F448058

General Info

Members Datasets Scaffolds Average Seq Length
457 224 914 300

Family's Representative Sequence

Representative Sequence 3300046663|Ga0495635_0189881|Ga0495635_0189881_299_1294
Length 331
Sequence MIPGPFAARLGDSQRRPFCHDPRMATDLLSSFSNQLADAVSAASPSVVQVQGRRRPASGLVYADNVVLTTVRALGREDGLHVRRHDGRTLDAELAGWDPTTSLAVLRVAGLDTPPLAPAATAPRVGHLALAVARSWSNVVTASAGIVSVIGGPLPTGRRRAIDQVIRTTAPMHDGFAGGAFLDTAGGLIGIATAAAIRGLGVVIPAAIAWKTAATVLEHGSLRRGYLGLAGQPVALPEGQGGADGREQALLVVGVTSGGPASQAGVLVGDLLLEFDGHPVEAPEELLDLLLGDRVGRAVALKILRGGTVAEVTVTVGEFLASDSGGEKIEI

Samples

Sample ID Description Type Environment
1 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
143 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
144 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
145 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
146 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
149 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
150 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
151 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
152 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
154 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
164 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
165 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
174 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
175 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 2.19
Rhizosphere 97.37
Stem 0
Stem Tuber 0
Unclassified 15.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495635_0189881 3300046663 Bacteria 1395
2 Ga0065712_10089488 3300005290 Bacteria 2467
3 Ga0065707_10085126 3300005295 Bacteria 6432
4 Ga0070676_10111785 3300005328 Bacteria 1702
5 Ga0070670_100002204 3300005331 Bacteria 16016
6 Ga0070670_100020506 3300005331 Bacteria 5683
7 Ga0070677_10154368 3300005333 Unclassified 1071
8 Ga0068869_100002479 3300005334 Bacteria 11131
9 Ga0068869_100011346 3300005334 Bacteria 5839
10 Ga0068869_100123772 3300005334 Bacteria 1981
11 Ga0070666_10001247 3300005335 Bacteria 15395
12 Ga0070666_10254858 3300005335 Bacteria 1243
13 Ga0068868_100189331 3300005338 Unclassified 1711
14 Ga0070689_100413565 3300005340 Bacteria 1142
15 Ga0070691_10018650 3300005341 Bacteria 3199
16 Ga0070687_100229435 3300005343 Bacteria 1142
17 Ga0070661_100010515 3300005344 Bacteria 6434
18 Ga0070668_100081666 3300005347 Bacteria 2534
19 Ga0070668_100427206 3300005347 Bacteria 1135
20 Ga0070669_100053201 3300005353 Bacteria 2963
21 Ga0070669_100150726 3300005353 Unclassified 1800
22 Ga0070675_100000204 3300005354 Bacteria 37628
23 Ga0070675_100000342 3300005354 Bacteria 31497
24 Ga0070675_100001621 3300005354 Bacteria 16598
25 Ga0070675_100027339 3300005354 Bacteria 4583
26 Ga0070675_100102316 3300005354 Bacteria 2414
27 Ga0070671_100206881 3300005355 Bacteria 1664
28 Ga0070674_100093453 3300005356 Bacteria 2176
29 Ga0070674_100093667 3300005356 Unclassified 2174
30 Ga0070674_100107158 3300005356 Unclassified 2046
31 Ga0070674_100324182 3300005356 Bacteria 1236
32 Ga0070673_100020088 3300005364 Bacteria 4810
33 Ga0070688_100011900 3300005365 Bacteria 4857
34 Ga0070688_100286013 3300005365 Bacteria 1187
35 Ga0070688_100418576 3300005365 Bacteria 995
36 Ga0070667_100025435 3300005367 Bacteria 4922
37 Ga0070713_100034896 3300005436 Bacteria 4046
38 Ga0070713_100122950 3300005436 Bacteria 2279
39 Ga0070701_10009264 3300005438 Bacteria 4306
40 Ga0070701_10064111 3300005438 Unclassified 1946
41 Ga0070711_100076447 3300005439 Bacteria 2374
42 Ga0070705_100005417 3300005440 Bacteria 6218
43 Ga0070700_100053347 3300005441 Bacteria 2523
44 Ga0070694_100004755 3300005444 Bacteria 8179
45 Ga0070663_100142291 3300005455 Unclassified 1832
46 Ga0070678_100054569 3300005456 Unclassified 2913
47 Ga0070662_100081285 3300005457 Bacteria 2414
48 Ga0070662_100271387 3300005457 Unclassified 1370
49 Ga0070681_10058717 3300005458 Bacteria 3827
50 Ga0068867_100005747 3300005459 Bacteria 8800
51 Ga0068867_100015354 3300005459 Bacteria 5431
52 Ga0070685_10076034 3300005466 Bacteria 2002
53 Ga0070706_100116848 3300005467 Bacteria 2485
54 Ga0070706_100395844 3300005467 Bacteria 1286
55 Ga0070707_100045492 3300005468 Bacteria 4202
56 Ga0070698_100127135 3300005471 Bacteria 2506
57 Ga0070699_100037950 3300005518 Bacteria 4171
58 Ga0070699_100183384 3300005518 Bacteria 1858
59 Ga0070684_100105726 3300005535 Bacteria 2519
60 Ga0070672_100143187 3300005543 Bacteria 1973
61 Ga0070672_100188184 3300005543 Bacteria 1722
62 Ga0070672_100275184 3300005543 Unclassified 1422
63 Ga0070672_100278685 3300005543 Bacteria 1413
64 Ga0070686_100001018 3300005544 Bacteria 16128
65 Ga0070686_100060592 3300005544 Bacteria 2442
66 Ga0070686_100085884 3300005544 Bacteria 2094
67 Ga0070695_100006575 3300005545 Bacteria 6868
68 Ga0070696_100096947 3300005546 Bacteria 2108
69 Ga0070696_100097991 3300005546 Bacteria 2097
70 Ga0070696_100145236 3300005546 Bacteria 1737
71 Ga0070696_100276753 3300005546 Unclassified 1278
72 Ga0070665_100029854 3300005548 Bacteria 5487
73 Ga0070665_100039676 3300005548 Bacteria 4734
74 Ga0070665_100105379 3300005548 Bacteria 2822
75 Ga0070665_100188240 3300005548 Bacteria 2065
76 Ga0070704_100040889 3300005549 Bacteria 3195
77 Ga0070704_100127515 3300005549 Bacteria 1966
78 Ga0070704_100203860 3300005549 Bacteria 1598
79 Ga0070704_100305000 3300005549 Bacteria 1328
80 Ga0070704_100335158 3300005549 Bacteria 1272
81 Ga0070704_100470734 3300005549 Bacteria 1085
82 Ga0068855_100303069 3300005563 Bacteria 1769
83 Ga0070664_100047784 3300005564 Bacteria 3616
84 Ga0070664_100210718 3300005564 Bacteria 1736
85 Ga0068857_100207129 3300005577 Unclassified 1789
86 Ga0068854_100005014 3300005578 Bacteria 8349
87 Ga0068854_100037060 3300005578 Bacteria 3421
88 Ga0068854_100059275 3300005578 Bacteria 2766
89 Ga0070702_100098759 3300005615 Bacteria 1787
90 Ga0070702_100199602 3300005615 Bacteria 1323
91 Ga0068852_100544627 3300005616 Bacteria 1160
92 Ga0068859_100045205 3300005617 Bacteria 4425
93 Ga0068859_100185385 3300005617 Unclassified 2165
94 Ga0068859_100213636 3300005617 Bacteria 2016
95 Ga0068859_100235567 3300005617 Unclassified 1919
96 Ga0068859_100670995 3300005617 Bacteria 1128
97 Ga0068864_100012241 3300005618 Bacteria 7089
98 Ga0068864_100071795 3300005618 Bacteria 3016
99 Ga0068864_100137219 3300005618 Bacteria 2203
100 Ga0068866_10086760 3300005718 Bacteria 1694
101 Ga0068861_100014453 3300005719 Bacteria 5541
102 Ga0068861_100161555 3300005719 Bacteria 1848
103 Ga0068861_100169451 3300005719 Unclassified 1808
104 Ga0068870_10007702 3300005840 Bacteria 4815
105 Ga0068870_10079544 3300005840 Bacteria 1809
106 Ga0068863_100001180 3300005841 Bacteria 26124
107 Ga0068863_100095828 3300005841 Unclassified 2817
108 Ga0068863_100118780 3300005841 Unclassified 2520
109 Ga0068858_100003770 3300005842 Bacteria 14981
110 Ga0068858_100041858 3300005842 Bacteria 4246
111 Ga0068858_100117617 3300005842 Bacteria 2485
112 Ga0068858_100240293 3300005842 Bacteria 1718
113 Ga0068860_100028012 3300005843 Bacteria 5424
114 Ga0068860_100081348 3300005843 Bacteria 3080
115 Ga0068860_100366107 3300005843 Unclassified 1421
116 Ga0068860_100486959 3300005843 Bacteria 1230
117 Ga0068862_100015252 3300005844 Bacteria 6382
118 Ga0081455_10030864 3300005937 Bacteria 4861
119 Ga0075364_10038108 3300006051 Bacteria 3115
120 Ga0068871_100004628 3300006358 Bacteria 9607
121 Ga0068871_100061619 3300006358 Unclassified 3064
122 Ga0068871_100104825 3300006358 Bacteria 2372
123 Ga0075428_100002943 3300006844 Bacteria 18557
124 Ga0075428_100057643 3300006844 Bacteria 4252
125 Ga0075430_100493688 3300006846 Bacteria 1010
126 Ga0075431_100107539 3300006847 Bacteria 2878
127 Ga0075431_100131763 3300006847 Bacteria 2578
128 Ga0075433_10027177 3300006852 Bacteria 4851
129 Ga0075433_10034721 3300006852 Bacteria 4333
130 Ga0075433_10055303 3300006852 Bacteria 3464
131 Ga0075433_10082567 3300006852 Unclassified 2834
132 Ga0075434_100000026 3300006871 Bacteria 68165
133 Ga0075434_100010651 3300006871 Bacteria 8631
134 Ga0075434_100123878 3300006871 Bacteria 2601
135 Ga0075434_100147274 3300006871 Bacteria 2375
136 Ga0075434_100560014 3300006871 Bacteria 1163
137 Ga0075429_100008693 3300006880 Bacteria 8837
138 Ga0075429_100044176 3300006880 Bacteria 3876
139 Ga0075429_100056466 3300006880 Unclassified 3417
140 Ga0075429_100138655 3300006880 Bacteria 2129
141 Ga0075429_100355909 3300006880 Bacteria 1282
142 Ga0068865_100017560 3300006881 Bacteria 4603
143 Ga0068865_100093745 3300006881 Unclassified 2184
144 Ga0075436_100000600 3300006914 Bacteria 23619
145 Ga0075436_100009299 3300006914 Bacteria 6724
146 Ga0075436_100022899 3300006914 Bacteria 4291
147 Ga0097620_100045206 3300006931 Bacteria 4425
148 Ga0097620_100185389 3300006931 Unclassified 2165
149 Ga0097620_100213631 3300006931 Bacteria 2016
150 Ga0097620_100235585 3300006931 Unclassified 1919
151 Ga0097620_100671083 3300006931 Bacteria 1128
152 Ga0075435_100000017 3300007076 Bacteria 99666
153 Ga0075435_100005047 3300007076 Bacteria 9169
154 Ga0075435_100006307 3300007076 Bacteria 8375
155 Ga0075435_100007466 3300007076 Bacteria 7794
156 Ga0075435_100018838 3300007076 Bacteria 5260
157 Ga0075435_100019935 3300007076 Bacteria 5128
158 Ga0075435_100028446 3300007076 Bacteria 4385
159 Ga0075435_100220460 3300007076 Bacteria 1611
160 Ga0111539_10000685 3300009094 Bacteria 43832
161 Ga0111539_10006195 3300009094 Bacteria 15435
162 Ga0111539_10040254 3300009094 Bacteria 5627
163 Ga0105245_10331020 3300009098 Bacteria 1503
164 Ga0105245_10461575 3300009098 Unclassified 1280
165 Ga0114129_10008732 3300009147 Bacteria 14448
166 Ga0114129_10024644 3300009147 Bacteria 8527
167 Ga0114129_10030155 3300009147 Bacteria 7682
168 Ga0114129_10063076 3300009147 Bacteria 5176
169 Ga0114129_10105469 3300009147 Bacteria 3895
170 Ga0114129_10150938 3300009147 Unclassified 3180
171 Ga0114129_10217124 3300009147 Bacteria 2582
172 Ga0114129_10224866 3300009147 Bacteria 2530
173 Ga0114129_10396237 3300009147 Bacteria 1820
174 Ga0114129_10410471 3300009147 Bacteria 1783
175 Ga0114129_10850276 3300009147 Unclassified 1160
176 Ga0105243_10020195 3300009148 Bacteria 5051
177 Ga0105243_10323108 3300009148 Bacteria 1407
178 Ga0105242_10024408 3300009176 Bacteria 4775
179 Ga0105242_10027380 3300009176 Bacteria 4526
180 Ga0105242_10223274 3300009176 Unclassified 1685
181 Ga0105248_10008980 3300009177 Bacteria 10988
182 Ga0105248_10043026 3300009177 Bacteria 5065
183 Ga0105248_10072035 3300009177 Bacteria 3883
184 Ga0105248_10212677 3300009177 Bacteria 2178
185 Ga0105248_10216113 3300009177 Bacteria 2159
186 Ga0105248_10243893 3300009177 Bacteria 2022
187 Ga0105248_10876825 3300009177 Bacteria 1013
188 Ga0105238_10020442 3300009551 Bacteria 6740
189 Ga0105249_10015133 3300009553 Bacteria 6826
190 Ga0105249_10178632 3300009553 Bacteria 2064
191 Ga0105246_10006926 3300011119 Bacteria 6936
192 Ga0105246_10366379 3300011119 Bacteria 1186
193 Ga0163162_10071838 3300013306 Unclassified 3515
194 Ga0163162_10079089 3300013306 Bacteria 3354
195 Ga0157375_10140725 3300013308 Bacteria 2540
196 Ga0157375_10190881 3300013308 Bacteria 2203
197 Ga0157375_10208565 3300013308 Bacteria 2111
198 Ga0163163_10014644 3300014325 Bacteria 7212
199 Ga0163163_10175737 3300014325 Bacteria 2188
200 Ga0157380_10013132 3300014326 Bacteria 6029
201 Ga0157380_10022833 3300014326 Bacteria 4717
202 Ga0157380_10090294 3300014326 Bacteria 2527
203 Ga0157380_10120448 3300014326 Unclassified 2222
204 Ga0157380_10120711 3300014326 Bacteria 2220
205 Ga0157380_10170628 3300014326 Bacteria 1901
206 Ga0157379_10011923 3300014968 Bacteria 7595
207 Ga0157379_10019664 3300014968 Bacteria 5966
208 Ga0157376_10009359 3300014969 Bacteria 7119
209 Ga0163161_10114579 3300017792 Bacteria 2019
210 Ga0207697_10000401 3300025315 Bacteria 24402
211 Ga0207682_10141042 3300025893 Unclassified 1081
212 Ga0207642_10009984 3300025899 Bacteria 3326
213 Ga0207688_10001140 3300025901 Bacteria 13699
214 Ga0207680_10001376 3300025903 Bacteria 11507
215 Ga0207680_10005949 3300025903 Bacteria 5863
216 Ga0207645_10002384 3300025907 Bacteria 14794
217 Ga0207645_10012339 3300025907 Bacteria 5799
218 Ga0207645_10026966 3300025907 Bacteria 3712
219 Ga0207645_10117682 3300025907 Unclassified 1724
220 Ga0207643_10003749 3300025908 Bacteria 8164
221 Ga0207643_10073078 3300025908 Bacteria 1976
222 Ga0207707_10048200 3300025912 Bacteria 3711
223 Ga0207663_10160644 3300025916 Bacteria 1586
224 Ga0207662_10002983 3300025918 Bacteria 8619
225 Ga0207662_10092370 3300025918 Bacteria 1863
226 Ga0207649_10025734 3300025920 Bacteria 3434
227 Ga0207652_10061614 3300025921 Bacteria 3240
228 Ga0207652_10222842 3300025921 Bacteria 1699
229 Ga0207646_10068402 3300025922 Bacteria 3171
230 Ga0207646_10074523 3300025922 Bacteria 3032
231 Ga0207646_10239663 3300025922 Bacteria 1638
232 Ga0207646_10265293 3300025922 Unclassified 1552
233 Ga0207681_10020570 3300025923 Bacteria 4184
234 Ga0207681_10031798 3300025923 Bacteria 3449
235 Ga0207681_10130947 3300025923 Bacteria 1854
236 Ga0207681_10142506 3300025923 Bacteria 1786
237 Ga0207681_10215077 3300025923 Bacteria 1484
238 Ga0207681_10270414 3300025923 Bacteria 1334
239 Ga0207694_10434167 3300025924 Bacteria 1095
240 Ga0207650_10460124 3300025925 Bacteria 1060
241 Ga0207659_10000201 3300025926 Bacteria 35674
242 Ga0207659_10001954 3300025926 Bacteria 12238
243 Ga0207659_10003320 3300025926 Bacteria 9641
244 Ga0207659_10009858 3300025926 Bacteria 5979
245 Ga0207659_10022140 3300025926 Bacteria 4229
246 Ga0207687_10052349 3300025927 Unclassified 2849
247 Ga0207706_10008438 3300025933 Bacteria 9507
248 Ga0207706_10043039 3300025933 Bacteria 4002
249 Ga0207706_10133230 3300025933 Unclassified 2186
250 Ga0207706_10267959 3300025933 Unclassified 1491
251 Ga0207686_10179986 3300025934 Bacteria 1498
252 Ga0207686_10270106 3300025934 Unclassified 1251
253 Ga0207709_10025070 3300025935 Bacteria 3412
254 Ga0207709_10029823 3300025935 Bacteria 3168
255 Ga0207670_10090854 3300025936 Bacteria 2158
256 Ga0207670_10120022 3300025936 Bacteria 1909
257 Ga0207670_10367217 3300025936 Bacteria 1143
258 Ga0207669_10026100 3300025937 Bacteria 3171
259 Ga0207669_10043878 3300025937 Unclassified 2622
260 Ga0207669_10053151 3300025937 Bacteria 2438
261 Ga0207704_10007256 3300025938 Bacteria 5222
262 Ga0207704_10116918 3300025938 Bacteria 1815
263 Ga0207704_10197362 3300025938 Bacteria 1469
264 Ga0207691_10000953 3300025940 Bacteria 28656
265 Ga0207691_10077563 3300025940 Bacteria 2993
266 Ga0207691_10150385 3300025940 Bacteria 2047
267 Ga0207691_10265057 3300025940 Bacteria 1480
268 Ga0207711_10040086 3300025941 Unclassified 3984
269 Ga0207711_10073700 3300025941 Bacteria 2968
270 Ga0207689_10005346 3300025942 Bacteria 11500
271 Ga0207689_10008919 3300025942 Bacteria 8698
272 Ga0207689_10187395 3300025942 Bacteria 1706
273 Ga0207679_10016274 3300025945 Bacteria 4935
274 Ga0207679_10303854 3300025945 Bacteria 1376
275 Ga0207651_10028422 3300025960 Bacteria 3527
276 Ga0207712_10242383 3300025961 Unclassified 1453
277 Ga0207668_10127821 3300025972 Unclassified 1936
278 Ga0207640_10006289 3300025981 Bacteria 6510
279 Ga0207640_10035521 3300025981 Bacteria 3120
280 Ga0207640_10046287 3300025981 Bacteria 2798
281 Ga0207640_10170049 3300025981 Bacteria 1623
282 Ga0207658_10056756 3300025986 Bacteria 2907
283 Ga0207677_10139972 3300026023 Unclassified 1851
284 Ga0207677_10148564 3300026023 Unclassified 1804
285 Ga0207703_10007098 3300026035 Bacteria 8912
286 Ga0207703_10096489 3300026035 Bacteria 2496
287 Ga0207678_10043299 3300026067 Bacteria 3895
288 Ga0207708_10007036 3300026075 Bacteria 8312
289 Ga0207708_10029358 3300026075 Bacteria 4168
290 Ga0207708_10063345 3300026075 Bacteria 2825
291 Ga0207641_10003014 3300026088 Bacteria 15205
292 Ga0207641_10274473 3300026088 Bacteria 1583
293 Ga0207641_10331127 3300026088 Unclassified 1446
294 Ga0207641_10388124 3300026088 Unclassified 1339
295 Ga0207648_10004852 3300026089 Bacteria 13716
296 Ga0207676_10029891 3300026095 Bacteria 4083
297 Ga0207676_10397263 3300026095 Bacteria 1287
298 Ga0207676_10563737 3300026095 Unclassified 1090
299 Ga0207674_10165206 3300026116 Bacteria 2168
300 Ga0207675_100004887 3300026118 Bacteria 12924
301 Ga0207675_100017057 3300026118 Bacteria 6785
302 Ga0207675_100023742 3300026118 Bacteria 5705
303 Ga0207675_100216163 3300026118 Unclassified 1845
304 Ga0207683_10009401 3300026121 Bacteria 8330
305 Ga0207683_10076047 3300026121 Bacteria 2973
306 Ga0207683_10314951 3300026121 Bacteria 1433
307 Ga0207428_10006320 3300027907 Bacteria 10954
308 Ga0207428_10024918 3300027907 Bacteria 5016
309 Ga0268266_10191549 3300028379 Bacteria 1867
310 Ga0268266_10277779 3300028379 Bacteria 1556
311 Ga0268266_10338422 3300028379 Bacteria 1412
312 Ga0268265_10022180 3300028380 Bacteria 4457
313 Ga0268264_10367247 3300028381 Unclassified 1374
314 Ga0268264_10523762 3300028381 Bacteria 1159
315 Ga0268264_10648550 3300028381 Bacteria 1045
316 Ga0307405_10015263 3300031731 Bacteria 4156
317 Ga0307409_100018110 3300031995 Bacteria 4720
318 Ga0307416_100231011 3300032002 Unclassified 1783
319 Ga0307416_100419576 3300032002 Bacteria 1382
320 Ga0307414_10481874 3300032004 Bacteria 1094
321 Ga0307411_10588289 3300032005 Bacteria 955
322 Ga0307415_100153564 3300032126 Bacteria 1775
323 Ga0373930_0003446 3300034816 Bacteria 2509
324 Ga0373948_0015168 3300034817 Bacteria 1412
325 Ga0373950_0000763 3300034818 Bacteria 4011
326 Ga0373928_0010096 3300035084 Bacteria 1850
327 Ga0373929_0001491 3300035085 Bacteria 4453
328 Ga0373934_0000435 3300035086 Bacteria 14563
329 Ga0373940_0002297 3300035088 Bacteria 3688
330 Ga0373949_0001478 3300035090 Bacteria 6705
331 Ga0373952_0000512 3300035092 Bacteria 6783
332 Ga0373932_0001481 3300035112 Bacteria 6561
333 Ga0373936_0060418 3300035113 Bacteria 1546
334 Ga0373939_0000394 3300035114 Bacteria 11029
335 Ga0373941_0001265 3300035115 Bacteria 5318
336 Ga0373941_0048390 3300035115 Bacteria 1342
337 Ga0373945_0017943 3300035116 Unclassified 2402
338 Ga0373953_0019363 3300035117 Unclassified 2531
339 Ga0373954_0033370 3300035118 Unclassified 2382
340 Ga0373956_0005080 3300035119 Bacteria 5267
341 Ga0373956_0054844 3300035119 Bacteria 1797
342 Ga0373956_0068737 3300035119 Unclassified 1614
343 Ga0373957_0045335 3300035120 Unclassified 1666
344 Ga0373960_0000197 3300035121 Bacteria 10990
345 Ga0373943_0010480 3300035170 Bacteria 4154
346 Ga0373946_0012901 3300035171 Bacteria 3133
347 Ga0373942_0002148 3300035207 Bacteria 4868
348 Ga0373961_0001086 3300035241 Bacteria 8665
349 Ga0373962_0002646 3300035242 Bacteria 4256
350 Ga0373924_0045634 3300035410 Bacteria 1803
351 Ga0373924_0077373 3300035410 Unclassified 1411
352 Ga0373931_0005366 3300035691 Bacteria 5917
353 Ga0373935_0029809 3300035692 Bacteria 3378
354 Ga0373927_0133869 3300035695 Bacteria 1620
355 Ga0373947_0063497 3300035725 Bacteria 2250
356 Ga0373947_0135777 3300035725 Bacteria 1574
357 Ga0373947_0136802 3300035725 Bacteria 1568
358 Ga0373947_0211701 3300035725 Bacteria 1272
359 Ga0373937_0000232 3300036401 Bacteria 54273
360 Ga0373937_0010656 3300036401 Bacteria 8037
361 Ga0373937_0054025 3300036401 Bacteria 3685
362 Ga0373937_0392039 3300036401 Bacteria 1317
363 Ga0373925_0001894 3300037068 Bacteria 17368
364 Ga0373925_0017187 3300037068 Bacteria 5239
365 Ga0373925_0045889 3300037068 Bacteria 3247
366 Ga0373925_0116086 3300037068 Bacteria 2073
367 Ga0439431_0027411 3300041997 Unclassified 1399
368 Ga0439450_006629 3300042008 Bacteria 2092
369 Ga0439434_0028487 3300042435 Unclassified 1691
370 Ga0451576_0414552 3300045051 Unclassified 1413
371 Ga0466967_0247692 3300045976 Unclassified 1701
372 Ga0495651_0097652 3300046462 Unclassified 2193
373 Ga0495580_0059543 3300046472 Bacteria 2684
374 Ga0495664_0077226 3300046477 Unclassified 1994
375 Ga0495664_0158816 3300046477 Bacteria 1372
376 Ga0495608_0002090 3300046511 Bacteria 14397
377 Ga0495630_0342535 3300046517 Unclassified 1144
378 Ga0495630_0343913 3300046517 Unclassified 1141
379 Ga0495652_0100733 3300046529 Unclassified 2343
380 Ga0495586_0099893 3300046535 Bacteria 1610
381 Ga0495586_0102645 3300046535 Unclassified 1588
382 Ga0495645_0023365 3300046543 Bacteria 4476
383 Ga0495645_0193467 3300046543 Unclassified 1384
384 Ga0495667_0013809 3300046559 Bacteria 5455
385 Ga0495623_0084687 3300046679 Bacteria 1956
386 Ga0495647_0004938 3300046681 Bacteria 4368
387 Ga0495658_0030840 3300046683 Bacteria 2915
388 Ga0495658_0114177 3300046683 Bacteria 1627
389 Ga0495658_0217473 3300046683 Bacteria 1195
390 Ga0495669_0006162 3300046684 Bacteria 5002
391 Ga0495670_0164673 3300046691 Bacteria 1166
392 Ga0495604_0032452 3300047317 Bacteria 4138
393 Ga0495674_0324939 3300047319 Bacteria 1253
394 Ga0495684_0000087 3300047471 Bacteria 64920
395 Ga0495593_0173710 3300047673 Bacteria 1086
396 Ga0496101_0269181 3300048904 Bacteria 1330
397 Ga0496102_0457125 3300048905 Bacteria 1198
398 Ga0496102_0484123 3300048905 Bacteria 1159
399 Ga0496106_0059688 3300048909 Bacteria 2890
400 Ga0496109_0088313 3300048912 Bacteria 2865
401 Ga0496109_0307898 3300048912 Bacteria 1494
402 Ga0496112_0006375 3300048915 Bacteria 10356
403 Ga0496114_0214678 3300048917 Bacteria 1688
404 Ga0496114_0398211 3300048917 Bacteria 1219
405 Ga0496115_0092369 3300048918 Bacteria 2474
406 Ga0501031_0120262 3300049568 Bacteria 1716
407 Ga0501036_0173313 3300049572 Bacteria 1817
408 Ga0501039_0210585 3300049575 Bacteria 1529
409 Ga0501071_0041026 3300049587 Bacteria 3314
410 Ga0501072_0093066 3300049588 Bacteria 2394
411 Ga0501072_0133588 3300049588 Bacteria 1979
412 Ga0501076_0054099 3300049592 Bacteria 3181
413 Ga0501080_0443552 3300049742 Bacteria 1164
414 Ga0501083_0096908 3300049744 Bacteria 1946
415 nmdc:mga00v17_61340_c1 3300050491 Bacteria 2311
416 nmdc:mga05p37_123354_c1 3300050507 Unclassified 3182
417 nmdc:mga05p37_150692_c1 3300050507 Bacteria 2845
418 nmdc:mga05p37_16284_c1 3300050507 Bacteria 8950
419 nmdc:mga05p37_171806_c1 3300050507 Bacteria 2643
420 nmdc:mga05p37_20210_c1 3300050507 Bacteria 8060
421 nmdc:mga05p37_26789_c1 3300050507 Bacteria 7011
422 nmdc:mga05p37_305221_c1 3300050507 Unclassified 1889
423 nmdc:mga05p37_8548_c1 3300050507 Bacteria 12100
424 nmdc:mga05p37_95657_c1 3300050507 Bacteria 3659
425 nmdc:mga09592_36456_c1 3300050508 Bacteria 4119
426 nmdc:mga09592_38797_c1 3300050508 Bacteria 3999
427 nmdc:mga09592_905_c1 3300050508 Bacteria 23310
428 nmdc:mga0qj67_472008_c1 3300050509 Bacteria 1010
429 nmdc:mga06r32_314438_c1 3300050510 Bacteria 1552
430 nmdc:mga06r32_69693_c1 3300050510 Bacteria 3399
431 nmdc:mga06r32_71756_c1 3300050510 Bacteria 3351
432 nmdc:mga08y16_104463_c1 3300050511 Unclassified 2949
433 nmdc:mga08y16_23190_c1 3300050511 Bacteria 6551
434 nmdc:mga08y16_556937_c1 3300050511 Bacteria 1160
435 nmdc:mga08y16_895711_c1 3300050511 Unclassified 874
436 nmdc:mga0n895_157888_c1 3300050512 Bacteria 2299
437 nmdc:mga0n895_234570_c1 3300050512 Bacteria 1862
438 nmdc:mga0n895_37_c1 3300050512 Bacteria 77167
439 nmdc:mga0n895_522124_c1 3300050512 Bacteria 1195
440 nmdc:mga0n895_79886_c1 3300050512 Bacteria 3258
441 nmdc:mga0n895_8171_c1 3300050512 Bacteria 9044
442 nmdc:mga0rr50_14_c1 3300050513 Bacteria 196574
443 nmdc:mga0rr50_1724_c1 3300050513 Bacteria 12052
444 nmdc:mga0rr50_210485_c1 3300050513 Bacteria 1602
445 nmdc:mga0rr50_22635_c1 3300050513 Bacteria 4317
446 nmdc:mga0rr50_243959_c1 3300050513 Bacteria 1490
447 nmdc:mga08x19_275_c1 3300050514 Bacteria 38855
448 nmdc:mga08x19_7678_c1 3300050514 Bacteria 6403
449 nmdc:mga0a205_49331_c1 3300050515 Bacteria 4063
450 nmdc:mga0a205_505504_c1 3300050515 Unclassified 1065
451 nmdc:mga0a205_69584_c1 3300050515 Unclassified 3398
452 nmdc:mga0a205_72273_c1 3300050515 Bacteria 2602
453 Ga0495601_0030442 3300053077 Bacteria 3351
454 Ga0495601_0117828 3300053077 Bacteria 1723
455 Ga0495619_0002209 3300053085 Bacteria 12891
456 Ga0501082_0314255 3300060353 Bacteria 1364
457 Ga0530510_0146118 3300061734 Bacteria 1744
458 Ga0495635_0189881
459 Ga0065712_10089488
460 Ga0065707_10085126
461 Ga0070676_10111785
462 Ga0070670_100002204
463 Ga0070670_100020506
464 Ga0070677_10154368
465 Ga0068869_100002479
466 Ga0068869_100011346
467 Ga0068869_100123772
468 Ga0070666_10001247
469 Ga0070666_10254858
470 Ga0068868_100189331
471 Ga0070689_100413565
472 Ga0070691_10018650
473 Ga0070687_100229435
474 Ga0070661_100010515
475 Ga0070668_100081666
476 Ga0070668_100427206
477 Ga0070669_100053201
478 Ga0070669_100150726
479 Ga0070675_100000204
480 Ga0070675_100000342
481 Ga0070675_100001621
482 Ga0070675_100027339
483 Ga0070675_100102316
484 Ga0070671_100206881
485 Ga0070674_100093453
486 Ga0070674_100093667
487 Ga0070674_100107158
488 Ga0070674_100324182
489 Ga0070673_100020088
490 Ga0070688_100011900
491 Ga0070688_100286013
492 Ga0070688_100418576
493 Ga0070667_100025435
494 Ga0070713_100034896
495 Ga0070713_100122950
496 Ga0070701_10009264
497 Ga0070701_10064111
498 Ga0070711_100076447
499 Ga0070705_100005417
500 Ga0070700_100053347
501 Ga0070694_100004755
502 Ga0070663_100142291
503 Ga0070678_100054569
504 Ga0070662_100081285
505 Ga0070662_100271387
506 Ga0070681_10058717
507 Ga0068867_100005747
508 Ga0068867_100015354
509 Ga0070685_10076034
510 Ga0070706_100116848
511 Ga0070706_100395844
512 Ga0070707_100045492
513 Ga0070698_100127135
514 Ga0070699_100037950
515 Ga0070699_100183384
516 Ga0070684_100105726
517 Ga0070672_100143187
518 Ga0070672_100188184
519 Ga0070672_100275184
520 Ga0070672_100278685
521 Ga0070686_100001018
522 Ga0070686_100060592
523 Ga0070686_100085884
524 Ga0070695_100006575
525 Ga0070696_100096947
526 Ga0070696_100097991
527 Ga0070696_100145236
528 Ga0070696_100276753
529 Ga0070665_100029854
530 Ga0070665_100039676
531 Ga0070665_100105379
532 Ga0070665_100188240
533 Ga0070704_100040889
534 Ga0070704_100127515
535 Ga0070704_100203860
536 Ga0070704_100305000
537 Ga0070704_100335158
538 Ga0070704_100470734
539 Ga0068855_100303069
540 Ga0070664_100047784
541 Ga0070664_100210718
542 Ga0068857_100207129
543 Ga0068854_100005014
544 Ga0068854_100037060
545 Ga0068854_100059275
546 Ga0070702_100098759
547 Ga0070702_100199602
548 Ga0068852_100544627
549 Ga0068859_100045205
550 Ga0068859_100185385
551 Ga0068859_100213636
552 Ga0068859_100235567
553 Ga0068859_100670995
554 Ga0068864_100012241
555 Ga0068864_100071795
556 Ga0068864_100137219
557 Ga0068866_10086760
558 Ga0068861_100014453
559 Ga0068861_100161555
560 Ga0068861_100169451
561 Ga0068870_10007702
562 Ga0068870_10079544
563 Ga0068863_100001180
564 Ga0068863_100095828
565 Ga0068863_100118780
566 Ga0068858_100003770
567 Ga0068858_100041858
568 Ga0068858_100117617
569 Ga0068858_100240293
570 Ga0068860_100028012
571 Ga0068860_100081348
572 Ga0068860_100366107
573 Ga0068860_100486959
574 Ga0068862_100015252
575 Ga0081455_10030864
576 Ga0075364_10038108
577 Ga0068871_100004628
578 Ga0068871_100061619
579 Ga0068871_100104825
580 Ga0075428_100002943
581 Ga0075428_100057643
582 Ga0075430_100493688
583 Ga0075431_100107539
584 Ga0075431_100131763
585 Ga0075433_10027177
586 Ga0075433_10034721
587 Ga0075433_10055303
588 Ga0075433_10082567
589 Ga0075434_100000026
590 Ga0075434_100010651
591 Ga0075434_100123878
592 Ga0075434_100147274
593 Ga0075434_100560014
594 Ga0075429_100008693
595 Ga0075429_100044176
596 Ga0075429_100056466
597 Ga0075429_100138655
598 Ga0075429_100355909
599 Ga0068865_100017560
600 Ga0068865_100093745
601 Ga0075436_100000600
602 Ga0075436_100009299
603 Ga0075436_100022899
604 Ga0097620_100045206
605 Ga0097620_100185389
606 Ga0097620_100213631
607 Ga0097620_100235585
608 Ga0097620_100671083
609 Ga0075435_100000017
610 Ga0075435_100005047
611 Ga0075435_100006307
612 Ga0075435_100007466
613 Ga0075435_100018838
614 Ga0075435_100019935
615 Ga0075435_100028446
616 Ga0075435_100220460
617 Ga0111539_10000685
618 Ga0111539_10006195
619 Ga0111539_10040254
620 Ga0105245_10331020
621 Ga0105245_10461575
622 Ga0114129_10008732
623 Ga0114129_10024644
624 Ga0114129_10030155
625 Ga0114129_10063076
626 Ga0114129_10105469
627 Ga0114129_10150938
628 Ga0114129_10217124
629 Ga0114129_10224866
630 Ga0114129_10396237
631 Ga0114129_10410471
632 Ga0114129_10850276
633 Ga0105243_10020195
634 Ga0105243_10323108
635 Ga0105242_10024408
636 Ga0105242_10027380
637 Ga0105242_10223274
638 Ga0105248_10008980
639 Ga0105248_10043026
640 Ga0105248_10072035
641 Ga0105248_10212677
642 Ga0105248_10216113
643 Ga0105248_10243893
644 Ga0105248_10876825
645 Ga0105238_10020442
646 Ga0105249_10015133
647 Ga0105249_10178632
648 Ga0105246_10006926
649 Ga0105246_10366379
650 Ga0163162_10071838
651 Ga0163162_10079089
652 Ga0157375_10140725
653 Ga0157375_10190881
654 Ga0157375_10208565
655 Ga0163163_10014644
656 Ga0163163_10175737
657 Ga0157380_10013132
658 Ga0157380_10022833
659 Ga0157380_10090294
660 Ga0157380_10120448
661 Ga0157380_10120711
662 Ga0157380_10170628
663 Ga0157379_10011923
664 Ga0157379_10019664
665 Ga0157376_10009359
666 Ga0163161_10114579
667 Ga0207697_10000401
668 Ga0207682_10141042
669 Ga0207642_10009984
670 Ga0207688_10001140
671 Ga0207680_10001376
672 Ga0207680_10005949
673 Ga0207645_10002384
674 Ga0207645_10012339
675 Ga0207645_10026966
676 Ga0207645_10117682
677 Ga0207643_10003749
678 Ga0207643_10073078
679 Ga0207707_10048200
680 Ga0207663_10160644
681 Ga0207662_10002983
682 Ga0207662_10092370
683 Ga0207649_10025734
684 Ga0207652_10061614
685 Ga0207652_10222842
686 Ga0207646_10068402
687 Ga0207646_10074523
688 Ga0207646_10239663
689 Ga0207646_10265293
690 Ga0207681_10020570
691 Ga0207681_10031798
692 Ga0207681_10130947
693 Ga0207681_10142506
694 Ga0207681_10215077
695 Ga0207681_10270414
696 Ga0207694_10434167
697 Ga0207650_10460124
698 Ga0207659_10000201
699 Ga0207659_10001954
700 Ga0207659_10003320
701 Ga0207659_10009858
702 Ga0207659_10022140
703 Ga0207687_10052349
704 Ga0207706_10008438
705 Ga0207706_10043039
706 Ga0207706_10133230
707 Ga0207706_10267959
708 Ga0207686_10179986
709 Ga0207686_10270106
710 Ga0207709_10025070
711 Ga0207709_10029823
712 Ga0207670_10090854
713 Ga0207670_10120022
714 Ga0207670_10367217
715 Ga0207669_10026100
716 Ga0207669_10043878
717 Ga0207669_10053151
718 Ga0207704_10007256
719 Ga0207704_10116918
720 Ga0207704_10197362
721 Ga0207691_10000953
722 Ga0207691_10077563
723 Ga0207691_10150385
724 Ga0207691_10265057
725 Ga0207711_10040086
726 Ga0207711_10073700
727 Ga0207689_10005346
728 Ga0207689_10008919
729 Ga0207689_10187395
730 Ga0207679_10016274
731 Ga0207679_10303854
732 Ga0207651_10028422
733 Ga0207712_10242383
734 Ga0207668_10127821
735 Ga0207640_10006289
736 Ga0207640_10035521
737 Ga0207640_10046287
738 Ga0207640_10170049
739 Ga0207658_10056756
740 Ga0207677_10139972
741 Ga0207677_10148564
742 Ga0207703_10007098
743 Ga0207703_10096489
744 Ga0207678_10043299
745 Ga0207708_10007036
746 Ga0207708_10029358
747 Ga0207708_10063345
748 Ga0207641_10003014
749 Ga0207641_10274473
750 Ga0207641_10331127
751 Ga0207641_10388124
752 Ga0207648_10004852
753 Ga0207676_10029891
754 Ga0207676_10397263
755 Ga0207676_10563737
756 Ga0207674_10165206
757 Ga0207675_100004887
758 Ga0207675_100017057
759 Ga0207675_100023742
760 Ga0207675_100216163
761 Ga0207683_10009401
762 Ga0207683_10076047
763 Ga0207683_10314951
764 Ga0207428_10006320
765 Ga0207428_10024918
766 Ga0268266_10191549
767 Ga0268266_10277779
768 Ga0268266_10338422
769 Ga0268265_10022180
770 Ga0268264_10367247
771 Ga0268264_10523762
772 Ga0268264_10648550
773 Ga0307405_10015263
774 Ga0307409_100018110
775 Ga0307416_100231011
776 Ga0307416_100419576
777 Ga0307414_10481874
778 Ga0307411_10588289
779 Ga0307415_100153564
780 Ga0373930_0003446
781 Ga0373948_0015168
782 Ga0373950_0000763
783 Ga0373928_0010096
784 Ga0373929_0001491
785 Ga0373934_0000435
786 Ga0373940_0002297
787 Ga0373949_0001478
788 Ga0373952_0000512
789 Ga0373932_0001481
790 Ga0373936_0060418
791 Ga0373939_0000394
792 Ga0373941_0001265
793 Ga0373941_0048390
794 Ga0373945_0017943
795 Ga0373953_0019363
796 Ga0373954_0033370
797 Ga0373956_0005080
798 Ga0373956_0054844
799 Ga0373956_0068737
800 Ga0373957_0045335
801 Ga0373960_0000197
802 Ga0373943_0010480
803 Ga0373946_0012901
804 Ga0373942_0002148
805 Ga0373961_0001086
806 Ga0373962_0002646
807 Ga0373924_0045634
808 Ga0373924_0077373
809 Ga0373931_0005366
810 Ga0373935_0029809
811 Ga0373927_0133869
812 Ga0373947_0063497
813 Ga0373947_0135777
814 Ga0373947_0136802
815 Ga0373947_0211701
816 Ga0373937_0000232
817 Ga0373937_0010656
818 Ga0373937_0054025
819 Ga0373937_0392039
820 Ga0373925_0001894
821 Ga0373925_0017187
822 Ga0373925_0045889
823 Ga0373925_0116086
824 Ga0439431_0027411
825 Ga0439450_006629
826 Ga0439434_0028487
827 Ga0451576_0414552
828 Ga0466967_0247692
829 Ga0495651_0097652
830 Ga0495580_0059543
831 Ga0495664_0077226
832 Ga0495664_0158816
833 Ga0495608_0002090
834 Ga0495630_0342535
835 Ga0495630_0343913
836 Ga0495652_0100733
837 Ga0495586_0099893
838 Ga0495586_0102645
839 Ga0495645_0023365
840 Ga0495645_0193467
841 Ga0495667_0013809
842 Ga0495623_0084687
843 Ga0495647_0004938
844 Ga0495658_0030840
845 Ga0495658_0114177
846 Ga0495658_0217473
847 Ga0495669_0006162
848 Ga0495670_0164673
849 Ga0495604_0032452
850 Ga0495674_0324939
851 Ga0495684_0000087
852 Ga0495593_0173710
853 Ga0496101_0269181
854 Ga0496102_0457125
855 Ga0496102_0484123
856 Ga0496106_0059688
857 Ga0496109_0088313
858 Ga0496109_0307898
859 Ga0496112_0006375
860 Ga0496114_0214678
861 Ga0496114_0398211
862 Ga0496115_0092369
863 Ga0501031_0120262
864 Ga0501036_0173313
865 Ga0501039_0210585
866 Ga0501071_0041026
867 Ga0501072_0093066
868 Ga0501072_0133588
869 Ga0501076_0054099
870 Ga0501080_0443552
871 Ga0501083_0096908
872 nmdc:mga00v17_61340_c1
873 nmdc:mga05p37_123354_c1
874 nmdc:mga05p37_150692_c1
875 nmdc:mga05p37_16284_c1
876 nmdc:mga05p37_171806_c1
877 nmdc:mga05p37_20210_c1
878 nmdc:mga05p37_26789_c1
879 nmdc:mga05p37_305221_c1
880 nmdc:mga05p37_8548_c1
881 nmdc:mga05p37_95657_c1
882 nmdc:mga09592_36456_c1
883 nmdc:mga09592_38797_c1
884 nmdc:mga09592_905_c1
885 nmdc:mga0qj67_472008_c1
886 nmdc:mga06r32_314438_c1
887 nmdc:mga06r32_69693_c1
888 nmdc:mga06r32_71756_c1
889 nmdc:mga08y16_104463_c1
890 nmdc:mga08y16_23190_c1
891 nmdc:mga08y16_556937_c1
892 nmdc:mga08y16_895711_c1
893 nmdc:mga0n895_157888_c1
894 nmdc:mga0n895_234570_c1
895 nmdc:mga0n895_37_c1
896 nmdc:mga0n895_522124_c1
897 nmdc:mga0n895_79886_c1
898 nmdc:mga0n895_8171_c1
899 nmdc:mga0rr50_14_c1
900 nmdc:mga0rr50_1724_c1
901 nmdc:mga0rr50_210485_c1
902 nmdc:mga0rr50_22635_c1
903 nmdc:mga0rr50_243959_c1
904 nmdc:mga08x19_275_c1
905 nmdc:mga08x19_7678_c1
906 nmdc:mga0a205_49331_c1
907 nmdc:mga0a205_505504_c1
908 nmdc:mga0a205_69584_c1
909 nmdc:mga0a205_72273_c1
910 Ga0495601_0030442
911 Ga0495601_0117828
912 Ga0495619_0002209
913 Ga0501082_0314255
914 Ga0530510_0146118

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13180

PDZ_2

PDZ domain

226

316

0.94

PF13365

Trypsin_2

Trypsin-like peptidase domain

57

191

0.91

PF17820

PDZ_6

PDZ domain

251

305

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lgt-assembly1.cif.gz_A y162a/h198p double mutant of degs-deltapdz protease 0.8925 16 197
3k6y-assembly1.cif.gz_A crystal structure of rv3671c protease from m. tuberculosis, active form 0.8911 16 191
3k6z-assembly1.cif.gz_B crystal structure of rv3671c protease, inactive form 0.8896 16 193
3b8j-assembly1.cif.gz_A q191a mutant of degs-deltapdz 0.8885 16 194
2qgr-assembly1.cif.gz_A structure of the r178a mutant of delta pdz degs protease 0.8872 16 194
ID Description Score Start End Superfamily
3gdvC03 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9343 201 299 2.30.42.10
3gdvC03 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9149 201 299 2.30.42.10
3mh4B01 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.9059 22 94 2.40.10.10
af_F1QL69_2_87_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9037 226 292 2.30.42.10
3stiA01 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.8955 13 87 2.40.10.10
ID Description Score Start End GO Terms
AF-A0A2V8E7W3-F1-model_v4 Uncharacterized protein 0.9718 1 115
AF-A0A3N5VEM7-F1-model_v4 Serine protease 0.9411 5 165 GO:0004252
GO:0005886
GO:0006515
GO:0042597
AF-A0A3M1SQ67-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9358 201 296 GO:0004177
GO:0006508
GO:0008235
AF-A0A535PW73-F1-model_v4 PDZ domain-containing protein 0.9353 205 292
AF-A0A3E1NPQ3-F1-model_v4 PDZ domain-containing protein 0.9335 200 295 GO:0006515
GO:0042597

Map