671_100086640 3300005355 Bacteria 2621
44 Ga0070671_100151471 3300005355 Bacteria 1958
45 Ga0070671_100185864 3300005355 Bacteria 1760
46 Ga0070671_100551754 3300005355 Bacteria 994
47 Ga0070671_100809073 3300005355 Bacteria 816
48 Ga0070674_100060001 3300005356 Bacteria 2650
49 Ga0070674_100314531 3300005356 Bacteria 1253
50 Ga0070674_100413708 3300005356 Bacteria 1105
51 Ga0070673_100533879 3300005364 Bacteria 1064
52 Ga0070673_100689881 3300005364 Bacteria 937
53 Ga0070688_100484593 3300005365 Bacteria 930
54 Ga0070659_100026285 3300005366 Bacteria 4477
55 Ga0070659_100526390 3300005366 Bacteria 1010
56 Ga0070659_100784674 3300005366 Unclassified 828
57 Ga0070667_100022788 3300005367 Bacteria 5194
58 Ga0070667_100246656 3300005367 Bacteria 1596
59 Ga0070667_100510156 3300005367 Bacteria 1103
60 Ga0070701_10178853 3300005438 Unclassified 1240
61 Ga0070694_100105267 3300005444 Unclassified 2002
62 Ga0070663_100497025 3300005455 Unclassified 1012
63 Ga0070663_100579247 3300005455 Bacteria 941
64 Ga0070663_100870626 3300005455 Bacteria 776
65 Ga0070678_100017844 3300005456 Bacteria 4581
66 Ga0070678_100220379 3300005456 Bacteria 1577
67 Ga0070678_100737873 3300005456 Bacteria 890
68 Ga0070678_101241367 3300005456 Unclassified 692
69 Ga0070662_100034615 3300005457 Bacteria 3563
70 Ga0070662_100359842 3300005457 Bacteria 1194
71 Ga0070681_10043251 3300005458 Bacteria 4513
72 Ga0070681_10117034 3300005458 Bacteria 2601
73 Ga0070681_10167127 3300005458 Bacteria 2122
74 Ga0070681_10487225 3300005458 Bacteria 1146
75 Ga0068867_100113624 3300005459 Bacteria 2084
76 Ga0068867_100188758 3300005459 Bacteria 1643
77 Ga0068867_100322828 3300005459 Bacteria 1280
78 Ga0070685_10286742 3300005466 Unclassified 1104
79 Ga0070679_100042928 3300005530 Bacteria 4504
80 Ga0070679_100748779 3300005530 Unclassified 920
81 Ga0070679_100918025 3300005530 Unclassified 819
82 Ga0070679_101137245 3300005530 Bacteria 726
83 Ga0068853_100002457 3300005539 Bacteria 13867
84 Ga0068853_100005574 3300005539 Bacteria 9883
85 Ga0068853_100019293 3300005539 Bacteria 5652
86 Ga0068853_100121068 3300005539 Bacteria 2334
87 Ga0070672_100267466 3300005543 Bacteria 1443
88 Ga0070672_100272821 3300005543 Bacteria 1429
89 Ga0070672_100560203 3300005543 Bacteria 993
90 Ga0070672_100914758 3300005543 Bacteria 775
91 Ga0070695_100310939 3300005545 Unclassified 1168
92 Ga0070665_100371383 3300005548 Bacteria 1437
93 Ga0070704_100032402 3300005549 Bacteria 3525
94 Ga0068855_100150208 3300005563 Bacteria 2649
95 Ga0068855_100221646 3300005563 Bacteria 2120
96 Ga0068855_100321637 3300005563 Bacteria 1710
97 Ga0068855_100444880 3300005563 Bacteria 1415
98 Ga0070664_100010179 3300005564 Bacteria 7627
99 Ga0070664_100032617 3300005564 Bacteria 4357
100 Ga0070664_100123066 3300005564 Bacteria 2273
101 Ga0070664_100204809 3300005564 Bacteria 1762
102 Ga0070664_100248456 3300005564 Bacteria 1598
103 Ga0070664_100464928 3300005564 Bacteria 1163
104 Ga0070664_100574290 3300005564 Bacteria 1044
105 Ga0068857_100031645 3300005577 Bacteria 4676
106 Ga0068857_100040777 3300005577 Bacteria 4116
107 Ga0068857_100476870 3300005577 Bacteria 1169
108 Ga0068857_100590184 3300005577 Bacteria 1049
109 Ga0068854_100298729 3300005578 Bacteria 1302
110 Ga0068854_100576929 3300005578 Bacteria 957
111 Ga0068856_100125370 3300005614 Bacteria 2571
112 Ga0070702_100194359 3300005615 Bacteria 1338
113 Ga0068852_100065811 3300005616 Bacteria 3164
114 Ga0068852_100133409 3300005616 Bacteria 2289
115 Ga0068852_100152989 3300005616 Bacteria 2147
116 Ga0068852_100158458 3300005616 Bacteria 2111
117 Ga0068852_100708900 3300005616 Bacteria 1017
118 Ga0068852_101030104 3300005616 Bacteria 842
119 Ga0068859_100049441 3300005617 Bacteria 4222
120 Ga0068859_100071466 3300005617 Bacteria 3506
121 Ga0068859_100281941 3300005617 Bacteria 1754
122 Ga0068864_100056750 3300005618 Unclassified 3383
123 Ga0068864_100099464 3300005618 Bacteria 2577
124 Ga0068861_100366236 3300005719 Bacteria 1269
125 Ga0068851_10185107 3300005834 Bacteria 1155
126 Ga0068851_10230127 3300005834 Bacteria 1045
127 Ga0068870_10078750 3300005840 Bacteria 1816
128 Ga0068870_10122808 3300005840 Bacteria 1498
129 Ga0068863_100187938 3300005841 Bacteria 1985
130 Ga0068863_100437367 3300005841 Bacteria 1282
131 Ga0068858_100077930 3300005842 Bacteria 3079
132 Ga0068858_100192734 3300005842 Bacteria 1926
133 Ga0068858_100764840 3300005842 Bacteria 941
134 Ga0068860_100041783 3300005843 Bacteria 4380
135 Ga0068860_100088916 3300005843 Bacteria 2940
136 Ga0068860_100515493 3300005843 Bacteria 1195
137 Ga0068860_101118898 3300005843 Unclassified 807
138 Ga0068862_100043872 3300005844 Bacteria 3813
139 Ga0068862_100461947 3300005844 Unclassified 1198
140 Ga0068862_100921940 3300005844 Bacteria 860
141 Ga0097621_100128581 3300006237 Bacteria 2154
142 Ga0097621_100291332 3300006237 Bacteria 1439
143 Ga0097621_100811702 3300006237 Bacteria 867
144 Ga0097621_101594504 3300006237 Unclassified 620
145 Ga0068871_100315435 3300006358 Bacteria 1375
146 Ga0068871_100337287 3300006358 Bacteria 1330
147 Ga0068871_100549924 3300006358 Bacteria 1045
148 Ga0097620_100049439 3300006931 Bacteria 4222
149 Ga0097620_100071473 3300006931 Bacteria 3506
150 Ga0097620_100281947 3300006931 Bacteria 1754
151 Ga0105240_10387103 3300009093 Bacteria 1578
152 Ga0111539_10076918 3300009094 Bacteria 3929
153 Ga0105245_10275700 3300009098 Bacteria 1642
154 Ga0105247_10004178 3300009101 Bacteria 9267
155 Ga0105247_10087442 3300009101 Bacteria 1973
156 Ga0105241_10013598 3300009174 Bacteria 5964
157 Ga0105241_10032496 3300009174 Bacteria 3912
158 Ga0105241_11115811 3300009174 Unclassified 743
159 Ga0105242_10320845 3300009176 Bacteria 1421
160 Ga0105248_10146626 3300009177 Bacteria 2663
161 Ga0105248_10169487 3300009177 Unclassified 2461
162 Ga0105248_10667886 3300009177 Bacteria 1172
163 Ga0105249_10024487 3300009553 Bacteria 5426
164 Ga0105249_10065728 3300009553 Bacteria 3337
165 Ga0105249_10114988 3300009553 Bacteria 2548
166 Ga0105249_10146201 3300009553 Unclassified 2272
167 Ga0105249_10929062 3300009553 Bacteria 937
168 Ga0105249_12209027 3300009553 Unclassified 623
169 Ga0105246_11164565 3300011119 Bacteria 708
170 Ga0157373_10081415 3300013100 Bacteria 2282
171 Ga0157373_10176772 3300013100 Bacteria 1503
172 Ga0157373_10604320 3300013100 Unclassified 799
173 Ga0157371_10271004 3300013102 Bacteria 1225
174 Ga0157369_10114654 3300013105 Bacteria 2862
175 Ga0157369_10177922 3300013105 Bacteria 2239
176 Ga0157369_10393147 3300013105 Bacteria 1438
177 Ga0157369_10905533 3300013105 Bacteria 904
178 Ga0157374_10037904 3300013296 Bacteria 4428
179 Ga0157374_10221879 3300013296 Bacteria 1855
180 Ga0157374_10758459 3300013296 Bacteria 985
181 Ga0157374_10906100 3300013296 Unclassified 899
182 Ga0157378_10078561 3300013297 Bacteria 2977
183 Ga0163162_10021179 3300013306 Bacteria 6396
184 Ga0163162_10022359 3300013306 Bacteria 6232
185 Ga0163162_10114263 3300013306 Bacteria 2799
186 Ga0163162_10382382 3300013306 Bacteria 1541
187 Ga0163162_10637747 3300013306 Unclassified 1190
188 Ga0163162_10714037 3300013306 Unclassified 1123
189 Ga0157372_10005548 3300013307 Bacteria 13413
190 Ga0157372_10067642 3300013307 Unclassified 4015
191 Ga0157372_10108502 3300013307 Bacteria 3177
192 Ga0157372_10582307 3300013307 Bacteria 1304
193 Ga0157375_10049660 3300013308 Bacteria 4112
194 Ga0157375_10072776 3300013308 Bacteria 3454
195 Ga0157375_10187509 3300013308 Bacteria 2222
196 Ga0157375_10190756 3300013308 Bacteria 2204
197 Ga0157375_10194513 3300013308 Bacteria 2183
198 Ga0157375_10652811 3300013308 Bacteria 1208
199 Ga0163163_10015484 3300014325 Bacteria 7050
200 Ga0163163_10351502 3300014325 Bacteria 1530
201 Ga0163163_10646401 3300014325 Bacteria 1121
202 Ga0163163_11189808 3300014325 Bacteria 825
203 Ga0163163_11628075 3300014325 Bacteria 706
204 Ga0157380_10126606 3300014326 Bacteria 2172
205 Ga0157380_10139649 3300014326 Bacteria 2080
206 Ga0157380_10453900 3300014326 Bacteria 1232
207 Ga0157380_12140081 3300014326 Bacteria 623
208 Ga0157379_10186943 3300014968 Bacteria 1872
209 Ga0157376_10211309 3300014969 Unclassified 1791
210 Ga0157376_10354597 3300014969 Bacteria 1405
211 Ga0157376_10531178 3300014969 Bacteria 1161
212 Ga0157376_10631190 3300014969 Bacteria 1070
213 Ga0157376_11647025 3300014969 Bacteria 676
214 Ga0157376_11647028 3300014969 Bacteria 676
215 Ga0163161_10002334 3300017792 Bacteria 13599
216 Ga0163161_10121455 3300017792 Bacteria 1963
217 Ga0163161_10127564 3300017792 Bacteria 1917
218 Ga0206356_10880250 3300020070 Bacteria 806
219 Ga0207656_10037870 3300025321 Bacteria 2032
220 Ga0207656_10180318 3300025321 Bacteria 1013
221 Ga0207682_10061580 3300025893 Unclassified 1571
222 Ga0207682_10142025 3300025893 Unclassified 1078
223 Ga0207710_10001507 3300025900 Bacteria 11541
224 Ga0207688_10329260 3300025901 Bacteria 938
225 Ga0207680_10208074 3300025903 Bacteria 1336
226 Ga0207645_10365499 3300025907 Bacteria 967
227 Ga0207645_10377136 3300025907 Bacteria 952
228 Ga0207645_10377641 3300025907 Unclassified 951
229 Ga0207645_10740488 3300025907 Bacteria 668
230 Ga0207643_10089535 3300025908 Unclassified 1792
231 Ga0207643_10118688 3300025908 Bacteria 1565
232 Ga0207643_10733591 3300025908 Bacteria 639
233 Ga0207705_10003309 3300025909 Bacteria 12261
234 Ga0207654_10125242 3300025911 Bacteria 1619
235 Ga0207654_10515463 3300025911 Unclassified 846
236 Ga0207707_10004504 3300025912 Bacteria 12254
237 Ga0207707_10059940 3300025912 Bacteria 3311
238 Ga0207707_10783287 3300025912 Bacteria 795
239 Ga0207695_10297975 3300025913 Unclassified 1504
240 Ga0207695_10479815 3300025913 Unclassified 1126
241 Ga0207671_10165453 3300025914 Bacteria 1715
242 Ga0207660_10039855 3300025917 Bacteria 3286
243 Ga0207660_10391359 3300025917 Bacteria 1118
244 Ga0207660_10411851 3300025917 Bacteria 1089
245 Ga0207649_10008598 3300025920 Bacteria 5572
246 Ga0207652_10031065 3300025921 Bacteria 4482
247 Ga0207652_10128373 3300025921 Bacteria 2260
248 Ga0207652_10713986 3300025921 Unclassified 894
249 Ga0207650_10080373 3300025925 Bacteria 2471
250 Ga0207650_10157866 3300025925 Bacteria 1795
251 Ga0207650_10235950 3300025925 Bacteria 1477
252 Ga0207650_10239976 3300025925 Bacteria 1464
253 Ga0207650_10247185 3300025925 Bacteria 1443
254 Ga0207650_10747840 3300025925 Bacteria 827
255 Ga0207659_10066396 3300025926 Bacteria 2618
256 Ga0207659_10181551 3300025926 Bacteria 1667
257 Ga0207659_10464661 3300025926 Unclassified 1067
258 Ga0207659_10987287 3300025926 Bacteria 724
259 Ga0207644_10266919 3300025931 Bacteria 1370
260 Ga0207644_10326815 3300025931 Unclassified 1241
261 Ga0207644_10820651 3300025931 Bacteria 778
262 Ga0207690_10050690 3300025932 Bacteria 2772
263 Ga0207690_10434014 3300025932 Bacteria 1053
264 Ga0207690_10912976 3300025932 Unclassified 729
265 Ga0207706_10026503 3300025933 Bacteria 5188
266 Ga0207706_10182198 3300025933 Bacteria 1845
267 Ga0207706_10492893 3300025933 Bacteria 1058
268 Ga0207709_10660543 3300025935 Unclassified 833
269 Ga0207670_10001740 3300025936 Bacteria 11370
270 Ga0207669_10111102 3300025937 Bacteria 1837
271 Ga0207691_10050930 3300025940 Bacteria 3789
272 Ga0207691_10123989 3300025940 Bacteria 2287
273 Ga0207691_10307682 3300025940 Bacteria 1360
274 Ga0207691_10337782 3300025940 Bacteria 1290
275 Ga0207711_10089606 3300025941 Bacteria 2703
276 Ga0207711_10367744 3300025941 Bacteria 1333
277 Ga0207689_10084269 3300025942 Bacteria 2613
278 Ga0207689_10830402 3300025942 Bacteria 780
279 Ga0207661_10337794 3300025944 Bacteria 1357
280 Ga0207661_10390367 3300025944 Bacteria 1261
281 Ga0207661_10764528 3300025944 Bacteria 889
282 Ga0207661_10765507 3300025944 Bacteria 889
283 Ga0207679_10007405 3300025945 Bacteria 6958
284 Ga0207679_10026404 3300025945 Unclassified 4004
285 Ga0207679_10096070 3300025945 Bacteria 2305
286 Ga0207679_10130284 3300025945 Bacteria 2017
287 Ga0207679_10197400 3300025945 Bacteria 1678
288 Ga0207679_10253216 3300025945 Bacteria 1498
289 Ga0207667_10213944 3300025949 Bacteria 1975
290 Ga0207667_10392295 3300025949 Bacteria 1413
291 Ga0207667_10425231 3300025949 Bacteria 1351
292 Ga0207667_10470583 3300025949 Bacteria 1276
293 Ga0207651_10059702 3300025960 Bacteria 2644
294 Ga0207651_10189903 3300025960 Bacteria 1638
295 Ga0207712_10001802 3300025961 Bacteria 14163
296 Ga0207712_10054801 3300025961 Bacteria 2802
297 Ga0207712_10449623 3300025961 Bacteria 1092
298 Ga0207712_10634913 3300025961 Unclassified 927
299 Ga0207668_10314569 3300025972 Bacteria 1297
300 Ga0207668_11176131 3300025972 Bacteria 689
301 Ga0207640_10009371 3300025981 Bacteria 5481
302 Ga0207640_10793919 3300025981 Bacteria 820
303 Ga0207640_11313692 3300025981 Unclassified 646
304 Ga0207658_10074897 3300025986 Bacteria 2573
305 Ga0207658_11165129 3300025986 Bacteria 704
306 Ga0207677_10074422 3300026023 Bacteria 2410
307 Ga0207677_11096573 3300026023 Unclassified 725
308 Ga0207703_10537353 3300026035 Bacteria 1101
309 Ga0207703_11693799 3300026035 Unclassified 608
310 Ga0207639_10027846 3300026041 Bacteria 4120
311 Ga0207639_10067298 3300026041 Bacteria 2787
312 Ga0207639_10069948 3300026041 Bacteria 2740
313 Ga0207639_10132631 3300026041 Bacteria 2064
314 Ga0207639_10781343 3300026041 Bacteria 889
315 Ga0207678_10100054 3300026067 Bacteria 2477
316 Ga0207702_10052333 3300026078 Bacteria 3455
317 Ga0207641_10034470 3300026088 Unclassified 4211
318 Ga0207641_10353258 3300026088 Bacteria 1401
319 Ga0207641_10549175 3300026088 Unclassified 1126
320 Ga0207648_10154706 3300026089 Bacteria 2024
321 Ga0207648_10155906 3300026089 Bacteria 2016
322 Ga0207648_10424155 3300026089 Bacteria 1208
323 Ga0207676_10054353 3300026095 Unclassified 3138
324 Ga0207676_10057376 3300026095 Bacteria 3066
325 Ga0207676_10174770 3300026095 Bacteria 1874
326 Ga0207676_10724426 3300026095 Bacteria 965
327 Ga0207676_11131236 3300026095 Unclassified 775
328 Ga0207674_10008939 3300026116 Bacteria 11512
329 Ga0207674_10305907 3300026116 Unclassified 1539
330 Ga0207674_10415525 3300026116 Bacteria 1300
331 Ga0207674_10427290 3300026116 Bacteria 1280
332 Ga0207675_100402144 3300026118 Bacteria 1350
333 Ga0207683_10374919 3300026121 Bacteria 1307
334 Ga0207683_10732429 3300026121 Bacteria 917
335 Ga0207698_10158650 3300026142 Bacteria 1975
336 Ga0207698_10259550 3300026142 Bacteria 1595
337 Ga0207698_10657733 3300026142 Bacteria 1039
338 Ga0268266_10311452 3300028379 Bacteria 1471
339 Ga0268265_10041694 3300028380 Bacteria 3400
340 Ga0268265_10302759 3300028380 Bacteria 1440
341 Ga0268265_11935631 3300028380 Unclassified 596
342 Ga0268264_10148308 3300028381 Bacteria 2100
343 Ga0268264_10545383 3300028381 Bacteria 1137
344 Ga0316182_1072641 3300030745 Unclassified 583
345 Ga0307408_100002645 3300031548 Bacteria 12433
346 Ga0307408_100139400 3300031548 Unclassified 1902
347 Ga0307408_100175207 3300031548 Unclassified 1716
348 Ga0307405_10001659 3300031731 Bacteria 9484
349 Ga0307405_10814119 3300031731 Unclassified 783
350 Ga0307413_10000564 3300031824 Bacteria 12425
351 Ga0307413_10012811 3300031824 Bacteria 4188
352 Ga0307413_10147802 3300031824 Bacteria 1633
353 Ga0307413_10150741 3300031824 Bacteria 1620
354 Ga0307413_10190839 3300031824 Bacteria 1471
355 Ga0307413_10879738 3300031824 Bacteria 759
356 Ga0307410_10001354 3300031852 Bacteria 10995
357 Ga0307410_10059157 3300031852 Bacteria 2615
358 Ga0307410_10184488 3300031852 Bacteria 1582
359 Ga0307410_10221666 3300031852 Bacteria 1455
360 Ga0307410_10345073 3300031852 Bacteria 1188
361 Ga0307410_10397775 3300031852 Bacteria 1112
362 Ga0307410_10464406 3300031852 Bacteria 1035
363 Ga0307410_10963736 3300031852 Bacteria 734
364 Ga0307410_11108681 3300031852 Unclassified 686
365 Ga0307406_10006014 3300031901 Bacteria 6663
366 Ga0307406_10030772 3300031901 Bacteria 3262
367 Ga0307406_10075034 3300031901 Bacteria 2229
368 Ga0307406_10083421 3300031901 Unclassified 2131
369 Ga0307406_10164738 3300031901 Bacteria 1598
370 Ga0307406_10662879 3300031901 Bacteria 867
371 Ga0307406_10785611 3300031901 Unclassified 802
372 Ga0307406_10965319 3300031901 Bacteria 729
373 Ga0307407_10000727 3300031903 Bacteria 10735
374 Ga0307407_10054556 3300031903 Bacteria 2306
375 Ga0307407_10107991 3300031903 Bacteria 1741
376 Ga0307407_10112394 3300031903 Bacteria 1712
377 Ga0307407_10135601 3300031903 Bacteria 1581
378 Ga0307407_10509490 3300031903 Unclassified 883
379 Ga0307407_10959976 3300031903 Unclassified 659
380 Ga0307412_10001237 3300031911 Bacteria 14449
381 Ga0307412_10030016 3300031911 Bacteria 3418
382 Ga0307412_10212930 3300031911 Bacteria 1476
383 Ga0307409_100012320 3300031995 Bacteria 5444
384 Ga0307409_100048815 3300031995 Bacteria 3224
385 Ga0307409_100161624 3300031995 Bacteria 1959
386 Ga0307409_100499524 3300031995 Bacteria 1184
387 Ga0307409_101166397 3300031995 Bacteria 793
388 Ga0307416_100097369 3300032002 Bacteria 2547
389 Ga0307416_100137575 3300032002 Bacteria 2213
390 Ga0307416_100278052 3300032002 Bacteria 1649
391 Ga0307416_100341777 3300032002 Bacteria 1510
392 Ga0307416_100782245 3300032002 Bacteria 1049
393 Ga0307416_101188833 3300032002 Unclassified 868
394 Ga0307416_102200566 3300032002 Bacteria 653
395 Ga0307416_102412079 3300032002 Bacteria 625
396 Ga0307414_10011414 3300032004 Bacteria 5208
397 Ga0307414_10200633 3300032004 Bacteria 1622
398 Ga0307414_10326009 3300032004 Bacteria 1309
399 Ga0307414_11302497 3300032004 Bacteria 674
400 Ga0307411_10019439 3300032005 Bacteria 3924
401 Ga0307411_10032917 3300032005 Bacteria 3209
402 Ga0307411_10106352 3300032005 Unclassified 1997
403 Ga0307411_10250934 3300032005 Bacteria 1391
404 Ga0307411_10302240 3300032005 Bacteria 1284
405 Ga0307411_10373560 3300032005 Bacteria 1170
406 Ga0307411_10650335 3300032005 Bacteria 913
407 Ga0307411_10828473 3300032005 Unclassified 817
408 Ga0307415_100000617 3300032126 Bacteria 15565
409 Ga0307415_100083263 3300032126 Bacteria 2291
410 Ga0307415_100250365 3300032126 Bacteria 1439
411 Ga0307415_100499837 3300032126 Bacteria 1063
412 Ga0307415_100596942 3300032126 Unclassified 982
413 Ga0307415_100831579 3300032126 Unclassified 846
414 Ga0307415_100978075 3300032126 Bacteria 785
415 Ga0307415_102029384 3300032126 Bacteria 560
416 Ga0373924_0480723 3300035410 Bacteria 558
417 Ga0436365_1561390 3300039437 Bacteria 614
418 Ga0451843_1487402 3300041509 Bacteria 1415
419 Ga0439452_100456 3300042010 Bacteria 622
420 Ga0495668_0004256 3300046616 Bacteria 10281
421 Ga0495658_0417620 3300046683 Bacteria 856
422 Ga0496100_0230380 3300048903 Bacteria 1363
423 Ga0496109_0049790 3300048912 Bacteria 3815
424 Ga0496110_1414144 3300048913 Unclassified 605
425 Ga0496113_0299732 3300048916 Bacteria 1287
426 Ga0496114_0198821 3300048917 Bacteria 1755
427 Ga0501292_041701 3300049515 Unclassified 794
428 Ga0501072_0027317 3300049588 Bacteria 4453
429 Ga0501207_016116 3300049654 Unclassified 1157
430 Ga0501209_038118 3300049656 Bacteria 1258
431 Ga0501216_079960 3300049660 Unclassified 690
432 Ga0501217_167913 3300049661 Bacteria 666
433 Ga0501227_008976 3300049665 Bacteria 2150
434 Ga0501239_001373 3300049672 Bacteria 2075
435 Ga0501239_040540 3300049672 Bacteria 643
436 Ga0501243_035523 3300049675 Bacteria 863
437 Ga0501247_047990 3300049677 Bacteria 627
438 Ga0501249_004293 3300049679 Bacteria 2893
439 Ga0501251_009843 3300049681 Bacteria 1110
440 Ga0501252_026022 3300049682 Unclassified 790
441 Ga0501253_023512 3300049683 Bacteria 1109
442 Ga0501256_031236 3300049685 Bacteria 601
443 Ga0501257_069041 3300049686 Bacteria 901
444 Ga0501258_000268 3300049687 Bacteria 3237
445 Ga0501259_001401 3300049688 Bacteria 4025
446 Ga0501221_003672 3300049704 Bacteria 2529
447 Ga0501225_0007792 3300049705 Bacteria 3092
448 Ga0501225_0034858 3300049705 Bacteria 1385
449 Ga0501245_002418 3300049708 Bacteria 2493
450 Ga0501263_005452 3300049760 Bacteria 1435
451 Ga0501268_002047 3300049765 Bacteria 2603
452 Ga0501270_024074 3300049767 Bacteria 953
453 nmdc:mga08y16_87324_c1 3300050511 Bacteria 3249
454 Ga0495601_0165176 3300053077 Bacteria 1447
455 Ga0500577_0002613 3300053142 Bacteria 4614
456 Ga0501084_0332151 3300054114 Bacteria 1284
457 Ga0590074_062916 3300059423 Bacteria 692
458 Ga0501082_0201031 3300060353 Bacteria 1734
459 JGI24743J22301_10087379
460 MBSR1b_contig_11253465
461 Ga0065712_10138912
462 Ga0065712_10471599
463 Ga0065715_10274269
464 Ga0065715_10532556
465 Ga0065715_10556072
466 Ga0070658_10007452
467 Ga0070658_10152136
468 Ga0070676_10171943
469 Ga0070676_10210799
470 Ga0070676_10383889
471 Ga0070676_10411350
472 Ga0070683_100229093
473 Ga0070683_100506898
474 Ga0070683_100695500
475 Ga0070683_100922251
476 Ga0070670_100009024
477 Ga0070670_100258990
478 Ga0070670_100261353
479 Ga0070670_100305208
480 Ga0070677_10021293
481 Ga0068869_100193622
482 Ga0068869_100269133
483 Ga0070666_10053318
484 Ga0070680_100146475
485 Ga0070680_100465895
486 Ga0070680_100724752
487 Ga0070682_100303177
488 Ga0070682_100427427
489 Ga0070660_100028449
490 Ga0070689_100005300
491 Ga0070689_100100318
492 Ga0070687_100135933
493 Ga0070661_100009734
494 Ga0070661_100146153
495 Ga0070692_10563514
496 Ga0070668_100212394
497 Ga0070668_100409407
498 Ga0070675_100069700
499 Ga0070675_100338411
500 Ga0070671_100051285
501 Ga0070671_100086640
502 Ga0070671_100151471
503 Ga0070671_100185864
504 Ga0070671_100551754
505 Ga0070671_100809073
506 Ga0070674_100060001
507 Ga0070674_100314531
508 Ga0070674_100413708
509 Ga0070673_100533879
510 Ga0070673_100689881
511 Ga0070688_100484593
512 Ga0070659_100026285
513 Ga0070659_100526390
514 Ga0070659_100784674
515 Ga0070667_100022788
516 Ga0070667_100246656
517 Ga0070667_100510156
518 Ga0070701_10178853
519 Ga0070694_100105267
520 Ga0070663_100497025
521 Ga0070663_100579247
522 Ga0070663_100870626
523 Ga0070678_100017844
524 Ga0070678_100220379
525 Ga0070678_100737873
526 Ga0070678_101241367
527 Ga0070662_100034615
528 Ga0070662_100359842
529 Ga0070681_10043251
530 Ga0070681_10117034
531 Ga0070681_10167127
532 Ga0070681_10487225
533 Ga0068867_100113624
534 Ga0068867_100188758
535 Ga0068867_100322828
536 Ga0070685_10286742
537 Ga0070679_100042928
538 Ga0070679_100748779
539 Ga0070679_100918025
540 Ga0070679_101137245
541 Ga0068853_100002457
542 Ga0068853_100005574
543 Ga0068853_100019293
544 Ga0068853_100121068
545 Ga0070672_100267466
546 Ga0070672_100272821
547 Ga0070672_100560203
548 Ga0070672_100914758
549 Ga0070695_100310939
550 Ga0070665_100371383
551 Ga0070704_100032402
552 Ga0068855_100150208
553 Ga0068855_100221646
554 Ga0068855_100321637
555 Ga0068855_100444880
556 Ga0070664_100010179
557 Ga0070664_100032617
558 Ga0070664_100123066
559 Ga0070664_100204809
560 Ga0070664_100248456
561 Ga0070664_100464928
562 Ga0070664_100574290
563 Ga0068857_100031645
564 Ga0068857_100040777
565 Ga0068857_100476870
566 Ga0068857_100590184
567 Ga0068854_100298729
568 Ga0068854_100576929
569 Ga0068856_100125370
570 Ga0070702_100194359
571 Ga0068852_100065811
572 Ga0068852_100133409
573 Ga0068852_100152989
574 Ga0068852_100158458
575 Ga0068852_100708900
576 Ga0068852_101030104
577 Ga0068859_100049441
578 Ga0068859_100071466
579 Ga0068859_100281941
580 Ga0068864_100056750
581 Ga0068864_100099464
582 Ga0068861_100366236
583 Ga0068851_10185107
584 Ga0068851_10230127
585 Ga0068870_10078750
586 Ga0068870_10122808
587 Ga0068863_100187938
588 Ga0068863_100437367
589 Ga0068858_100077930
590 Ga0068858_100192734
591 Ga0068858_100764840
592 Ga0068860_100041783
593 Ga0068860_100088916
594 Ga0068860_100515493
595 Ga0068860_101118898
596 Ga0068862_100043872
597 Ga0068862_100461947
598 Ga0068862_100921940
599 Ga0097621_100128581
600 Ga0097621_100291332
601 Ga0097621_100811702
602 Ga0097621_101594504
603 Ga0068871_100315435
604 Ga0068871_100337287
605 Ga0068871_100549924
606 Ga0097620_100049439
607 Ga0097620_100071473
608 Ga0097620_100281947
609 Ga0105240_10387103
610 Ga0111539_10076918
611 Ga0105245_10275700
612 Ga0105247_10004178
613 Ga0105247_10087442
614 Ga0105241_10013598
615 Ga0105241_10032496
616 Ga0105241_11115811
617 Ga0105242_10320845
618 Ga0105248_10146626
619 Ga0105248_10169487
620 Ga0105248_10667886
621 Ga0105249_10024487
622 Ga0105249_10065728
623 Ga0105249_10114988
624 Ga0105249_10146201
625 Ga0105249_10929062
626 Ga0105249_12209027
627 Ga0105246_11164565
628 Ga0157373_10081415
629 Ga0157373_10176772
630 Ga0157373_10604320
631 Ga0157371_10271004
632 Ga0157369_10114654
633 Ga0157369_10177922
634 Ga0157369_10393147
635 Ga0157369_10905533
636 Ga0157374_10037904
637 Ga0157374_10221879
638 Ga0157374_10758459
639 Ga0157374_10906100
640 Ga0157378_10078561
641 Ga0163162_10021179
642 Ga0163162_10022359
643 Ga0163162_10114263
644 Ga0163162_10382382
645 Ga0163162_10637747
646 Ga0163162_10714037
647 Ga0157372_10005548
648 Ga0157372_10067642
649 Ga0157372_10108502
650 Ga0157372_10582307
651 Ga0157375_10049660
652 Ga0157375_10072776
653 Ga0157375_10187509
654 Ga0157375_10190756
655 Ga0157375_10194513
656 Ga0157375_10652811
657 Ga0163163_10015484
658 Ga0163163_10351502
659 Ga0163163_10646401
660 Ga0163163_11189808
661 Ga0163163_11628075
662 Ga0157380_10126606
663 Ga0157380_10139649
664 Ga0157380_10453900
665 Ga0157380_12140081
666 Ga0157379_10186943
667 Ga0157376_10211309
668 Ga0157376_10354597
669 Ga0157376_10531178
670 Ga0157376_10631190
671 Ga0157376_11647025
672 Ga0157376_11647028
673 Ga0163161_10002334
674 Ga0163161_10121455
675 Ga0163161_10127564
676 Ga0206356_10880250
677 Ga0207656_10037870
678 Ga0207656_10180318
679 Ga0207682_10061580
680 Ga0207682_10142025
681 Ga0207710_10001507
682 Ga0207688_10329260
683 Ga0207680_10208074
684 Ga0207645_10365499
685 Ga0207645_10377136
686 Ga0207645_10377641
687 Ga0207645_10740488
688 Ga0207643_10089535
689 Ga0207643_10118688
690 Ga0207643_10733591
691 Ga0207705_10003309
692 Ga0207654_10125242
693 Ga0207654_10515463
694 Ga0207707_10004504
695 Ga0207707_10059940
696 Ga0207707_10783287
697 Ga0207695_10297975
698 Ga0207695_10479815
699 Ga0207671_10165453
700 Ga0207660_10039855
701 Ga0207660_10391359
702 Ga0207660_10411851
703 Ga0207649_10008598
704 Ga0207652_10031065
705 Ga0207652_10128373
706 Ga0207652_10713986
707 Ga0207650_10080373
708 Ga0207650_10157866
709 Ga0207650_10235950
710 Ga0207650_10239976
711 Ga0207650_10247185
712 Ga0207650_10747840
713 Ga0207659_10066396
714 Ga0207659_10181551
715 Ga0207659_10464661
716 Ga0207659_10987287
717 Ga0207644_10266919
718 Ga0207644_10326815
719 Ga0207644_10820651
720 Ga0207690_10050690
721 Ga0207690_10434014
722 Ga0207690_10912976
723 Ga0207706_10026503
724 Ga0207706_10182198
725 Ga0207706_10492893
726 Ga0207709_10660543
727 Ga0207670_10001740
728 Ga0207669_10111102
729 Ga0207691_10050930
730 Ga0207691_10123989
731 Ga0207691_10307682
732 Ga0207691_10337782
733 Ga0207711_10089606
734 Ga0207711_10367744
735 Ga0207689_10084269
736 Ga0207689_10830402
737 Ga0207661_10337794
738 Ga0207661_10390367
739 Ga0207661_10764528
740 Ga0207661_10765507
741 Ga0207679_10007405
742 Ga0207679_10026404
743 Ga0207679_10096070
744 Ga0207679_10130284
745 Ga0207679_10197400
746 Ga0207679_10253216
747 Ga0207667_10213944
748 Ga0207667_10392295
749 Ga0207667_10425231
750 Ga0207667_10470583
751 Ga0207651_10059702
752 Ga0207651_10189903
753 Ga0207712_10001802
754 Ga0207712_10054801
755 Ga0207712_10449623
756 Ga0207712_10634913
757 Ga0207668_10314569
758 Ga0207668_11176131
759 Ga0207640_10009371
760 Ga0207640_10793919
761 Ga0207640_11313692
762 Ga0207658_10074897
763 Ga0207658_11165129
764 Ga0207677_10074422
765 Ga0207677_11096573
766 Ga0207703_10537353
767 Ga0207703_11693799
768 Ga0207639_10027846
769 Ga0207639_10067298
770 Ga0207639_10069948
771 Ga0207639_10132631
772 Ga0207639_10781343
773 Ga0207678_10100054
774 Ga0207702_10052333
775 Ga0207641_10034470
776 Ga0207641_10353258
777 Ga0207641_10549175
778 Ga0207648_10154706
779 Ga0207648_10155906
780 Ga0207648_10424155
781 Ga0207676_10054353
782 Ga0207676_10057376
783 Ga0207676_10174770
784 Ga0207676_10724426
785 Ga0207676_11131236
786 Ga0207674_10008939
787 Ga0207674_10305907
788 Ga0207674_10415525
789 Ga0207674_10427290
790 Ga0207675_100402144
791 Ga0207683_10374919
792 Ga0207683_10732429
793 Ga0207698_10158650
794 Ga0207698_10259550
795 Ga0207698_10657733
796 Ga0268266_10311452
797 Ga0268265_10041694
798 Ga0268265_10302759
799 Ga0268265_11935631
800 Ga0268264_10148308
801 Ga0268264_10545383
802 Ga0316182_1072641
803 Ga0307408_100002645
804 Ga0307408_100139400
805 Ga0307408_100175207
806 Ga0307405_10001659
807 Ga0307405_10814119
808 Ga0307413_10000564
809 Ga0307413_10012811
810 Ga0307413_10147802
811 Ga0307413_10150741
812 Ga0307413_10190839
813 Ga0307413_10879738
814 Ga0307410_10001354
815 Ga0307410_10059157
816 Ga0307410_10184488
817 Ga0307410_10221666
818 Ga0307410_10345073
819 Ga0307410_10397775
820 Ga0307410_10464406
821 Ga0307410_10963736
822 Ga0307410_11108681
823 Ga0307406_10006014
824 Ga0307406_10030772
825 Ga0307406_10075034
826 Ga0307406_10083421
827 Ga0307406_10164738
828 Ga0307406_10662879
829 Ga0307406_10785611
830 Ga0307406_10965319
831 Ga0307407_10000727
832 Ga0307407_10054556
833 Ga0307407_10107991
834 Ga0307407_10112394
835 Ga0307407_10135601
836 Ga0307407_10509490
837 Ga0307407_10959976
838 Ga0307412_10001237
839 Ga0307412_10030016
840 Ga0307412_10212930
841 Ga0307409_100012320
842 Ga0307409_100048815
843 Ga0307409_100161624
844 Ga0307409_100499524
845 Ga0307409_101166397
846 Ga0307416_100097369
847 Ga0307416_100137575
848 Ga0307416_100278052
849 Ga0307416_100341777
850 Ga0307416_100782245
851 Ga0307416_101188833
852 Ga0307416_102200566
853 Ga0307416_102412079
854 Ga0307414_10011414
855 Ga0307414_10200633
856 Ga0307414_10326009
857 Ga0307414_11302497
858 Ga0307411_10019439
859 Ga0307411_10032917
860 Ga0307411_10106352
861 Ga0307411_10250934
862 Ga0307411_10302240
863 Ga0307411_10373560
864 Ga0307411_10650335
865 Ga0307411_10828473
866 Ga0307415_100000617
867 Ga0307415_100083263
868 Ga0307415_100250365
869 Ga0307415_100499837
870 Ga0307415_100596942
871 Ga0307415_100831579
872 Ga0307415_100978075
873 Ga0307415_102029384
874 Ga0373924_0480723
875 Ga0436365_1561390
876 Ga0451843_1487402
877 Ga0439452_100456
878 Ga0495668_0004256
879 Ga0495658_0417620
880 Ga0496100_0230380
881 Ga0496109_0049790
882 Ga0496110_1414144
883 Ga0496113_0299732
884 Ga0496114_0198821
885 Ga0501292_041701
886 Ga0501072_0027317
887 Ga0501207_016116
888 Ga0501209_038118
889 Ga0501216_079960
890 Ga0501217_167913
891 Ga0501227_008976
892 Ga0501239_001373
893 Ga0501239_040540
894 Ga0501243_035523
895 Ga0501247_047990
896 Ga0501249_004293
897 Ga0501251_009843
898 Ga0501252_026022
899 Ga0501253_023512
900 Ga0501256_031236
901 Ga0501257_069041
902 Ga0501258_000268
903 Ga0501259_001401
904 Ga0501221_003672
905 Ga0501225_0007792
906 Ga0501225_0034858
907 Ga0501245_002418
908 Ga0501263_005452
909 Ga0501268_002047
910 Ga0501270_024074
911 nmdc:mga08y16_87324_c1
912 Ga0495601_0165176
913 Ga0500577_0002613
914 Ga0501084_0332151
915 Ga0590074_062916
916 Ga0501082_0201031

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00507

Oxidored_q4

NADH-ubiquinone/plastoquinone oxidoreductase, chain 3

24

133

0.9

Map