F448076

General Info

Members Datasets Scaffolds Average Seq Length
457 237 914 198

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0177728|Ga0501040_0177728_674_1321
Length 215
Sequence MRRYDTQGEKSIYEERVIAINRVAKVVKGGRRFSFAALVVVGDGAGRVGLGYGKAKEVPAAIAKGVEEAKRKMFEVPMMGTTIPHQVLGEDGAGVVLLKPAAPGTGVIAGGPVRALIECAGIKDILSKSLGSSNGINIVKAAMAGLKSLKRPEDVARLRGRDVREVAPKPMLEAVTAAQERMQAARAAKLEEVYGDQAEARPDGPRRDGPPRGRR

Samples

Sample ID Description Type Environment
1 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
114 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
115 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
116 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
117 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
120 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
124 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
125 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
126 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
127 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
130 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
131 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
134 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
141 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
146 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
147 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
148 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
149 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
150 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
151 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
152 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
153 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
154 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
160 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
161 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
164 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
176 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
177 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
219 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
220 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
230 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
231 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
232 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 1.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.35
Nodule 0
Rhizoplane 5.03
Rhizosphere 86.21
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501040_0177728 3300049576 Bacteria 1508
2 JGI24751J29686_10000650 3300002459 Bacteria 8778
3 JGI24751J29686_10003292 3300002459 Unclassified 3252
4 Ga0070683_100265522 3300005329 Bacteria 1633
5 Ga0070670_100211244 3300005331 Bacteria 1687
6 Ga0070670_100353015 3300005331 Bacteria 1292
7 Ga0070677_10017280 3300005333 Bacteria 2581
8 Ga0070689_100600956 3300005340 Bacteria 953
9 Ga0070661_100020772 3300005344 Bacteria 4684
10 Ga0070661_100103545 3300005344 Bacteria 2120
11 Ga0070668_100034448 3300005347 Bacteria 3858
12 Ga0070669_100180100 3300005353 Bacteria 1653
13 Ga0070675_100017277 3300005354 Bacteria 5731
14 Ga0070675_100046841 3300005354 Bacteria 3542
15 Ga0070671_100145747 3300005355 Bacteria 1998
16 Ga0070674_100211113 3300005356 Bacteria 1505
17 Ga0070667_100252409 3300005367 Bacteria 1577
18 Ga0070713_100060396 3300005436 Bacteria 3169
19 Ga0070700_100037510 3300005441 Bacteria 2948
20 Ga0070700_100354742 3300005441 Bacteria 1088
21 Ga0070663_100114935 3300005455 Bacteria 2027
22 Ga0070663_100651500 3300005455 Bacteria 891
23 Ga0070681_10394276 3300005458 Bacteria 1295
24 Ga0070685_10243073 3300005466 Bacteria 1189
25 Ga0070685_10723163 3300005466 Bacteria 728
26 Ga0070706_100148861 3300005467 Bacteria 2186
27 Ga0070706_100309684 3300005467 Bacteria 1473
28 Ga0070699_100157536 3300005518 Bacteria 2009
29 Ga0070684_100032950 3300005535 Bacteria 4420
30 Ga0070672_100151494 3300005543 Bacteria 1919
31 Ga0070664_100023793 3300005564 Bacteria 5060
32 Ga0068857_100222221 3300005577 Bacteria 1725
33 Ga0068856_100052395 3300005614 Bacteria 4024
34 Ga0070702_100052749 3300005615 Bacteria 2333
35 Ga0068852_101304803 3300005616 Bacteria 747
36 Ga0068859_100935050 3300005617 Bacteria 951
37 Ga0068861_100008806 3300005719 Bacteria 6950
38 Ga0068861_100157413 3300005719 Bacteria 1870
39 Ga0068870_10000375 3300005840 Bacteria 16758
40 Ga0068863_100013521 3300005841 Bacteria 7874
41 Ga0068863_100520490 3300005841 Bacteria 1173
42 Ga0068860_100049813 3300005843 Bacteria 3988
43 Ga0068860_100080554 3300005843 Bacteria 3096
44 Ga0068860_100349414 3300005843 Bacteria 1455
45 Ga0068860_100778047 3300005843 Bacteria 970
46 Ga0068862_100053766 3300005844 Bacteria 3447
47 Ga0081455_10001246 3300005937 Bacteria 31840
48 Ga0081455_10006029 3300005937 Bacteria 13133
49 Ga0081455_10019312 3300005937 Bacteria 6452
50 Ga0081455_10073568 3300005937 Bacteria 2825
51 Ga0081455_10228915 3300005937 Bacteria 1373
52 Ga0081538_10027452 3300005981 Bacteria 3946
53 Ga0075365_10473357 3300006038 Bacteria 885
54 Ga0075365_10590500 3300006038 Bacteria 785
55 Ga0075363_100079405 3300006048 Bacteria 1792
56 Ga0075363_100417217 3300006048 Bacteria 790
57 Ga0075363_100576973 3300006048 Bacteria 672
58 Ga0075364_10069582 3300006051 Bacteria 2316
59 Ga0075364_10119664 3300006051 Bacteria 1762
60 Ga0075364_10183516 3300006051 Bacteria 1416
61 Ga0075364_10203693 3300006051 Bacteria 1341
62 Ga0075364_10699965 3300006051 Bacteria 691
63 Ga0075432_10002848 3300006058 Bacteria 5807
64 Ga0075432_10060883 3300006058 Bacteria 1344
65 Ga0075362_10068155 3300006177 Bacteria 1620
66 Ga0075367_10207925 3300006178 Bacteria 1223
67 Ga0075367_10458981 3300006178 Bacteria 807
68 Ga0075369_10085041 3300006186 Bacteria 1406
69 Ga0075366_10185048 3300006195 Bacteria 1265
70 Ga0097621_101258818 3300006237 Bacteria 698
71 Ga0075370_10277994 3300006353 Bacteria 994
72 Ga0075428_100007971 3300006844 Bacteria 11750
73 Ga0075428_100010442 3300006844 Bacteria 10313
74 Ga0075428_100050387 3300006844 Bacteria 4567
75 Ga0075428_100142831 3300006844 Bacteria 2602
76 Ga0075428_100679155 3300006844 Bacteria 1097
77 Ga0075430_100000285 3300006846 Bacteria 35539
78 Ga0075430_100004496 3300006846 Bacteria 11750
79 Ga0075430_100006208 3300006846 Bacteria 10075
80 Ga0075430_100018701 3300006846 Bacteria 5896
81 Ga0075431_100000899 3300006847 Bacteria 26201
82 Ga0075431_100014147 3300006847 Bacteria 8068
83 Ga0075431_100021761 3300006847 Bacteria 6556
84 Ga0075431_100034918 3300006847 Bacteria 5179
85 Ga0075431_100039453 3300006847 Bacteria 4864
86 Ga0075433_10051351 3300006852 Bacteria 3590
87 Ga0075433_10324294 3300006852 Bacteria 1362
88 Ga0075434_100025716 3300006871 Bacteria 5762
89 Ga0075434_100027895 3300006871 Bacteria 5543
90 Ga0075429_100000228 3300006880 Bacteria 38162
91 Ga0075429_100001166 3300006880 Bacteria 21212
92 Ga0075429_100004700 3300006880 Bacteria 11750
93 Ga0075429_100118891 3300006880 Bacteria 2309
94 Ga0075429_100127604 3300006880 Bacteria 2224
95 Ga0075429_100275140 3300006880 Bacteria 1474
96 Ga0075429_100461167 3300006880 Bacteria 1113
97 Ga0068865_100379067 3300006881 Bacteria 1153
98 Ga0097620_100493310 3300006931 Bacteria 1320
99 Ga0097620_100934962 3300006931 Bacteria 951
100 Ga0111539_10028860 3300009094 Bacteria 6766
101 Ga0111539_10036756 3300009094 Bacteria 5918
102 Ga0111539_10174198 3300009094 Bacteria 2513
103 Ga0111539_10232698 3300009094 Bacteria 2146
104 Ga0105245_10022916 3300009098 Bacteria 5479
105 Ga0105245_10511606 3300009098 Bacteria 1218
106 Ga0114129_10013234 3300009147 Bacteria 11750
107 Ga0114129_10039220 3300009147 Bacteria 6678
108 Ga0114129_10039268 3300009147 Bacteria 6674
109 Ga0114129_10156852 3300009147 Bacteria 3112
110 Ga0114129_11564087 3300009147 Bacteria 808
111 Ga0105243_10004735 3300009148 Bacteria 10703
112 Ga0105243_10006064 3300009148 Bacteria 9346
113 Ga0105243_10456296 3300009148 Bacteria 1200
114 Ga0105248_10124853 3300009177 Bacteria 2903
115 Ga0105239_10505228 3300010375 Bacteria 1374
116 Ga0157369_10288257 3300013105 Bacteria 1709
117 Ga0157374_10753677 3300013296 Bacteria 988
118 Ga0157374_10869214 3300013296 Bacteria 919
119 Ga0157378_10081782 3300013297 Bacteria 2920
120 Ga0157375_10008438 3300013308 Bacteria 9023
121 Ga0157375_10247308 3300013308 Bacteria 1944
122 Ga0157375_10634625 3300013308 Bacteria 1225
123 Ga0157375_11034862 3300013308 Bacteria 959
124 Ga0163163_10006685 3300014325 Bacteria 10104
125 Ga0163163_10031271 3300014325 Bacteria 5137
126 Ga0163163_10680232 3300014325 Bacteria 1092
127 Ga0157380_10067605 3300014326 Bacteria 2878
128 Ga0157380_11676651 3300014326 Bacteria 693
129 Ga0182008_10013172 3300014497 Bacteria 4349
130 Ga0157379_10555321 3300014968 Bacteria 1069
131 Ga0157376_10714614 3300014969 Bacteria 1008
132 Ga0163161_10016026 3300017792 Bacteria 5231
133 Ga0206350_10800340 3300020080 Bacteria 736
134 Ga0213876_10169304 3300021384 Bacteria 1162
135 Ga0224572_1022914 3300024225 Bacteria 1200
136 Ga0207642_10070001 3300025899 Bacteria 1666
137 Ga0207688_10254436 3300025901 Bacteria 1064
138 Ga0207647_10006436 3300025904 Bacteria 8538
139 Ga0207645_10094364 3300025907 Bacteria 1926
140 Ga0207643_10000118 3300025908 Bacteria 53785
141 Ga0207684_10569888 3300025910 Bacteria 968
142 Ga0207707_10129024 3300025912 Bacteria 2211
143 Ga0207707_10266805 3300025912 Bacteria 1484
144 Ga0207649_10079383 3300025920 Bacteria 2120
145 Ga0207650_10002395 3300025925 Bacteria 13056
146 Ga0207650_10345626 3300025925 Bacteria 1223
147 Ga0207650_10469253 3300025925 Bacteria 1049
148 Ga0207659_10201067 3300025926 Bacteria 1591
149 Ga0207687_10078809 3300025927 Bacteria 2373
150 Ga0207687_10374566 3300025927 Bacteria 1165
151 Ga0207687_10733796 3300025927 Bacteria 840
152 Ga0207700_10379775 3300025928 Bacteria 1235
153 Ga0207644_10113690 3300025931 Bacteria 2050
154 Ga0207709_10091647 3300025935 Bacteria 1988
155 Ga0207709_10213924 3300025935 Bacteria 1385
156 Ga0207670_10138422 3300025936 Bacteria 1793
157 Ga0207669_10491005 3300025937 Bacteria 981
158 Ga0207691_10007702 3300025940 Bacteria 10364
159 Ga0207661_10173715 3300025944 Bacteria 1877
160 Ga0207679_10003258 3300025945 Bacteria 10029
161 Ga0207668_10361787 3300025972 Bacteria 1216
162 Ga0207668_10373508 3300025972 Bacteria 1198
163 Ga0207668_10423389 3300025972 Bacteria 1131
164 Ga0207658_10180622 3300025986 Bacteria 1746
165 Ga0207658_10399100 3300025986 Bacteria 1208
166 Ga0207703_10598697 3300026035 Bacteria 1043
167 Ga0207678_10008107 3300026067 Bacteria 9264
168 Ga0207708_10030576 3300026075 Bacteria 4083
169 Ga0207708_10750454 3300026075 Bacteria 837
170 Ga0207702_10094514 3300026078 Bacteria 2624
171 Ga0207702_10183444 3300026078 Bacteria 1929
172 Ga0207641_10085368 3300026088 Bacteria 2750
173 Ga0207648_10071203 3300026089 Bacteria 3030
174 Ga0207676_10000647 3300026095 Bacteria 27890
175 Ga0207676_10150304 3300026095 Bacteria 2005
176 Ga0207676_10815698 3300026095 Bacteria 911
177 Ga0207674_10019413 3300026116 Bacteria 7361
178 Ga0207675_100006310 3300026118 Bacteria 11252
179 Ga0207675_100177243 3300026118 Bacteria 2040
180 Ga0207675_100199739 3300026118 Bacteria 1920
181 Ga0207683_10271393 3300026121 Bacteria 1549
182 Ga0207683_10838882 3300026121 Bacteria 853
183 Ga0207698_10701952 3300026142 Bacteria 1007
184 Ga0207428_10000755 3300027907 Bacteria 36919
185 Ga0207428_10029499 3300027907 Bacteria 4546
186 Ga0268265_10071252 3300028380 Bacteria 2706
187 Ga0268264_10013231 3300028381 Bacteria 6791
188 Ga0268264_10034621 3300028381 Bacteria 4156
189 Ga0268264_10036210 3300028381 Bacteria 4064
190 Ga0268264_10182181 3300028381 Bacteria 1908
191 Ga0268264_10363733 3300028381 Bacteria 1381
192 Ga0268264_10408924 3300028381 Bacteria 1306
193 Ga0307517_10200393 3300028786 Bacteria 1249
194 Ga0265338_10033562 3300028800 Bacteria 4977
195 Ga0265338_10618612 3300028800 Bacteria 753
196 Ga0265770_1013611 3300030878 Bacteria 1219
197 Ga0265760_10034268 3300031090 Bacteria 1502
198 Ga0265327_10035923 3300031251 Bacteria 2731
199 Ga0316575_10023255 3300031665 Bacteria 2395
200 Ga0316579_10044489 3300031691 Bacteria 2068
201 Ga0316576_10037669 3300031727 Bacteria 3463
202 Ga0316578_10000790 3300031728 Bacteria 11689
203 Ga0316578_10004574 3300031728 Bacteria 6556
204 Ga0316577_10050872 3300031733 Bacteria 2313
205 Ga0316577_10066828 3300031733 Bacteria 2007
206 Ga0307416_101488321 3300032002 Bacteria 783
207 Ga0316580_10007998 3300032139 Bacteria 3161
208 Ga0316593_10004257 3300032168 Bacteria 3657
209 Ga0316586_1057154 3300033527 Bacteria 705
210 Ga0316596_1002269 3300033541 Bacteria 4079
211 Ga0373948_0004143 3300034817 Bacteria 2276
212 Ga0373944_0009816 3300035089 Bacteria 2602
213 Ga0373949_0011265 3300035090 Bacteria 1968
214 Ga0373951_0040210 3300035091 Bacteria 1126
215 Ga0373941_0061372 3300035115 Bacteria 1224
216 Ga0373943_0154181 3300035170 Bacteria 1246
217 Ga0373961_0018327 3300035241 Bacteria 1827
218 Ga0373962_0014564 3300035242 Bacteria 2005
219 Ga0316574_0010480 3300035398 Bacteria 5242
220 Ga0316574_0057335 3300035398 Bacteria 2438
221 Ga0373927_0000686 3300035695 Bacteria 25824
222 Ga0316582_0068021 3300036647 Bacteria 2299
223 Ga0316584_0004117 3300036712 Bacteria 9591
224 Ga0316584_0016208 3300036712 Bacteria 5342
225 Ga0373925_0005035 3300037068 Bacteria 9915
226 Ga0395899_0047414 3300037312 Bacteria 3199
227 Ga0395900_0759476 3300037418 Bacteria 899
228 Ga0395898_0037450 3300037466 Bacteria 4811
229 Ga0395905_0025006 3300037471 Bacteria 5632
230 Ga0395905_0090297 3300037471 Bacteria 2872
231 Ga0400485_01890 3300038735 Bacteria 4701
232 Ga0400483_076338 3300039062 Bacteria 1243
233 Ga0400483_122812 3300039062 Bacteria 1939
234 Ga0400483_217638 3300039062 Bacteria 24445
235 Ga0400483_218418 3300039062 Bacteria 42144
236 Ga0436365_1863882 3300039437 Bacteria 6798
237 Ga0436365_1909981 3300039437 Bacteria 2497
238 Ga0436360_0735077 3300039438 Bacteria 673
239 Ga0436362_0092792 3300039453 Bacteria 1387
240 Ga0436362_0296838 3300039453 Bacteria 4604
241 Ga0439466_0089179 3300041411 Bacteria 968
242 Ga0451802_0458473 3300041460 Bacteria 1006
243 Ga0451807_0095516 3300041486 Bacteria 677
244 Ga0451837_0071548 3300041494 Bacteria 1420
245 Ga0451837_0714092 3300041494 Bacteria 1561
246 Ga0439448_0005269 3300042005 Bacteria 3684
247 Ga0439448_0033463 3300042005 Bacteria 1640
248 Ga0439450_067765 3300042008 Bacteria 872
249 Ga0439456_060187 3300042013 Bacteria 834
250 Ga0439463_001342 3300042016 Bacteria 6565
251 Ga0439444_0027279 3300042437 Bacteria 1050
252 Ga0439464_0000848 3300042439 Bacteria 6778
253 Ga0451577_0007199 3300042876 Bacteria 10963
254 Ga0453684_0017333 3300044712 Bacteria 11163
255 Ga0495592_0364133 3300046454 Bacteria 924
256 Ga0495603_0033810 3300046455 Bacteria 3076
257 Ga0495591_024796 3300046458 Bacteria 1893
258 Ga0495664_0214813 3300046477 Bacteria 1165
259 Ga0495584_0139862 3300046491 Bacteria 1229
260 Ga0495594_0006316 3300046499 Bacteria 6095
261 Ga0495596_0086585 3300046500 Bacteria 1216
262 Ga0495607_0190881 3300046501 Bacteria 1020
263 Ga0495628_0310808 3300046516 Bacteria 1165
264 Ga0495631_0175170 3300046518 Bacteria 919
265 Ga0495642_0089116 3300046528 Bacteria 1305
266 Ga0495587_0150847 3300046536 Bacteria 1325
267 Ga0495645_0431335 3300046543 Bacteria 835
268 Ga0495659_0022021 3300046664 Bacteria 2151
269 Ga0495658_0150496 3300046683 Bacteria 1429
270 Ga0495669_0083899 3300046684 Bacteria 1465
271 Ga0495670_0134029 3300046691 Bacteria 1292
272 Ga0495581_0476617 3300047315 Bacteria 726
273 Ga0495679_055452 3300047446 Bacteria 1177
274 Ga0495681_0116579 3300047470 Bacteria 1151
275 Ga0495614_0327784 3300048089 Bacteria 711
276 Ga0496100_0615710 3300048903 Bacteria 844
277 Ga0496102_0534751 3300048905 Bacteria 1095
278 Ga0496102_0605003 3300048905 Bacteria 1019
279 Ga0496104_0337624 3300048907 Bacteria 1420
280 Ga0496108_0009206 3300048911 Bacteria 7994
281 Ga0496108_0032489 3300048911 Bacteria 4335
282 Ga0496108_1359662 3300048911 Bacteria 595
283 Ga0496109_0010105 3300048912 Bacteria 8051
284 Ga0496109_0127108 3300048912 Bacteria 2377
285 Ga0496109_0165488 3300048912 Bacteria 2073
286 Ga0496109_0674954 3300048912 Bacteria 971
287 Ga0496110_0075013 3300048913 Bacteria 3005
288 Ga0496110_0093866 3300048913 Bacteria 2686
289 Ga0496110_0670647 3300048913 Bacteria 937
290 Ga0496111_0302296 3300048914 Bacteria 1186
291 Ga0496113_0010377 3300048916 Bacteria 6157
292 Ga0496113_0244863 3300048916 Bacteria 1431
293 Ga0496113_0572054 3300048916 Bacteria 906
294 Ga0496114_0042364 3300048917 Bacteria 3774
295 Ga0496114_0161467 3300048917 Bacteria 1949
296 Ga0496114_0329143 3300048917 Bacteria 1350
297 Ga0501031_0020256 3300049568 Bacteria 4337
298 Ga0501031_0175867 3300049568 Bacteria 1398
299 Ga0501032_0002622 3300049569 Bacteria 14061
300 Ga0501033_0007082 3300049570 Bacteria 8756
301 Ga0501033_0065847 3300049570 Bacteria 2665
302 Ga0501033_0467551 3300049570 Bacteria 875
303 Ga0501034_0003206 3300049571 Bacteria 18765
304 Ga0501034_0004900 3300049571 Bacteria 14756
305 Ga0501034_0051197 3300049571 Bacteria 4164
306 Ga0501034_0126128 3300049571 Bacteria 2545
307 Ga0501034_0821187 3300049571 Bacteria 821
308 Ga0501036_0014785 3300049572 Bacteria 6510
309 Ga0501036_0016080 3300049572 Bacteria 6252
310 Ga0501036_0043183 3300049572 Bacteria 3817
311 Ga0501036_0140310 3300049572 Bacteria 2039
312 Ga0501036_0386938 3300049572 Bacteria 1167
313 Ga0501037_0003123 3300049573 Bacteria 12009
314 Ga0501037_0277045 3300049573 Bacteria 1169
315 Ga0501038_0018247 3300049574 Bacteria 6334
316 Ga0501038_0038011 3300049574 Bacteria 4217
317 Ga0501038_0119136 3300049574 Bacteria 2179
318 Ga0501038_0171112 3300049574 Bacteria 1758
319 Ga0501038_0326395 3300049574 Bacteria 1200
320 Ga0501039_0002563 3300049575 Bacteria 13562
321 Ga0501039_0013552 3300049575 Bacteria 6235
322 Ga0501039_0178474 3300049575 Bacteria 1670
323 Ga0501040_0002053 3300049576 Bacteria 12978
324 Ga0501040_0011866 3300049576 Bacteria 5701
325 Ga0501040_0013956 3300049576 Bacteria 5290
326 Ga0501040_0031261 3300049576 Bacteria 3597
327 Ga0501041_0009630 3300049577 Bacteria 5696
328 Ga0501041_0018833 3300049577 Bacteria 4111
329 Ga0501041_0025638 3300049577 Bacteria 3543
330 Ga0501041_0092489 3300049577 Bacteria 1867
331 Ga0501042_0004476 3300049578 Bacteria 8913
332 Ga0501042_0012903 3300049578 Bacteria 5675
333 Ga0501042_0013371 3300049578 Bacteria 5584
334 Ga0501042_0064752 3300049578 Bacteria 2612
335 Ga0501042_0176214 3300049578 Bacteria 1542
336 Ga0501043_0057348 3300049579 Bacteria 3059
337 Ga0501043_0066703 3300049579 Bacteria 2826
338 Ga0501043_0223516 3300049579 Bacteria 1456
339 Ga0501046_0030593 3300049580 Bacteria 4368
340 Ga0501046_0046282 3300049580 Bacteria 3453
341 Ga0501047_0144851 3300049581 Bacteria 2253
342 Ga0501047_0435056 3300049581 Bacteria 1142
343 Ga0501047_0732298 3300049581 Bacteria 805
344 Ga0501048_0004571 3300049582 Bacteria 10528
345 Ga0501048_0007798 3300049582 Bacteria 8118
346 Ga0501048_0030590 3300049582 Bacteria 3895
347 Ga0501048_0053488 3300049582 Bacteria 2871
348 Ga0501048_0367333 3300049582 Bacteria 1027
349 Ga0501067_0214756 3300049583 Bacteria 1071
350 Ga0501068_0005345 3300049584 Bacteria 7020
351 Ga0501068_0050905 3300049584 Bacteria 2505
352 Ga0501068_0053272 3300049584 Bacteria 2449
353 Ga0501068_0159931 3300049584 Bacteria 1419
354 Ga0501068_0252665 3300049584 Bacteria 1124
355 Ga0501070_0078524 3300049586 Bacteria 2731
356 Ga0501070_0151858 3300049586 Bacteria 1911
357 Ga0501071_0005915 3300049587 Bacteria 7914
358 Ga0501071_0018369 3300049587 Bacteria 4840
359 Ga0501071_0059569 3300049587 Bacteria 2762
360 Ga0501072_0000404 3300049588 Bacteria 30870
361 Ga0501072_0015537 3300049588 Bacteria 5832
362 Ga0501072_0015662 3300049588 Bacteria 5811
363 Ga0501072_0215624 3300049588 Bacteria 1530
364 Ga0501072_0645641 3300049588 Bacteria 833
365 Ga0501074_0042273 3300049590 Bacteria 3298
366 Ga0501074_0101434 3300049590 Bacteria 2060
367 Ga0501074_0312170 3300049590 Bacteria 1117
368 Ga0501075_0002249 3300049591 Bacteria 12793
369 Ga0501075_0003133 3300049591 Bacteria 11058
370 Ga0501075_0004688 3300049591 Bacteria 9283
371 Ga0501076_0002476 3300049592 Bacteria 12692
372 Ga0501076_0007602 3300049592 Bacteria 7891
373 Ga0501076_0012269 3300049592 Bacteria 6408
374 Ga0501076_0148865 3300049592 Bacteria 1904
375 Ga0501077_0006635 3300049593 Bacteria 7107
376 Ga0501077_0010895 3300049593 Bacteria 5665
377 Ga0501077_0077464 3300049593 Bacteria 2106
378 Ga0501079_0016993 3300049741 Bacteria 5557
379 Ga0501079_0017365 3300049741 Bacteria 5495
380 Ga0501079_0046905 3300049741 Bacteria 3334
381 Ga0501079_0085952 3300049741 Bacteria 2434
382 Ga0501080_0007063 3300049742 Bacteria 10140
383 Ga0501080_0084299 3300049742 Bacteria 2953
384 Ga0501080_0163200 3300049742 Bacteria 2057
385 Ga0501080_0456508 3300049742 Bacteria 1145
386 Ga0501081_0006867 3300049743 Bacteria 7402
387 Ga0501081_0112831 3300049743 Bacteria 1930
388 Ga0501081_0139545 3300049743 Bacteria 1736
389 Ga0501081_0714572 3300049743 Bacteria 752
390 Ga0501083_0060423 3300049744 Bacteria 2532
391 Ga0501035_0098363 3300049822 Bacteria 2569
392 Ga0501035_0302501 3300049822 Bacteria 1347
393 Ga0501044_0005788 3300049823 Bacteria 13687
394 Ga0501044_0007378 3300049823 Bacteria 12090
395 Ga0501044_0855362 3300049823 Bacteria 786
396 Ga0501045_0002201 3300049824 Bacteria 13214
397 Ga0501045_0012325 3300049824 Bacteria 6019
398 Ga0501045_0107879 3300049824 Bacteria 2063
399 Ga0501045_0273154 3300049824 Bacteria 1258
400 nmdc:mga00v17_33307_c1 3300050491 Bacteria 3053
401 nmdc:mga00v17_435350_c1 3300050491 Bacteria 852
402 nmdc:mga00v17_459960_c1 3300050491 Bacteria 826
403 nmdc:mga0yw44_15450_c1 3300050492 Bacteria 4091
404 nmdc:mga0yw44_281760_c1 3300050492 Bacteria 1111
405 nmdc:mga0yw44_352288_c1 3300050492 Bacteria 991
406 nmdc:mga0yw44_429563_c1 3300050492 Bacteria 895
407 nmdc:mga0k408_368863_c1 3300050493 Bacteria 855
408 nmdc:mga06z11_480615_c1 3300050494 Bacteria 752
409 nmdc:mga05p37_12934_c1 3300050507 Bacteria 9983
410 nmdc:mga05p37_171_c1 3300050507 Bacteria 63303
411 nmdc:mga05p37_17264_c1 3300050507 Bacteria 8706
412 nmdc:mga05p37_33504_c1 3300050507 Bacteria 6292
413 nmdc:mga05p37_41972_c1 3300050507 Bacteria 5619
414 nmdc:mga05p37_47080_c1 3300050507 Bacteria 5303
415 nmdc:mga09592_13664_c1 3300050508 Bacteria 6635
416 nmdc:mga09592_183_c1 3300050508 Bacteria 44709
417 nmdc:mga09592_27861_c1 3300050508 Bacteria 4689
418 nmdc:mga09592_565_c1 3300050508 Bacteria 28059
419 nmdc:mga0qj67_15087_c1 3300050509 Bacteria 5847
420 nmdc:mga0qj67_234918_c1 3300050509 Bacteria 1488
421 nmdc:mga0qj67_2649_c1 3300050509 Bacteria 12826
422 nmdc:mga0qj67_5012_c1 3300050509 Bacteria 9622
423 nmdc:mga0qj67_66709_c1 3300050509 Bacteria 2867
424 nmdc:mga06r32_147331_c1 3300050510 Bacteria 2332
425 nmdc:mga06r32_182281_c1 3300050510 Bacteria 2086
426 nmdc:mga06r32_32845_c1 3300050510 Bacteria 4886
427 nmdc:mga06r32_342_c1 3300050510 Bacteria 38838
428 nmdc:mga06r32_35398_c1 3300050510 Bacteria 4712
429 nmdc:mga06r32_458714_c1 3300050510 Bacteria 1254
430 nmdc:mga06r32_72641_c1 3300050510 Bacteria 3331
431 nmdc:mga08y16_145299_c1 3300050511 Bacteria 2466
432 nmdc:mga08y16_160248_c1 3300050511 Bacteria 2338
433 nmdc:mga08y16_74751_c1 3300050511 Bacteria 3532
434 nmdc:mga08y16_941816_c1 3300050511 Bacteria 847
435 nmdc:mga0n895_34981_c1 3300050512 Bacteria 4840
436 nmdc:mga0n895_35003_c1 3300050512 Bacteria 4838
437 nmdc:mga0a205_3780_c1 3300050515 Bacteria 13551
438 nmdc:mga0a205_55881_c1 3300050515 Bacteria 3812
439 Ga0495601_0664394 3300053077 Bacteria 666
440 Ga0495655_0101103 3300053083 Bacteria 854
441 Ga0500646_0046580 3300053090 Bacteria 1238
442 Ga0500562_091170 3300053108 Bacteria 827
443 Ga0500568_0000029 3300053139 Bacteria 159927
444 Ga0500616_0001847 3300053153 Bacteria 19181
445 Ga0501084_0004976 3300054114 Bacteria 10867
446 Ga0501084_0009653 3300054114 Bacteria 7984
447 Ga0501084_0072401 3300054114 Bacteria 2886
448 Ga0501084_0328882 3300054114 Bacteria 1291
449 Ga0590077_014088 3300059426 Bacteria 1664
450 Ga0501082_0015305 3300060353 Bacteria 6604
451 Ga0501082_0018922 3300060353 Bacteria 5933
452 Ga0501082_0052772 3300060353 Bacteria 3505
453 Ga0530510_0008315 3300061734 Bacteria 7237
454 Ga0530510_0010134 3300061734 Bacteria 6605
455 Ga0530510_0010398 3300061734 Bacteria 6523
456 Ga0530510_0015394 3300061734 Bacteria 5405
457 Ga0530510_0293994 3300061734 Bacteria 1215
458 Ga0501040_0177728
459 JGI24751J29686_10000650
460 JGI24751J29686_10003292
461 Ga0070683_100265522
462 Ga0070670_100211244
463 Ga0070670_100353015
464 Ga0070677_10017280
465 Ga0070689_100600956
466 Ga0070661_100020772
467 Ga0070661_100103545
468 Ga0070668_100034448
469 Ga0070669_100180100
470 Ga0070675_100017277
471 Ga0070675_100046841
472 Ga0070671_100145747
473 Ga0070674_100211113
474 Ga0070667_100252409
475 Ga0070713_100060396
476 Ga0070700_100037510
477 Ga0070700_100354742
478 Ga0070663_100114935
479 Ga0070663_100651500
480 Ga0070681_10394276
481 Ga0070685_10243073
482 Ga0070685_10723163
483 Ga0070706_100148861
484 Ga0070706_100309684
485 Ga0070699_100157536
486 Ga0070684_100032950
487 Ga0070672_100151494
488 Ga0070664_100023793
489 Ga0068857_100222221
490 Ga0068856_100052395
491 Ga0070702_100052749
492 Ga0068852_101304803
493 Ga0068859_100935050
494 Ga0068861_100008806
495 Ga0068861_100157413
496 Ga0068870_10000375
497 Ga0068863_100013521
498 Ga0068863_100520490
499 Ga0068860_100049813
500 Ga0068860_100080554
501 Ga0068860_100349414
502 Ga0068860_100778047
503 Ga0068862_100053766
504 Ga0081455_10001246
505 Ga0081455_10006029
506 Ga0081455_10019312
507 Ga0081455_10073568
508 Ga0081455_10228915
509 Ga0081538_10027452
510 Ga0075365_10473357
511 Ga0075365_10590500
512 Ga0075363_100079405
513 Ga0075363_100417217
514 Ga0075363_100576973
515 Ga0075364_10069582
516 Ga0075364_10119664
517 Ga0075364_10183516
518 Ga0075364_10203693
519 Ga0075364_10699965
520 Ga0075432_10002848
521 Ga0075432_10060883
522 Ga0075362_10068155
523 Ga0075367_10207925
524 Ga0075367_10458981
525 Ga0075369_10085041
526 Ga0075366_10185048
527 Ga0097621_101258818
528 Ga0075370_10277994
529 Ga0075428_100007971
530 Ga0075428_100010442
531 Ga0075428_100050387
532 Ga0075428_100142831
533 Ga0075428_100679155
534 Ga0075430_100000285
535 Ga0075430_100004496
536 Ga0075430_100006208
537 Ga0075430_100018701
538 Ga0075431_100000899
539 Ga0075431_100014147
540 Ga0075431_100021761
541 Ga0075431_100034918
542 Ga0075431_100039453
543 Ga0075433_10051351
544 Ga0075433_10324294
545 Ga0075434_100025716
546 Ga0075434_100027895
547 Ga0075429_100000228
548 Ga0075429_100001166
549 Ga0075429_100004700
550 Ga0075429_100118891
551 Ga0075429_100127604
552 Ga0075429_100275140
553 Ga0075429_100461167
554 Ga0068865_100379067
555 Ga0097620_100493310
556 Ga0097620_100934962
557 Ga0111539_10028860
558 Ga0111539_10036756
559 Ga0111539_10174198
560 Ga0111539_10232698
561 Ga0105245_10022916
562 Ga0105245_10511606
563 Ga0114129_10013234
564 Ga0114129_10039220
565 Ga0114129_10039268
566 Ga0114129_10156852
567 Ga0114129_11564087
568 Ga0105243_10004735
569 Ga0105243_10006064
570 Ga0105243_10456296
571 Ga0105248_10124853
572 Ga0105239_10505228
573 Ga0157369_10288257
574 Ga0157374_10753677
575 Ga0157374_10869214
576 Ga0157378_10081782
577 Ga0157375_10008438
578 Ga0157375_10247308
579 Ga0157375_10634625
580 Ga0157375_11034862
581 Ga0163163_10006685
582 Ga0163163_10031271
583 Ga0163163_10680232
584 Ga0157380_10067605
585 Ga0157380_11676651
586 Ga0182008_10013172
587 Ga0157379_10555321
588 Ga0157376_10714614
589 Ga0163161_10016026
590 Ga0206350_10800340
591 Ga0213876_10169304
592 Ga0224572_1022914
593 Ga0207642_10070001
594 Ga0207688_10254436
595 Ga0207647_10006436
596 Ga0207645_10094364
597 Ga0207643_10000118
598 Ga0207684_10569888
599 Ga0207707_10129024
600 Ga0207707_10266805
601 Ga0207649_10079383
602 Ga0207650_10002395
603 Ga0207650_10345626
604 Ga0207650_10469253
605 Ga0207659_10201067
606 Ga0207687_10078809
607 Ga0207687_10374566
608 Ga0207687_10733796
609 Ga0207700_10379775
610 Ga0207644_10113690
611 Ga0207709_10091647
612 Ga0207709_10213924
613 Ga0207670_10138422
614 Ga0207669_10491005
615 Ga0207691_10007702
616 Ga0207661_10173715
617 Ga0207679_10003258
618 Ga0207668_10361787
619 Ga0207668_10373508
620 Ga0207668_10423389
621 Ga0207658_10180622
622 Ga0207658_10399100
623 Ga0207703_10598697
624 Ga0207678_10008107
625 Ga0207708_10030576
626 Ga0207708_10750454
627 Ga0207702_10094514
628 Ga0207702_10183444
629 Ga0207641_10085368
630 Ga0207648_10071203
631 Ga0207676_10000647
632 Ga0207676_10150304
633 Ga0207676_10815698
634 Ga0207674_10019413
635 Ga0207675_100006310
636 Ga0207675_100177243
637 Ga0207675_100199739
638 Ga0207683_10271393
639 Ga0207683_10838882
640 Ga0207698_10701952
641 Ga0207428_10000755
642 Ga0207428_10029499
643 Ga0268265_10071252
644 Ga0268264_10013231
645 Ga0268264_10034621
646 Ga0268264_10036210
647 Ga0268264_10182181
648 Ga0268264_10363733
649 Ga0268264_10408924
650 Ga0307517_10200393
651 Ga0265338_10033562
652 Ga0265338_10618612
653 Ga0265770_1013611
654 Ga0265760_10034268
655 Ga0265327_10035923
656 Ga0316575_10023255
657 Ga0316579_10044489
658 Ga0316576_10037669
659 Ga0316578_10000790
660 Ga0316578_10004574
661 Ga0316577_10050872
662 Ga0316577_10066828
663 Ga0307416_101488321
664 Ga0316580_10007998
665 Ga0316593_10004257
666 Ga0316586_1057154
667 Ga0316596_1002269
668 Ga0373948_0004143
669 Ga0373944_0009816
670 Ga0373949_0011265
671 Ga0373951_0040210
672 Ga0373941_0061372
673 Ga0373943_0154181
674 Ga0373961_0018327
675 Ga0373962_0014564
676 Ga0316574_0010480
677 Ga0316574_0057335
678 Ga0373927_0000686
679 Ga0316582_0068021
680 Ga0316584_0004117
681 Ga0316584_0016208
682 Ga0373925_0005035
683 Ga0395899_0047414
684 Ga0395900_0759476
685 Ga0395898_0037450
686 Ga0395905_0025006
687 Ga0395905_0090297
688 Ga0400485_01890
689 Ga0400483_076338
690 Ga0400483_122812
691 Ga0400483_217638
692 Ga0400483_218418
693 Ga0436365_1863882
694 Ga0436365_1909981
695 Ga0436360_0735077
696 Ga0436362_0092792
697 Ga0436362_0296838
698 Ga0439466_0089179
699 Ga0451802_0458473
700 Ga0451807_0095516
701 Ga0451837_0071548
702 Ga0451837_0714092
703 Ga0439448_0005269
704 Ga0439448_0033463
705 Ga0439450_067765
706 Ga0439456_060187
707 Ga0439463_001342
708 Ga0439444_0027279
709 Ga0439464_0000848
710 Ga0451577_0007199
711 Ga0453684_0017333
712 Ga0495592_0364133
713 Ga0495603_0033810
714 Ga0495591_024796
715 Ga0495664_0214813
716 Ga0495584_0139862
717 Ga0495594_0006316
718 Ga0495596_0086585
719 Ga0495607_0190881
720 Ga0495628_0310808
721 Ga0495631_0175170
722 Ga0495642_0089116
723 Ga0495587_0150847
724 Ga0495645_0431335
725 Ga0495659_0022021
726 Ga0495658_0150496
727 Ga0495669_0083899
728 Ga0495670_0134029
729 Ga0495581_0476617
730 Ga0495679_055452
731 Ga0495681_0116579
732 Ga0495614_0327784
733 Ga0496100_0615710
734 Ga0496102_0534751
735 Ga0496102_0605003
736 Ga0496104_0337624
737 Ga0496108_0009206
738 Ga0496108_0032489
739 Ga0496108_1359662
740 Ga0496109_0010105
741 Ga0496109_0127108
742 Ga0496109_0165488
743 Ga0496109_0674954
744 Ga0496110_0075013
745 Ga0496110_0093866
746 Ga0496110_0670647
747 Ga0496111_0302296
748 Ga0496113_0010377
749 Ga0496113_0244863
750 Ga0496113_0572054
751 Ga0496114_0042364
752 Ga0496114_0161467
753 Ga0496114_0329143
754 Ga0501031_0020256
755 Ga0501031_0175867
756 Ga0501032_0002622
757 Ga0501033_0007082
758 Ga0501033_0065847
759 Ga0501033_0467551
760 Ga0501034_0003206
761 Ga0501034_0004900
762 Ga0501034_0051197
763 Ga0501034_0126128
764 Ga0501034_0821187
765 Ga0501036_0014785
766 Ga0501036_0016080
767 Ga0501036_0043183
768 Ga0501036_0140310
769 Ga0501036_0386938
770 Ga0501037_0003123
771 Ga0501037_0277045
772 Ga0501038_0018247
773 Ga0501038_0038011
774 Ga0501038_0119136
775 Ga0501038_0171112
776 Ga0501038_0326395
777 Ga0501039_0002563
778 Ga0501039_0013552
779 Ga0501039_0178474
780 Ga0501040_0002053
781 Ga0501040_0011866
782 Ga0501040_0013956
783 Ga0501040_0031261
784 Ga0501041_0009630
785 Ga0501041_0018833
786 Ga0501041_0025638
787 Ga0501041_0092489
788 Ga0501042_0004476
789 Ga0501042_0012903
790 Ga0501042_0013371
791 Ga0501042_0064752
792 Ga0501042_0176214
793 Ga0501043_0057348
794 Ga0501043_0066703
795 Ga0501043_0223516
796 Ga0501046_0030593
797 Ga0501046_0046282
798 Ga0501047_0144851
799 Ga0501047_0435056
800 Ga0501047_0732298
801 Ga0501048_0004571
802 Ga0501048_0007798
803 Ga0501048_0030590
804 Ga0501048_0053488
805 Ga0501048_0367333
806 Ga0501067_0214756
807 Ga0501068_0005345
808 Ga0501068_0050905
809 Ga0501068_0053272
810 Ga0501068_0159931
811 Ga0501068_0252665
812 Ga0501070_0078524
813 Ga0501070_0151858
814 Ga0501071_0005915
815 Ga0501071_0018369
816 Ga0501071_0059569
817 Ga0501072_0000404
818 Ga0501072_0015537
819 Ga0501072_0015662
820 Ga0501072_0215624
821 Ga0501072_0645641
822 Ga0501074_0042273
823 Ga0501074_0101434
824 Ga0501074_0312170
825 Ga0501075_0002249
826 Ga0501075_0003133
827 Ga0501075_0004688
828 Ga0501076_0002476
829 Ga0501076_0007602
830 Ga0501076_0012269
831 Ga0501076_0148865
832 Ga0501077_0006635
833 Ga0501077_0010895
834 Ga0501077_0077464
835 Ga0501079_0016993
836 Ga0501079_0017365
837 Ga0501079_0046905
838 Ga0501079_0085952
839 Ga0501080_0007063
840 Ga0501080_0084299
841 Ga0501080_0163200
842 Ga0501080_0456508
843 Ga0501081_0006867
844 Ga0501081_0112831
845 Ga0501081_0139545
846 Ga0501081_0714572
847 Ga0501083_0060423
848 Ga0501035_0098363
849 Ga0501035_0302501
850 Ga0501044_0005788
851 Ga0501044_0007378
852 Ga0501044_0855362
853 Ga0501045_0002201
854 Ga0501045_0012325
855 Ga0501045_0107879
856 Ga0501045_0273154
857 nmdc:mga00v17_33307_c1
858 nmdc:mga00v17_435350_c1
859 nmdc:mga00v17_459960_c1
860 nmdc:mga0yw44_15450_c1
861 nmdc:mga0yw44_281760_c1
862 nmdc:mga0yw44_352288_c1
863 nmdc:mga0yw44_429563_c1
864 nmdc:mga0k408_368863_c1
865 nmdc:mga06z11_480615_c1
866 nmdc:mga05p37_12934_c1
867 nmdc:mga05p37_171_c1
868 nmdc:mga05p37_17264_c1
869 nmdc:mga05p37_33504_c1
870 nmdc:mga05p37_41972_c1
871 nmdc:mga05p37_47080_c1
872 nmdc:mga09592_13664_c1
873 nmdc:mga09592_183_c1
874 nmdc:mga09592_27861_c1
875 nmdc:mga09592_565_c1
876 nmdc:mga0qj67_15087_c1
877 nmdc:mga0qj67_234918_c1
878 nmdc:mga0qj67_2649_c1
879 nmdc:mga0qj67_5012_c1
880 nmdc:mga0qj67_66709_c1
881 nmdc:mga06r32_147331_c1
882 nmdc:mga06r32_182281_c1
883 nmdc:mga06r32_32845_c1
884 nmdc:mga06r32_342_c1
885 nmdc:mga06r32_35398_c1
886 nmdc:mga06r32_458714_c1
887 nmdc:mga06r32_72641_c1
888 nmdc:mga08y16_145299_c1
889 nmdc:mga08y16_160248_c1
890 nmdc:mga08y16_74751_c1
891 nmdc:mga08y16_941816_c1
892 nmdc:mga0n895_34981_c1
893 nmdc:mga0n895_35003_c1
894 nmdc:mga0a205_3780_c1
895 nmdc:mga0a205_55881_c1
896 Ga0495601_0664394
897 Ga0495655_0101103
898 Ga0500646_0046580
899 Ga0500562_091170
900 Ga0500568_0000029
901 Ga0500616_0001847
902 Ga0501084_0004976
903 Ga0501084_0009653
904 Ga0501084_0072401
905 Ga0501084_0328882
906 Ga0590077_014088
907 Ga0501082_0015305
908 Ga0501082_0018922
909 Ga0501082_0052772
910 Ga0530510_0008315
911 Ga0530510_0010134
912 Ga0530510_0010398
913 Ga0530510_0015394
914 Ga0530510_0293994

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00333

Ribosomal_S5

Ribosomal protein S5, N-terminal domain

13

77

0.98

PF03719

Ribosomal_S5_C

Ribosomal protein S5, C-terminal domain

89

159

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zto-assembly1.cif.gz_AE e. coli 70s-rnap expressome complex in uncoupled state 1 0.9775 13 167
8byv-assembly1.cif.gz_e cryo-em structure of a staphylococus aureus 30s-rbfa complex 0.9755 13 165
8buu-assembly1.cif.gz_e are-abcf vmlr2 bound to a 70s ribosome 0.9751 13 165
5u4j-assembly1.cif.gz_e structural basis of co-translational quality control by arfa and rf2 bound to ribosome 0.9736 13 146
7p7t-assembly1.cif.gz_f poxta-eq2 antibiotic resistance abcf bound to e. faecalis 70s ribosome, state iii 0.9718 13 167
ID Description Score Start End Superfamily
af_A0A146M1R1_669_734_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9799 12 72 3.30.160.20
af_Q25815_90_159_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9683 12 74 3.30.160.20
af_C0PEC4_230_319_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9671 81 167 3.30.230.10
af_Q93425_147_216_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9627 12 74 3.30.160.20
af_Q6GKU7_423_512_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9563 85 161 3.30.230.10
ID Description Score Start End GO Terms
AF-F0SY25-F1-model_v4 Small ribosomal subunit protein uS5 0.9825 13 166 GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A6L7VTK8-F1-model_v4 Small ribosomal subunit protein uS5 0.9796 11 166 GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A1J5CYC8-F1-model_v4 Small ribosomal subunit protein uS5 0.9794 14 166 GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A0C1ZXE4-F1-model_v4 Small ribosomal subunit protein uS5 0.9786 14 165 GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A3G2FN95-F1-model_v4 deleted 0.9785 13 166

Map