F448059

General Info

Members Datasets Scaffolds Average Seq Length
457 265 914 122

Family's Representative Sequence

Representative Sequence 3300046678|Ga0495599_0119116|Ga0495599_0119116_141_533
Length 130
Sequence MAGQIVHFEIPADDTGAGQAFWGSLFGWEFQAFPGPFEYHMTRIGEQTGAAITNMEPGKRGTRAYFSVDEINAGAARVRELGGQAGDPMPVPGMGWFSTCTDPQGNEFGLWQNDEAAPTPDMEPWPHSMW

Samples

Sample ID Description Type Environment
1 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
144 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
145 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
148 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
149 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
152 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
172 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
173 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
174 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
177 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
198 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
211 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
212 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
213 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
250 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
251 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
260 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
265 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 13.57
Rhizosphere 85.56
Stem 0
Stem Tuber 0
Unclassified 16.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495599_0119116 3300046678 Bacteria 1641
2 JGI25407J50210_10138582 3300003373 Unclassified 599
3 JGI25404J52841_10065176 3300003659 Unclassified 762
4 Ga0070683_100296501 3300005329 Bacteria 1538
5 Ga0070690_100153293 3300005330 Bacteria 1574
6 Ga0070670_100052110 3300005331 Bacteria 3515
7 Ga0070680_101201313 3300005336 Bacteria 656
8 Ga0070682_100014320 3300005337 Bacteria 4581
9 Ga0068868_100034851 3300005338 Bacteria 3887
10 Ga0070660_100082565 3300005339 Bacteria 2523
11 Ga0070691_10089475 3300005341 Bacteria 1516
12 Ga0070661_100339697 3300005344 Unclassified 1176
13 Ga0070675_100359665 3300005354 Bacteria 1292
14 Ga0070671_100418329 3300005355 Bacteria 1148
15 Ga0070671_101630126 3300005355 Unclassified 572
16 Ga0070674_100365140 3300005356 Bacteria 1170
17 Ga0070673_100137705 3300005364 Bacteria 2057
18 Ga0070688_100375352 3300005365 Bacteria 1047
19 Ga0070659_100020617 3300005366 Bacteria 5010
20 Ga0070659_100301241 3300005366 Bacteria 1337
21 Ga0070709_10103716 3300005434 Unclassified 1899
22 Ga0070714_100152209 3300005435 Bacteria 2085
23 Ga0070714_101564361 3300005435 Unclassified 644
24 Ga0070713_102189180 3300005436 Bacteria 536
25 Ga0070710_10000411 3300005437 Bacteria 20167
26 Ga0070701_10633170 3300005438 Unclassified 712
27 Ga0070701_10759545 3300005438 Bacteria 658
28 Ga0070711_100047057 3300005439 Bacteria 2943
29 Ga0070711_100099651 3300005439 Bacteria 2111
30 Ga0070711_101013610 3300005439 Bacteria 713
31 Ga0070705_101937129 3300005440 Unclassified 502
32 Ga0070700_100582205 3300005441 Bacteria 874
33 Ga0070694_100911708 3300005444 Bacteria 726
34 Ga0070708_100187501 3300005445 Bacteria 1934
35 Ga0070663_100154040 3300005455 Bacteria 1765
36 Ga0070678_100104207 3300005456 Bacteria 2205
37 Ga0070662_100541129 3300005457 Bacteria 975
38 Ga0070681_10178374 3300005458 Bacteria 2046
39 Ga0068867_100129844 3300005459 Unclassified 1957
40 Ga0070685_10343154 3300005466 Bacteria 1019
41 Ga0070706_100081410 3300005467 Bacteria 2998
42 Ga0070706_101271649 3300005467 Bacteria 675
43 Ga0070707_100073045 3300005468 Plasmid 3307
44 Ga0070698_101047567 3300005471 Bacteria 763
45 Ga0070699_100000512 3300005518 Bacteria 36772
46 Ga0070699_100168309 3300005518 Bacteria 1941
47 Ga0070679_100194220 3300005530 Bacteria 1998
48 Ga0070679_100338145 3300005530 Bacteria 1454
49 Ga0070684_100003093 3300005535 Bacteria 12417
50 Ga0070684_100831223 3300005535 Bacteria 864
51 Ga0070697_100935543 3300005536 Bacteria 769
52 Ga0070686_100319856 3300005544 Unclassified 1156
53 Ga0070696_100077293 3300005546 Unclassified 2352
54 Ga0070696_100562507 3300005546 Bacteria 915
55 Ga0070696_101467301 3300005546 Bacteria 583
56 Ga0070693_100051115 3300005547 Bacteria 2366
57 Ga0070665_100577911 3300005548 Bacteria 1136
58 Ga0068855_100006714 3300005563 Bacteria 13965
59 Ga0070664_100165160 3300005564 Bacteria 1961
60 Ga0070664_100710573 3300005564 Unclassified 937
61 Ga0068857_100002942 3300005577 Bacteria 14031
62 Ga0068856_100011679 3300005614 Bacteria 8518
63 Ga0068859_101573252 3300005617 Bacteria 726
64 Ga0068859_101845381 3300005617 Bacteria 668
65 Ga0068864_100249283 3300005618 Bacteria 1648
66 Ga0068866_10059444 3300005718 Bacteria 1978
67 Ga0068861_101136947 3300005719 Bacteria 752
68 Ga0068851_10088919 3300005834 Bacteria 1624
69 Ga0068870_10540186 3300005840 Bacteria 783
70 Ga0068858_101261804 3300005842 Bacteria 727
71 Ga0081538_10001565 3300005981 Bacteria 23471
72 Ga0081538_10001609 3300005981 Bacteria 23178
73 Ga0081538_10147152 3300005981 Bacteria 1074
74 Ga0081538_10147546 3300005981 Bacteria 1072
75 Ga0081540_1000418 3300005983 Bacteria 41960
76 Ga0070717_10010756 3300006028 Bacteria 6926
77 Ga0070717_10019014 3300006028 Bacteria 5379
78 Ga0070717_10109045 3300006028 Bacteria 2359
79 Ga0075365_10265960 3300006038 Bacteria 1206
80 Ga0070716_100097616 3300006173 Bacteria 1794
81 Ga0070716_100130172 3300006173 Bacteria 1589
82 Ga0070716_100529043 3300006173 Bacteria 875
83 Ga0070712_100121602 3300006175 Bacteria 1965
84 Ga0070712_100152779 3300006175 Bacteria 1774
85 Ga0070712_100454892 3300006175 Bacteria 1066
86 Ga0070712_100773278 3300006175 Unclassified 823
87 Ga0097621_100277861 3300006237 Bacteria 1474
88 Ga0068871_101420077 3300006358 Unclassified 655
89 Ga0075428_100183679 3300006844 Unclassified 2263
90 Ga0075434_100058062 3300006871 Bacteria 3846
91 Ga0068865_100013735 3300006881 Bacteria 5129
92 Ga0068865_100075530 3300006881 Unclassified 2403
93 Ga0075436_100119515 3300006914 Bacteria 1843
94 Ga0097620_101572849 3300006931 Bacteria 726
95 Ga0097620_101845450 3300006931 Bacteria 668
96 Ga0075435_100000942 3300007076 Bacteria 18348
97 Ga0105240_11740788 3300009093 Bacteria 650
98 Ga0105240_12100850 3300009093 Unclassified 586
99 Ga0111539_10112312 3300009094 Bacteria 3197
100 Ga0111539_10235165 3300009094 Bacteria 2133
101 Ga0105245_10088453 3300009098 Unclassified 2845
102 Ga0105247_10006119 3300009101 Bacteria 7474
103 Ga0114129_10338283 3300009147 Unclassified 1997
104 Ga0105243_10154472 3300009148 Bacteria 1972
105 Ga0105241_10357083 3300009174 Bacteria 1271
106 Ga0105242_10187018 3300009176 Bacteria 1831
107 Ga0105248_10999775 3300009177 Bacteria 945
108 Ga0105238_10005660 3300009551 Bacteria 12351
109 Ga0105238_11583225 3300009551 Bacteria 685
110 Ga0105239_10073542 3300010375 Bacteria 3757
111 Ga0105239_10094983 3300010375 Unclassified 3294
112 Ga0105239_11419655 3300010375 Bacteria 801
113 Ga0105239_11839303 3300010375 Bacteria 702
114 Ga0105246_10051826 3300011119 Bacteria 2819
115 Ga0157373_10310760 3300013100 Unclassified 1120
116 Ga0157373_10635520 3300013100 Bacteria 779
117 Ga0157371_10416171 3300013102 Bacteria 985
118 Ga0157369_10206124 3300013105 Bacteria 2062
119 Ga0157378_11732966 3300013297 Bacteria 672
120 Ga0163162_10718776 3300013306 Bacteria 1120
121 Ga0163162_10938383 3300013306 Bacteria 977
122 Ga0157372_10178939 3300013307 Bacteria 2455
123 Ga0157375_10108837 3300013308 Bacteria 2867
124 Ga0157375_10438436 3300013308 Bacteria 1472
125 Ga0157375_11215727 3300013308 Bacteria 884
126 Ga0163163_10015196 3300014325 Bacteria 7110
127 Ga0157380_10484140 3300014326 Bacteria 1197
128 Ga0157379_10184377 3300014968 Bacteria 1886
129 Ga0157376_10060461 3300014969 Bacteria 3182
130 Ga0157376_10984729 3300014969 Bacteria 865
131 Ga0207656_10099056 3300025321 Unclassified 1334
132 Ga0207692_10014034 3300025898 Bacteria 3491
133 Ga0207692_10016994 3300025898 Bacteria 3235
134 Ga0207692_10020852 3300025898 Bacteria 2989
135 Ga0207692_10365959 3300025898 Unclassified 892
136 Ga0207692_10441629 3300025898 Bacteria 818
137 Ga0207642_11089283 3300025899 Unclassified 516
138 Ga0207710_10032211 3300025900 Bacteria 2296
139 Ga0207688_10045835 3300025901 Bacteria 2440
140 Ga0207699_10127351 3300025906 Bacteria 1655
141 Ga0207699_10135675 3300025906 Bacteria 1611
142 Ga0207643_10307150 3300025908 Bacteria 988
143 Ga0207684_10360010 3300025910 Bacteria 1252
144 Ga0207684_10793953 3300025910 Bacteria 800
145 Ga0207654_10015945 3300025911 Bacteria 3908
146 Ga0207707_10181146 3300025912 Bacteria 1839
147 Ga0207707_10282644 3300025912 Bacteria 1437
148 Ga0207707_11322385 3300025912 Bacteria 578
149 Ga0207671_10593060 3300025914 Bacteria 883
150 Ga0207693_10011697 3300025915 Bacteria 7101
151 Ga0207693_10030510 3300025915 Bacteria 4259
152 Ga0207693_10047890 3300025915 Bacteria 3358
153 Ga0207693_10061949 3300025915 Bacteria 2930
154 Ga0207693_10101932 3300025915 Bacteria 2251
155 Ga0207693_10129120 3300025915 Bacteria 1987
156 Ga0207693_10141480 3300025915 Bacteria 1892
157 Ga0207693_10154866 3300025915 Bacteria 1803
158 Ga0207693_11417890 3300025915 Unclassified 515
159 Ga0207663_10051410 3300025916 Bacteria 2565
160 Ga0207663_10177635 3300025916 Bacteria 1517
161 Ga0207663_10526229 3300025916 Unclassified 921
162 Ga0207660_11413752 3300025917 Unclassified 563
163 Ga0207657_10002052 3300025919 Bacteria 21796
164 Ga0207649_10280838 3300025920 Bacteria 1211
165 Ga0207652_10050466 3300025921 Bacteria 3565
166 Ga0207652_10684533 3300025921 Bacteria 916
167 Ga0207646_10034875 3300025922 Plasmid 4548
168 Ga0207646_10201807 3300025922 Bacteria 1796
169 Ga0207694_10019180 3300025924 Bacteria 5170
170 Ga0207694_10911330 3300025924 Bacteria 743
171 Ga0207650_10731765 3300025925 Bacteria 837
172 Ga0207687_10003780 3300025927 Bacteria 10171
173 Ga0207687_10066457 3300025927 Unclassified 2563
174 Ga0207700_10358771 3300025928 Bacteria 1270
175 Ga0207700_10623902 3300025928 Bacteria 960
176 Ga0207700_10993696 3300025928 Unclassified 751
177 Ga0207664_10108465 3300025929 Bacteria 2305
178 Ga0207664_10129437 3300025929 Bacteria 2123
179 Ga0207664_10292045 3300025929 Bacteria 1433
180 Ga0207664_11338024 3300025929 Bacteria 636
181 Ga0207644_10617612 3300025931 Unclassified 901
182 Ga0207690_10255031 3300025932 Bacteria 1357
183 Ga0207706_10190600 3300025933 Bacteria 1800
184 Ga0207686_10410031 3300025934 Unclassified 1034
185 Ga0207670_10848227 3300025936 Unclassified 763
186 Ga0207669_11070705 3300025937 Bacteria 680
187 Ga0207669_11576751 3300025937 Unclassified 560
188 Ga0207704_10060275 3300025938 Unclassified 2347
189 Ga0207665_10000242 3300025939 Bacteria 37438
190 Ga0207665_10089680 3300025939 Bacteria 2130
191 Ga0207665_11335323 3300025939 Bacteria 571
192 Ga0207711_10609911 3300025941 Unclassified 1018
193 Ga0207661_10730781 3300025944 Bacteria 911
194 Ga0207679_10127072 3300025945 Bacteria 2039
195 Ga0207679_10214575 3300025945 Bacteria 1616
196 Ga0207667_10060549 3300025949 Bacteria 3962
197 Ga0207651_10102712 3300025960 Bacteria 2126
198 Ga0207712_11335835 3300025961 Unclassified 641
199 Ga0207677_10482451 3300026023 Unclassified 1068
200 Ga0207703_10016616 3300026035 Bacteria 5739
201 Ga0207678_10108474 3300026067 Bacteria 2368
202 Ga0207708_10064198 3300026075 Bacteria 2804
203 Ga0207702_10003309 3300026078 Bacteria 14833
204 Ga0207648_10135651 3300026089 Unclassified 2168
205 Ga0207648_10522414 3300026089 Bacteria 1088
206 Ga0207674_10007689 3300026116 Bacteria 12548
207 Ga0207675_100959940 3300026118 Bacteria 872
208 Ga0207683_10125884 3300026121 Bacteria 2303
209 Ga0207683_10429867 3300026121 Bacteria 1216
210 Ga0207698_10085052 3300026142 Bacteria 2566
211 Ga0207428_10134728 3300027907 Bacteria 1889
212 Ga0268264_10071497 3300028381 Bacteria 2940
213 Ga0265319_1072118 3300028563 Bacteria 1106
214 Ga0265319_1079850 3300028563 Unclassified 1040
215 Ga0265334_10216975 3300028573 Bacteria 662
216 Ga0265328_10398757 3300031239 Bacteria 540
217 Ga0265342_10286446 3300031712 Bacteria 871
218 Ga0373926_0205326 3300035083 Bacteria 759
219 Ga0373944_0014353 3300035089 Bacteria 2210
220 Ga0373944_0366522 3300035089 Bacteria 550
221 Ga0373923_0041957 3300035111 Bacteria 1888
222 Ga0373936_0032332 3300035113 Bacteria 2069
223 Ga0373945_0052185 3300035116 Bacteria 1506
224 Ga0373953_0286660 3300035117 Bacteria 718
225 Ga0373956_0158008 3300035119 Bacteria 1068
226 Ga0373957_0008284 3300035120 Bacteria 3361
227 Ga0373943_0041837 3300035170 Bacteria 2217
228 Ga0373943_0308741 3300035170 Bacteria 899
229 Ga0373943_0355252 3300035170 Bacteria 840
230 Ga0373946_0036367 3300035171 Bacteria 1996
231 Ga0373924_0108474 3300035410 Bacteria 1198
232 Ga0373931_0263757 3300035691 Bacteria 1052
233 Ga0373935_0212375 3300035692 Bacteria 1341
234 Ga0373927_0054145 3300035695 Bacteria 2595
235 Ga0373927_0154465 3300035695 Bacteria 1503
236 Ga0373933_0123578 3300035724 Bacteria 1622
237 Ga0373947_0154158 3300035725 Bacteria 1481
238 Ga0373937_0212716 3300036401 Bacteria 1819
239 Ga0373937_1507201 3300036401 Unclassified 620
240 Ga0373925_0149615 3300037068 Bacteria 1832
241 Ga0373925_1756460 3300037068 Unclassified 506
242 Ga0395899_0222491 3300037312 Unclassified 1307
243 Ga0395899_0751042 3300037312 Unclassified 607
244 Ga0395900_0013897 3300037418 Bacteria 8215
245 Ga0395898_0062082 3300037466 Bacteria 3630
246 Ga0395898_0499852 3300037466 Unclassified 1156
247 Ga0395905_0070599 3300037471 Bacteria 3273
248 Ga0436364_0817533 3300037853 Bacteria 3910
249 Ga0395901_0003414 3300038443 Bacteria 16004
250 Ga0395901_0444384 3300038443 Bacteria 1327
251 Ga0395901_0454031 3300038443 Bacteria 1310
252 Ga0439453_0002118 3300041408 Bacteria 2687
253 Ga0451787_696618 3300041441 Unclassified 602
254 Ga0451789_0749899 3300041443 Bacteria 732
255 Ga0451851_1055962 3300041507 Bacteria 543
256 Ga0451853_0117045 3300041512 Unclassified 648
257 Ga0439451_002771 3300042009 Bacteria 3565
258 Ga0439454_002452 3300042011 Bacteria 1958
259 Ga0451577_0524532 3300042876 Bacteria 1076
260 Ga0466965_0128626 3300044683 Bacteria 1312
261 Ga0466965_0948816 3300044683 Bacteria 503
262 Ga0466966_0318810 3300044684 Bacteria 934
263 Ga0466963_0117082 3300044694 Bacteria 1831
264 Ga0466963_0517694 3300044694 Bacteria 842
265 Ga0466964_0214229 3300044706 Bacteria 932
266 Ga0453684_1350933 3300044712 Unclassified 741
267 Ga0466968_0295381 3300044735 Bacteria 778
268 Ga0466970_0692592 3300044765 Unclassified 594
269 Ga0466959_0011476 3300045049 Bacteria 6369
270 Ga0466959_0059556 3300045049 Bacteria 2781
271 Ga0466959_0070196 3300045049 Bacteria 2538
272 Ga0466958_0001567 3300045836 Bacteria 10965
273 Ga0466958_0190884 3300045836 Bacteria 1302
274 Ga0466967_0003241 3300045976 Bacteria 10531
275 Ga0466967_0037777 3300045976 Bacteria 4136
276 Ga0466967_0050759 3300045976 Bacteria 3633
277 Ga0466967_0154334 3300045976 Bacteria 2149
278 Ga0466967_0499954 3300045976 Bacteria 1193
279 Ga0495603_0009435 3300046455 Bacteria 5898
280 Ga0495603_0070020 3300046455 Bacteria 2062
281 Ga0495603_0125254 3300046455 Bacteria 1497
282 Ga0495629_0138139 3300046459 Bacteria 1696
283 Ga0495629_0334984 3300046459 Bacteria 1033
284 Ga0495629_0368183 3300046459 Bacteria 979
285 Ga0495641_0020489 3300046461 Bacteria 3351
286 Ga0495641_0413302 3300046461 Unclassified 612
287 Ga0495580_0128905 3300046472 Bacteria 1755
288 Ga0495580_0726143 3300046472 Bacteria 648
289 Ga0495582_0006636 3300046473 Bacteria 6429
290 Ga0495582_0115924 3300046473 Bacteria 1506
291 Ga0495662_0008160 3300046476 Bacteria 5160
292 Ga0495662_0228903 3300046476 Bacteria 916
293 Ga0495664_0220744 3300046477 Bacteria 1147
294 Ga0495594_0025587 3300046499 Bacteria 3172
295 Ga0495594_0232068 3300046499 Bacteria 1052
296 Ga0495608_0119753 3300046511 Bacteria 1688
297 Ga0495608_0481761 3300046511 Unclassified 753
298 Ga0495618_0455008 3300046514 Bacteria 776
299 Ga0495618_0835605 3300046514 Unclassified 535
300 Ga0495628_0977569 3300046516 Bacteria 583
301 Ga0495630_0139153 3300046517 Bacteria 1845
302 Ga0495630_0254504 3300046517 Bacteria 1341
303 Ga0495630_0464892 3300046517 Unclassified 969
304 Ga0495630_0647160 3300046517 Unclassified 809
305 Ga0495652_0411638 3300046529 Bacteria 955
306 Ga0495652_0507732 3300046529 Bacteria 835
307 Ga0495665_0039368 3300046531 Bacteria 2518
308 Ga0495665_0065951 3300046531 Bacteria 1911
309 Ga0495665_0218034 3300046531 Bacteria 987
310 Ga0495640_0178093 3300046533 Bacteria 1356
311 Ga0495640_0236118 3300046533 Bacteria 1148
312 Ga0495586_0152523 3300046535 Bacteria 1300
313 Ga0495586_0185669 3300046535 Bacteria 1177
314 Ga0495586_0763635 3300046535 Unclassified 558
315 Ga0495645_0933946 3300046543 Unclassified 513
316 Ga0495622_0109657 3300046557 Bacteria 1264
317 Ga0495667_0132730 3300046559 Bacteria 1606
318 Ga0495667_0454540 3300046559 Bacteria 804
319 Ga0495667_0597795 3300046559 Bacteria 687
320 Ga0495667_0867687 3300046559 Unclassified 554
321 Ga0495634_0201767 3300046642 Bacteria 1235
322 Ga0495635_0135987 3300046663 Bacteria 1675
323 Ga0495635_0456932 3300046663 Bacteria 844
324 Ga0495635_1111514 3300046663 Unclassified 500
325 Ga0495588_0012191 3300046674 Bacteria 4055
326 Ga0495588_0299331 3300046674 Bacteria 847
327 Ga0495657_0086794 3300046675 Bacteria 2014
328 Ga0495646_0047364 3300046680 Bacteria 2617
329 Ga0495646_0470019 3300046680 Unclassified 648
330 Ga0495647_0002785 3300046681 Bacteria 5542
331 Ga0495658_0053689 3300046683 Bacteria 2289
332 Ga0495658_0274266 3300046683 Bacteria 1063
333 Ga0495613_0068975 3300046689 Bacteria 2578
334 Ga0495624_0049718 3300046690 Bacteria 2658
335 Ga0495624_0942801 3300046690 Bacteria 507
336 Ga0495600_0013935 3300046809 Bacteria 5066
337 Ga0495581_0008198 3300047315 Bacteria 6053
338 Ga0495581_0110509 3300047315 Bacteria 1598
339 Ga0495604_0162295 3300047317 Bacteria 1578
340 Ga0495674_0035033 3300047319 Bacteria 4532
341 Ga0495674_0107312 3300047319 Bacteria 2370
342 Ga0495674_0580652 3300047319 Bacteria 889
343 Ga0495676_0059058 3300047321 Bacteria 3014
344 Ga0495676_0081617 3300047321 Bacteria 2450
345 Ga0495676_0599997 3300047321 Bacteria 717
346 Ga0495676_0749073 3300047321 Bacteria 631
347 Ga0495680_0231661 3300047322 Unclassified 1315
348 Ga0495680_0325210 3300047322 Bacteria 1075
349 Ga0495684_0018400 3300047471 Bacteria 5383
350 Ga0495593_0033807 3300047673 Bacteria 2782
351 Ga0495593_0225400 3300047673 Bacteria 940
352 Ga0495602_0270698 3300048088 Unclassified 1256
353 Ga0495614_0040528 3300048089 Bacteria 1998
354 Ga0495614_0416892 3300048089 Unclassified 632
355 Ga0496100_0028160 3300048903 Bacteria 3463
356 Ga0496100_0389196 3300048903 Bacteria 1060
357 Ga0496100_0749488 3300048903 Bacteria 764
358 Ga0496101_0212188 3300048904 Bacteria 1500
359 Ga0496101_0351610 3300048904 Bacteria 1158
360 Ga0496101_0394522 3300048904 Bacteria 1089
361 Ga0496101_0596252 3300048904 Bacteria 873
362 Ga0496102_0050145 3300048905 Bacteria 3799
363 Ga0496102_0077551 3300048905 Bacteria 3058
364 Ga0496102_0228459 3300048905 Bacteria 1754
365 Ga0496102_0540350 3300048905 Bacteria 1088
366 Ga0496103_0017664 3300048906 Bacteria 4270
367 Ga0496103_0056231 3300048906 Bacteria 2442
368 Ga0496104_0034569 3300048907 Bacteria 4714
369 Ga0496104_0055847 3300048907 Bacteria 3733
370 Ga0496104_1008935 3300048907 Bacteria 736
371 Ga0496104_1690779 3300048907 Unclassified 535
372 Ga0496105_0111535 3300048908 Bacteria 2257
373 Ga0496105_0392726 3300048908 Bacteria 1102
374 Ga0496106_0005699 3300048909 Bacteria 9210
375 Ga0496106_0006407 3300048909 Bacteria 8712
376 Ga0496106_0250584 3300048909 Bacteria 1416
377 Ga0496106_0400312 3300048909 Bacteria 1103
378 Ga0496106_0493140 3300048909 Unclassified 984
379 Ga0496106_1180774 3300048909 Bacteria 597
380 Ga0496107_0004781 3300048910 Bacteria 9201
381 Ga0496107_0055376 3300048910 Bacteria 2864
382 Ga0496107_0077851 3300048910 Bacteria 2415
383 Ga0496107_0382013 3300048910 Bacteria 1048
384 Ga0496107_1122205 3300048910 Unclassified 567
385 Ga0496107_1353904 3300048910 Bacteria 508
386 Ga0496108_0005003 3300048911 Bacteria 10707
387 Ga0496108_0032590 3300048911 Bacteria 4328
388 Ga0496108_0479257 3300048911 Bacteria 1087
389 Ga0496108_0652682 3300048911 Bacteria 914
390 Ga0496109_0001457 3300048912 Bacteria 19614
391 Ga0496109_0119664 3300048912 Bacteria 2452
392 Ga0496109_0850499 3300048912 Unclassified 850
393 Ga0496109_2020260 3300048912 Unclassified 508
394 Ga0496110_0007449 3300048913 Bacteria 8744
395 Ga0496110_0779514 3300048913 Bacteria 860
396 Ga0496111_0000338 3300048914 Bacteria 23346
397 Ga0496111_0006002 3300048914 Bacteria 7845
398 Ga0496111_1031144 3300048914 Bacteria 589
399 Ga0496112_0012803 3300048915 Bacteria 7722
400 Ga0496112_0020368 3300048915 Bacteria 6287
401 Ga0496112_0054423 3300048915 Bacteria 3932
402 Ga0496112_0061134 3300048915 Bacteria 3713
403 Ga0496112_0818202 3300048915 Bacteria 856
404 Ga0496113_0000913 3300048916 Bacteria 15606
405 Ga0496113_0007223 3300048916 Bacteria 7120
406 Ga0496113_0175330 3300048916 Bacteria 1699
407 Ga0496113_0223555 3300048916 Unclassified 1501
408 Ga0496114_0058613 3300048917 Bacteria 3215
409 Ga0496114_0187463 3300048917 Bacteria 1808
410 Ga0496114_1568270 3300048917 Unclassified 546
411 Ga0496115_0008343 3300048918 Bacteria 7664
412 Ga0496115_0015546 3300048918 Bacteria 5775
413 Ga0496115_0144443 3300048918 Bacteria 1963
414 Ga0496115_0344389 3300048918 Unclassified 1216
415 Ga0501036_0586816 3300049572 Bacteria 925
416 Ga0501036_1078061 3300049572 Unclassified 656
417 Ga0501039_0187478 3300049575 Bacteria 1627
418 Ga0501040_0018519 3300049576 Bacteria 4624
419 Ga0501040_0407012 3300049576 Bacteria 977
420 Ga0501041_0518979 3300049577 Bacteria 758
421 Ga0501048_0261704 3300049582 Bacteria 1229
422 Ga0501072_0050427 3300049588 Bacteria 3277
423 Ga0501072_0071322 3300049588 Bacteria 2745
424 Ga0501075_1266375 3300049591 Unclassified 559
425 Ga0501075_1275435 3300049591 Bacteria 557
426 Ga0501076_0380541 3300049592 Bacteria 1160
427 Ga0501076_0489492 3300049592 Bacteria 1014
428 Ga0501077_0506123 3300049593 Bacteria 774
429 Ga0501077_0924489 3300049593 Unclassified 561
430 Ga0501080_0430446 3300049742 Bacteria 1184
431 Ga0501045_0024842 3300049824 Bacteria 4304
432 nmdc:mga05p37_1446305_c1 3300050507 Bacteria 689
433 nmdc:mga08y16_211561_c1 3300050511 Bacteria 2008
434 nmdc:mga08y16_51526_c1 3300050511 Bacteria 4306
435 nmdc:mga0rr50_7877_c1 3300050513 Bacteria 6607
436 nmdc:mga08x19_1031462_c1 3300050514 Bacteria 584
437 nmdc:mga08x19_28981_c1 3300050514 Bacteria 3471
438 Ga0495601_0041016 3300053077 Bacteria 2900
439 Ga0495601_0096617 3300053077 Bacteria 1906
440 Ga0495601_0287515 3300053077 Bacteria 1072
441 Ga0495612_0038450 3300053078 Bacteria 1944
442 Ga0495612_0067453 3300053078 Bacteria 1488
443 Ga0495612_0205502 3300053078 Unclassified 869
444 Ga0495595_0131959 3300053084 Bacteria 1222
445 Ga0495595_0151957 3300053084 Bacteria 1139
446 Ga0495595_0154154 3300053084 Bacteria 1131
447 Ga0495595_0356480 3300053084 Unclassified 739
448 Ga0495619_0123888 3300053085 Bacteria 1773
449 Ga0495619_0206212 3300053085 Bacteria 1361
450 Ga0495619_0386876 3300053085 Bacteria 966
451 Ga0495619_0872081 3300053085 Bacteria 606
452 Ga0501084_0079153 3300054114 Bacteria 2755
453 Ga0501084_0207141 3300054114 Bacteria 1655
454 Ga0587073_0261636 3300059492 Unclassified 547
455 Ga0501082_0581344 3300060353 Bacteria 980
456 Ga0501082_1677244 3300060353 Unclassified 555
457 Ga0466962_0017800 3300061719 Bacteria 3420
458 Ga0495599_0119116
459 JGI25407J50210_10138582
460 JGI25404J52841_10065176
461 Ga0070683_100296501
462 Ga0070690_100153293
463 Ga0070670_100052110
464 Ga0070680_101201313
465 Ga0070682_100014320
466 Ga0068868_100034851
467 Ga0070660_100082565
468 Ga0070691_10089475
469 Ga0070661_100339697
470 Ga0070675_100359665
471 Ga0070671_100418329
472 Ga0070671_101630126
473 Ga0070674_100365140
474 Ga0070673_100137705
475 Ga0070688_100375352
476 Ga0070659_100020617
477 Ga0070659_100301241
478 Ga0070709_10103716
479 Ga0070714_100152209
480 Ga0070714_101564361
481 Ga0070713_102189180
482 Ga0070710_10000411
483 Ga0070701_10633170
484 Ga0070701_10759545
485 Ga0070711_100047057
486 Ga0070711_100099651
487 Ga0070711_101013610
488 Ga0070705_101937129
489 Ga0070700_100582205
490 Ga0070694_100911708
491 Ga0070708_100187501
492 Ga0070663_100154040
493 Ga0070678_100104207
494 Ga0070662_100541129
495 Ga0070681_10178374
496 Ga0068867_100129844
497 Ga0070685_10343154
498 Ga0070706_100081410
499 Ga0070706_101271649
500 Ga0070707_100073045
501 Ga0070698_101047567
502 Ga0070699_100000512
503 Ga0070699_100168309
504 Ga0070679_100194220
505 Ga0070679_100338145
506 Ga0070684_100003093
507 Ga0070684_100831223
508 Ga0070697_100935543
509 Ga0070686_100319856
510 Ga0070696_100077293
511 Ga0070696_100562507
512 Ga0070696_101467301
513 Ga0070693_100051115
514 Ga0070665_100577911
515 Ga0068855_100006714
516 Ga0070664_100165160
517 Ga0070664_100710573
518 Ga0068857_100002942
519 Ga0068856_100011679
520 Ga0068859_101573252
521 Ga0068859_101845381
522 Ga0068864_100249283
523 Ga0068866_10059444
524 Ga0068861_101136947
525 Ga0068851_10088919
526 Ga0068870_10540186
527 Ga0068858_101261804
528 Ga0081538_10001565
529 Ga0081538_10001609
530 Ga0081538_10147152
531 Ga0081538_10147546
532 Ga0081540_1000418
533 Ga0070717_10010756
534 Ga0070717_10019014
535 Ga0070717_10109045
536 Ga0075365_10265960
537 Ga0070716_100097616
538 Ga0070716_100130172
539 Ga0070716_100529043
540 Ga0070712_100121602
541 Ga0070712_100152779
542 Ga0070712_100454892
543 Ga0070712_100773278
544 Ga0097621_100277861
545 Ga0068871_101420077
546 Ga0075428_100183679
547 Ga0075434_100058062
548 Ga0068865_100013735
549 Ga0068865_100075530
550 Ga0075436_100119515
551 Ga0097620_101572849
552 Ga0097620_101845450
553 Ga0075435_100000942
554 Ga0105240_11740788
555 Ga0105240_12100850
556 Ga0111539_10112312
557 Ga0111539_10235165
558 Ga0105245_10088453
559 Ga0105247_10006119
560 Ga0114129_10338283
561 Ga0105243_10154472
562 Ga0105241_10357083
563 Ga0105242_10187018
564 Ga0105248_10999775
565 Ga0105238_10005660
566 Ga0105238_11583225
567 Ga0105239_10073542
568 Ga0105239_10094983
569 Ga0105239_11419655
570 Ga0105239_11839303
571 Ga0105246_10051826
572 Ga0157373_10310760
573 Ga0157373_10635520
574 Ga0157371_10416171
575 Ga0157369_10206124
576 Ga0157378_11732966
577 Ga0163162_10718776
578 Ga0163162_10938383
579 Ga0157372_10178939
580 Ga0157375_10108837
581 Ga0157375_10438436
582 Ga0157375_11215727
583 Ga0163163_10015196
584 Ga0157380_10484140
585 Ga0157379_10184377
586 Ga0157376_10060461
587 Ga0157376_10984729
588 Ga0207656_10099056
589 Ga0207692_10014034
590 Ga0207692_10016994
591 Ga0207692_10020852
592 Ga0207692_10365959
593 Ga0207692_10441629
594 Ga0207642_11089283
595 Ga0207710_10032211
596 Ga0207688_10045835
597 Ga0207699_10127351
598 Ga0207699_10135675
599 Ga0207643_10307150
600 Ga0207684_10360010
601 Ga0207684_10793953
602 Ga0207654_10015945
603 Ga0207707_10181146
604 Ga0207707_10282644
605 Ga0207707_11322385
606 Ga0207671_10593060
607 Ga0207693_10011697
608 Ga0207693_10030510
609 Ga0207693_10047890
610 Ga0207693_10061949
611 Ga0207693_10101932
612 Ga0207693_10129120
613 Ga0207693_10141480
614 Ga0207693_10154866
615 Ga0207693_11417890
616 Ga0207663_10051410
617 Ga0207663_10177635
618 Ga0207663_10526229
619 Ga0207660_11413752
620 Ga0207657_10002052
621 Ga0207649_10280838
622 Ga0207652_10050466
623 Ga0207652_10684533
624 Ga0207646_10034875
625 Ga0207646_10201807
626 Ga0207694_10019180
627 Ga0207694_10911330
628 Ga0207650_10731765
629 Ga0207687_10003780
630 Ga0207687_10066457
631 Ga0207700_10358771
632 Ga0207700_10623902
633 Ga0207700_10993696
634 Ga0207664_10108465
635 Ga0207664_10129437
636 Ga0207664_10292045
637 Ga0207664_11338024
638 Ga0207644_10617612
639 Ga0207690_10255031
640 Ga0207706_10190600
641 Ga0207686_10410031
642 Ga0207670_10848227
643 Ga0207669_11070705
644 Ga0207669_11576751
645 Ga0207704_10060275
646 Ga0207665_10000242
647 Ga0207665_10089680
648 Ga0207665_11335323
649 Ga0207711_10609911
650 Ga0207661_10730781
651 Ga0207679_10127072
652 Ga0207679_10214575
653 Ga0207667_10060549
654 Ga0207651_10102712
655 Ga0207712_11335835
656 Ga0207677_10482451
657 Ga0207703_10016616
658 Ga0207678_10108474
659 Ga0207708_10064198
660 Ga0207702_10003309
661 Ga0207648_10135651
662 Ga0207648_10522414
663 Ga0207674_10007689
664 Ga0207675_100959940
665 Ga0207683_10125884
666 Ga0207683_10429867
667 Ga0207698_10085052
668 Ga0207428_10134728
669 Ga0268264_10071497
670 Ga0265319_1072118
671 Ga0265319_1079850
672 Ga0265334_10216975
673 Ga0265328_10398757
674 Ga0265342_10286446
675 Ga0373926_0205326
676 Ga0373944_0014353
677 Ga0373944_0366522
678 Ga0373923_0041957
679 Ga0373936_0032332
680 Ga0373945_0052185
681 Ga0373953_0286660
682 Ga0373956_0158008
683 Ga0373957_0008284
684 Ga0373943_0041837
685 Ga0373943_0308741
686 Ga0373943_0355252
687 Ga0373946_0036367
688 Ga0373924_0108474
689 Ga0373931_0263757
690 Ga0373935_0212375
691 Ga0373927_0054145
692 Ga0373927_0154465
693 Ga0373933_0123578
694 Ga0373947_0154158
695 Ga0373937_0212716
696 Ga0373937_1507201
697 Ga0373925_0149615
698 Ga0373925_1756460
699 Ga0395899_0222491
700 Ga0395899_0751042
701 Ga0395900_0013897
702 Ga0395898_0062082
703 Ga0395898_0499852
704 Ga0395905_0070599
705 Ga0436364_0817533
706 Ga0395901_0003414
707 Ga0395901_0444384
708 Ga0395901_0454031
709 Ga0439453_0002118
710 Ga0451787_696618
711 Ga0451789_0749899
712 Ga0451851_1055962
713 Ga0451853_0117045
714 Ga0439451_002771
715 Ga0439454_002452
716 Ga0451577_0524532
717 Ga0466965_0128626
718 Ga0466965_0948816
719 Ga0466966_0318810
720 Ga0466963_0117082
721 Ga0466963_0517694
722 Ga0466964_0214229
723 Ga0453684_1350933
724 Ga0466968_0295381
725 Ga0466970_0692592
726 Ga0466959_0011476
727 Ga0466959_0059556
728 Ga0466959_0070196
729 Ga0466958_0001567
730 Ga0466958_0190884
731 Ga0466967_0003241
732 Ga0466967_0037777
733 Ga0466967_0050759
734 Ga0466967_0154334
735 Ga0466967_0499954
736 Ga0495603_0009435
737 Ga0495603_0070020
738 Ga0495603_0125254
739 Ga0495629_0138139
740 Ga0495629_0334984
741 Ga0495629_0368183
742 Ga0495641_0020489
743 Ga0495641_0413302
744 Ga0495580_0128905
745 Ga0495580_0726143
746 Ga0495582_0006636
747 Ga0495582_0115924
748 Ga0495662_0008160
749 Ga0495662_0228903
750 Ga0495664_0220744
751 Ga0495594_0025587
752 Ga0495594_0232068
753 Ga0495608_0119753
754 Ga0495608_0481761
755 Ga0495618_0455008
756 Ga0495618_0835605
757 Ga0495628_0977569
758 Ga0495630_0139153
759 Ga0495630_0254504
760 Ga0495630_0464892
761 Ga0495630_0647160
762 Ga0495652_0411638
763 Ga0495652_0507732
764 Ga0495665_0039368
765 Ga0495665_0065951
766 Ga0495665_0218034
767 Ga0495640_0178093
768 Ga0495640_0236118
769 Ga0495586_0152523
770 Ga0495586_0185669
771 Ga0495586_0763635
772 Ga0495645_0933946
773 Ga0495622_0109657
774 Ga0495667_0132730
775 Ga0495667_0454540
776 Ga0495667_0597795
777 Ga0495667_0867687
778 Ga0495634_0201767
779 Ga0495635_0135987
780 Ga0495635_0456932
781 Ga0495635_1111514
782 Ga0495588_0012191
783 Ga0495588_0299331
784 Ga0495657_0086794
785 Ga0495646_0047364
786 Ga0495646_0470019
787 Ga0495647_0002785
788 Ga0495658_0053689
789 Ga0495658_0274266
790 Ga0495613_0068975
791 Ga0495624_0049718
792 Ga0495624_0942801
793 Ga0495600_0013935
794 Ga0495581_0008198
795 Ga0495581_0110509
796 Ga0495604_0162295
797 Ga0495674_0035033
798 Ga0495674_0107312
799 Ga0495674_0580652
800 Ga0495676_0059058
801 Ga0495676_0081617
802 Ga0495676_0599997
803 Ga0495676_0749073
804 Ga0495680_0231661
805 Ga0495680_0325210
806 Ga0495684_0018400
807 Ga0495593_0033807
808 Ga0495593_0225400
809 Ga0495602_0270698
810 Ga0495614_0040528
811 Ga0495614_0416892
812 Ga0496100_0028160
813 Ga0496100_0389196
814 Ga0496100_0749488
815 Ga0496101_0212188
816 Ga0496101_0351610
817 Ga0496101_0394522
818 Ga0496101_0596252
819 Ga0496102_0050145
820 Ga0496102_0077551
821 Ga0496102_0228459
822 Ga0496102_0540350
823 Ga0496103_0017664
824 Ga0496103_0056231
825 Ga0496104_0034569
826 Ga0496104_0055847
827 Ga0496104_1008935
828 Ga0496104_1690779
829 Ga0496105_0111535
830 Ga0496105_0392726
831 Ga0496106_0005699
832 Ga0496106_0006407
833 Ga0496106_0250584
834 Ga0496106_0400312
835 Ga0496106_0493140
836 Ga0496106_1180774
837 Ga0496107_0004781
838 Ga0496107_0055376
839 Ga0496107_0077851
840 Ga0496107_0382013
841 Ga0496107_1122205
842 Ga0496107_1353904
843 Ga0496108_0005003
844 Ga0496108_0032590
845 Ga0496108_0479257
846 Ga0496108_0652682
847 Ga0496109_0001457
848 Ga0496109_0119664
849 Ga0496109_0850499
850 Ga0496109_2020260
851 Ga0496110_0007449
852 Ga0496110_0779514
853 Ga0496111_0000338
854 Ga0496111_0006002
855 Ga0496111_1031144
856 Ga0496112_0012803
857 Ga0496112_0020368
858 Ga0496112_0054423
859 Ga0496112_0061134
860 Ga0496112_0818202
861 Ga0496113_0000913
862 Ga0496113_0007223
863 Ga0496113_0175330
864 Ga0496113_0223555
865 Ga0496114_0058613
866 Ga0496114_0187463
867 Ga0496114_1568270
868 Ga0496115_0008343
869 Ga0496115_0015546
870 Ga0496115_0144443
871 Ga0496115_0344389
872 Ga0501036_0586816
873 Ga0501036_1078061
874 Ga0501039_0187478
875 Ga0501040_0018519
876 Ga0501040_0407012
877 Ga0501041_0518979
878 Ga0501048_0261704
879 Ga0501072_0050427
880 Ga0501072_0071322
881 Ga0501075_1266375
882 Ga0501075_1275435
883 Ga0501076_0380541
884 Ga0501076_0489492
885 Ga0501077_0506123
886 Ga0501077_0924489
887 Ga0501080_0430446
888 Ga0501045_0024842
889 nmdc:mga05p37_1446305_c1
890 nmdc:mga08y16_211561_c1
891 nmdc:mga08y16_51526_c1
892 nmdc:mga0rr50_7877_c1
893 nmdc:mga08x19_1031462_c1
894 nmdc:mga08x19_28981_c1
895 Ga0495601_0041016
896 Ga0495601_0096617
897 Ga0495601_0287515
898 Ga0495612_0038450
899 Ga0495612_0067453
900 Ga0495612_0205502
901 Ga0495595_0131959
902 Ga0495595_0151957
903 Ga0495595_0154154
904 Ga0495595_0356480
905 Ga0495619_0123888
906 Ga0495619_0206212
907 Ga0495619_0386876
908 Ga0495619_0872081
909 Ga0501084_0079153
910 Ga0501084_0207141
911 Ga0587073_0261636
912 Ga0501082_0581344
913 Ga0501082_1677244
914 Ga0466962_0017800

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

4

110

0.93

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

4

45

0.89

PF18029

Glyoxalase_6

Glyoxalase-like domain

6

111

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r6u-assembly2.cif.gz_D crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.8533 1 114
2r6u-assembly2.cif.gz_B crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.8287 1 114
3hdp-assembly1.cif.gz_A crystal structure of the ni(ii)-bound glyoxalase-i from clostridium acetobutylicum 0.8 1 113
2r6u-assembly2.cif.gz_D crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.7959 1 114
6xbv-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (s115t) in complex with 2-nitronate-propionyl-coa 0.7825 1 118
ID Description Score Start End Superfamily
af_I6XA34_134_256_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8679 1 112 3.10.180.10
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8575 3 113 3.10.180.10
3oxhA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8476 1 114 3.10.180.10
3oxhA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8274 1 114 3.10.180.10
3oxhA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8271 1 117 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7W1JID9-F1-model_v4 VOC family protein 0.9738 65 120
AF-A0A7W1BRD3-F1-model_v4 VOC family protein 0.9615 1 122
AF-A0A7W1BRD3-F1-model_v4 VOC family protein 0.9539 1 122
AF-A0A7Y5X0U9-F1-model_v4 VOC family protein 0.9523 1 118
AF-A0A538B3C3-F1-model_v4 VOC family protein 0.9427 1 92

Map