F448042

General Info

Members Datasets Scaffolds Average Seq Length
457 173 457 135

Family's Representative Sequence

Representative Sequence 3300044735|Ga0466968_0368532|Ga0466968_0368532_76_501
Length 141
Sequence VDVPRSLSTKVFFAILAAILFVVGIAGIIYKYFEQRDRMRMHAAVEVGGDPRRGEAMFIQYGCGSCHAVKDVRTATGMVGPPLDGIALRVIIAGHLANNPGNMERWIQNPQQVSPGTAMPNLHVGANDARDITAFLYTRAK

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.81
Rhizosphere 94.53
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10122091 3300001979 Bacteria 652
2 JGI24735J21928_10057698 3300002067 Bacteria 1117
3 Ga0070658_10063050 3300005327 Unclassified 3021
4 Ga0070658_10204884 3300005327 Bacteria 1665
5 Ga0070658_10525304 3300005327 Unclassified 1023
6 Ga0070658_10596199 3300005327 Bacteria 957
7 Ga0070658_10686776 3300005327 Unclassified 888
8 Ga0070683_100058939 3300005329 Bacteria 3567
9 Ga0070683_100152354 3300005329 Bacteria 2192
10 Ga0070683_101022237 3300005329 Bacteria 794
11 Ga0070690_100038684 3300005330 Bacteria 3011
12 Ga0070670_100063769 3300005331 Bacteria 3162
13 Ga0070670_100104424 3300005331 Bacteria 2441
14 Ga0070670_100679281 3300005331 Bacteria 925
15 Ga0070666_10002660 3300005335 Bacteria 10779
16 Ga0070680_100002569 3300005336 Bacteria 13424
17 Ga0070680_100208267 3300005336 Unclassified 1649
18 Ga0070680_100814494 3300005336 Unclassified 805
19 Ga0070682_100683671 3300005337 Bacteria 821
20 Ga0068868_100357345 3300005338 Unclassified 1252
21 Ga0068868_100432691 3300005338 Bacteria 1141
22 Ga0070660_100006487 3300005339 Bacteria 8114
23 Ga0070660_100021096 3300005339 Bacteria 4798
24 Ga0070660_100032890 3300005339 Bacteria 3906
25 Ga0070660_100112059 3300005339 Bacteria 2171
26 Ga0070660_100705075 3300005339 Bacteria 846
27 Ga0070689_100295410 3300005340 Unclassified 1347
28 Ga0070687_100142062 3300005343 Bacteria 1399
29 Ga0070687_100239864 3300005343 Unclassified 1120
30 Ga0070661_100025887 3300005344 Bacteria 4217
31 Ga0070661_100042886 3300005344 Unclassified 3304
32 Ga0070661_101175106 3300005344 Unclassified 641
33 Ga0070675_100058556 3300005354 Bacteria 3178
34 Ga0070675_100479263 3300005354 Unclassified 1119
35 Ga0070671_100015139 3300005355 Bacteria 6230
36 Ga0070673_100007942 3300005364 Bacteria 7032
37 Ga0070673_100391242 3300005364 Bacteria 1241
38 Ga0070673_101212096 3300005364 Bacteria 707
39 Ga0070688_100473614 3300005365 Unclassified 940
40 Ga0070659_100006363 3300005366 Bacteria 8529
41 Ga0070659_100024893 3300005366 Bacteria 4592
42 Ga0070659_100130507 3300005366 Bacteria 2041
43 Ga0070659_101665839 3300005366 Bacteria 570
44 Ga0070667_100003204 3300005367 Bacteria 14026
45 Ga0070667_100018847 3300005367 Bacteria 5723
46 Ga0070667_100050511 3300005367 Bacteria 3505
47 Ga0070667_100149265 3300005367 Bacteria 2052
48 Ga0070714_100024323 3300005435 Bacteria 4985
49 Ga0070713_101171704 3300005436 Unclassified 743
50 Ga0070663_100344100 3300005455 Bacteria 1206
51 Ga0070663_100742269 3300005455 Unclassified 837
52 Ga0070663_100826363 3300005455 Bacteria 796
53 Ga0070663_101903838 3300005455 Unclassified 534
54 Ga0070678_100000630 3300005456 Bacteria 17294
55 Ga0070678_100028567 3300005456 Bacteria 3806
56 Ga0070662_100025792 3300005457 Bacteria 4063
57 Ga0070662_100060161 3300005457 Plasmid 2769
58 Ga0070662_100143574 3300005457 Bacteria 1852
59 Ga0070662_100826413 3300005457 Bacteria 788
60 Ga0070662_101106454 3300005457 Unclassified 680
61 Ga0070681_10037966 3300005458 Bacteria 4830
62 Ga0068867_100086920 3300005459 Bacteria 2366
63 Ga0070685_10075489 3300005466 Bacteria 2008
64 Ga0070685_10292189 3300005466 Unclassified 1095
65 Ga0070679_100149842 3300005530 Bacteria 2310
66 Ga0070679_100166850 3300005530 Unclassified 2175
67 Ga0070679_100621561 3300005530 Unclassified 1023
68 Ga0070684_100206154 3300005535 Bacteria 1792
69 Ga0068853_100005874 3300005539 Bacteria 9676
70 Ga0068853_100016475 3300005539 Bacteria 6083
71 Ga0068853_100107483 3300005539 Unclassified 2474
72 Ga0068853_100473343 3300005539 Bacteria 1180
73 Ga0068853_100501606 3300005539 Archaea 1146
74 Ga0068853_100761100 3300005539 Unclassified 926
75 Ga0070672_100065271 3300005543 Bacteria 2879
76 Ga0070693_100003864 3300005547 Bacteria 7023
77 Ga0070665_100579952 3300005548 Unclassified 1134
78 Ga0068855_100015770 3300005563 Bacteria 9090
79 Ga0068855_100016170 3300005563 Bacteria 8970
80 Ga0068855_100090913 3300005563 Bacteria 3521
81 Ga0068855_100494374 3300005563 Bacteria 1330
82 Ga0068855_101114137 3300005563 Bacteria 824
83 Ga0070664_100034680 3300005564 Bacteria 4233
84 Ga0070664_100060948 3300005564 Plasmid 3214
85 Ga0070664_100161753 3300005564 Bacteria 1981
86 Ga0070664_100172933 3300005564 Unclassified 1917
87 Ga0068857_100032874 3300005577 Plasmid 4586
88 Ga0068857_100129485 3300005577 Unclassified 2275
89 Ga0068857_100767218 3300005577 Unclassified 919
90 Ga0068854_100003443 3300005578 Bacteria 9872
91 Ga0068854_100030744 3300005578 Bacteria 3727
92 Ga0068854_100086236 3300005578 Bacteria 2327
93 Ga0068854_100228546 3300005578 Unclassified 1475
94 Ga0068854_100453086 3300005578 Archaea 1072
95 Ga0068856_100007468 3300005614 Bacteria 10672
96 Ga0068856_100132884 3300005614 Bacteria 2494
97 Ga0068856_100155704 3300005614 Bacteria 2295
98 Ga0068856_100524276 3300005614 Unclassified 1206
99 Ga0068856_101056437 3300005614 Unclassified 830
100 Ga0068852_100000947 3300005616 Bacteria 19091
101 Ga0068852_100003304 3300005616 Bacteria 11260
102 Ga0068852_100080784 3300005616 Plasmid 2884
103 Ga0068852_100128552 3300005616 Unclassified 2330
104 Ga0068852_100168894 3300005616 Bacteria 2049
105 Ga0068852_100201573 3300005616 Bacteria 1883
106 Ga0068852_100207240 3300005616 Unclassified 1858
107 Ga0068852_100260793 3300005616 Unclassified 1664
108 Ga0068859_100186071 3300005617 Unclassified 2161
109 Ga0068859_100329468 3300005617 Bacteria 1621
110 Ga0068864_100001847 3300005618 Bacteria 17419
111 Ga0068864_100017956 3300005618 Bacteria 5902
112 Ga0068864_101723071 3300005618 Bacteria 631
113 Ga0068866_10010145 3300005718 Bacteria 4027
114 Ga0068866_10334973 3300005718 Bacteria 956
115 Ga0068851_10018509 3300005834 Bacteria 3355
116 Ga0068851_10019303 3300005834 Bacteria 3293
117 Ga0068863_100008161 3300005841 Bacteria 10227
118 Ga0068863_100029236 3300005841 Bacteria 5261
119 Ga0068863_100490162 3300005841 Bacteria 1209
120 Ga0068858_100003328 3300005842 Bacteria 16003
121 Ga0068860_100154651 3300005843 Bacteria 2210
122 Ga0068862_102214053 3300005844 Bacteria 561
123 Ga0070716_100137632 3300006173 Unclassified 1553
124 Ga0070712_100160038 3300006175 Bacteria 1738
125 Ga0097621_100024161 3300006237 Bacteria 4742
126 Ga0068871_100051641 3300006358 Bacteria 3329
127 Ga0068865_100013506 3300006881 Bacteria 5162
128 Ga0097620_100186065 3300006931 Unclassified 2161
129 Ga0097620_100329504 3300006931 Bacteria 1621
130 Ga0105240_10016062 3300009093 Bacteria 10146
131 Ga0105245_10070154 3300009098 Bacteria 3179
132 Ga0105243_10175099 3300009148 Bacteria 1861
133 Ga0105241_10293719 3300009174 Bacteria 1392
134 Ga0105248_10004260 3300009177 Bacteria 15834
135 Ga0105248_10005172 3300009177 Bacteria 14385
136 Ga0105237_10007969 3300009545 Bacteria 11537
137 Ga0105238_10069422 3300009551 Bacteria 3524
138 Ga0105238_10087482 3300009551 Bacteria 3103
139 Ga0105238_10096455 3300009551 Bacteria 2943
140 Ga0105238_11529838 3300009551 Bacteria 696
141 Ga0105239_10117833 3300010375 Unclassified 2947
142 Ga0157373_10001257 3300013100 Bacteria 19369
143 Ga0157373_10047694 3300013100 Bacteria 3055
144 Ga0157373_10917110 3300013100 Unclassified 651
145 Ga0157371_10022517 3300013102 Bacteria 4615
146 Ga0157371_10030966 3300013102 Bacteria 3856
147 Ga0157371_10036237 3300013102 Bacteria 3533
148 Ga0157371_10513428 3300013102 Unclassified 886
149 Ga0157370_10051091 3300013104 Bacteria 3950
150 Ga0157370_10052496 3300013104 Unclassified 3892
151 Ga0157370_10120010 3300013104 Bacteria 2455
152 Ga0157370_10209191 3300013104 Bacteria 1808
153 Ga0157370_10268615 3300013104 Unclassified 1576
154 Ga0157370_10385852 3300013104 Unclassified 1290
155 Ga0157369_10004147 3300013105 Bacteria 17165
156 Ga0157369_10012242 3300013105 Bacteria 9741
157 Ga0157369_10040375 3300013105 Bacteria 5094
158 Ga0157369_10089390 3300013105 Unclassified 3288
159 Ga0157369_10089835 3300013105 Bacteria 3280
160 Ga0157369_10565287 3300013105 Unclassified 1175
161 Ga0157374_10233723 3300013296 Bacteria 1806
162 Ga0157374_12031851 3300013296 Bacteria 601
163 Ga0157378_10213300 3300013297 Bacteria 1832
164 Ga0157378_10337744 3300013297 Bacteria 1468
165 Ga0157372_10003603 3300013307 Bacteria 16671
166 Ga0157372_10192248 3300013307 Bacteria 2364
167 Ga0157372_10425293 3300013307 Bacteria 1548
168 Ga0157375_10107233 3300013308 Bacteria 2886
169 Ga0163163_10062800 3300014325 Bacteria 3681
170 Ga0163163_10836240 3300014325 Bacteria 984
171 Ga0157379_10276919 3300014968 Bacteria 1526
172 Ga0157376_10102818 3300014969 Bacteria 2500
173 Ga0206354_10018236 3300020081 Bacteria 2103
174 Ga0206353_10841971 3300020082 Bacteria 1070
175 Ga0206353_11031190 3300020082 Bacteria 1968
176 Ga0213875_10226992 3300021388 Unclassified 879
177 Ga0207656_10019858 3300025321 Bacteria 2662
178 Ga0207642_10169251 3300025899 Unclassified 1180
179 Ga0207680_10002682 3300025903 Bacteria 8317
180 Ga0207680_10301756 3300025903 Bacteria 1116
181 Ga0207680_10414778 3300025903 Bacteria 953
182 Ga0207680_11153253 3300025903 Unclassified 553
183 Ga0207647_10002106 3300025904 Bacteria 15234
184 Ga0207647_10051546 3300025904 Bacteria 2543
185 Ga0207645_10079953 3300025907 Bacteria 2095
186 Ga0207705_10002105 3300025909 Bacteria 15478
187 Ga0207705_10050675 3300025909 Bacteria 2989
188 Ga0207705_10053383 3300025909 Bacteria 2911
189 Ga0207705_10064267 3300025909 Unclassified 2652
190 Ga0207707_10066036 3300025912 Unclassified 3150
191 Ga0207695_10024528 3300025913 Bacteria 6780
192 Ga0207671_10064861 3300025914 Unclassified 2715
193 Ga0207693_10241473 3300025915 Bacteria 1418
194 Ga0207693_10354722 3300025915 Bacteria 1147
195 Ga0207660_10367910 3300025917 Unclassified 1154
196 Ga0207660_10534194 3300025917 Unclassified 953
197 Ga0207660_10740317 3300025917 Unclassified 802
198 Ga0207662_10122990 3300025918 Bacteria 1629
199 Ga0207662_10156570 3300025918 Bacteria 1453
200 Ga0207657_10006364 3300025919 Bacteria 12264
201 Ga0207657_10010394 3300025919 Bacteria 9290
202 Ga0207657_10013074 3300025919 Bacteria 8158
203 Ga0207657_10110183 3300025919 Bacteria 2274
204 Ga0207657_10171059 3300025919 Unclassified 1760
205 Ga0207657_10305696 3300025919 Bacteria 1259
206 Ga0207657_10441042 3300025919 Bacteria 1022
207 Ga0207657_10504432 3300025919 Bacteria 948
208 Ga0207649_10004561 3300025920 Bacteria 7518
209 Ga0207649_10016272 3300025920 Bacteria 4190
210 Ga0207649_10135652 3300025920 Unclassified 1677
211 Ga0207649_10136155 3300025920 Bacteria 1675
212 Ga0207649_10996797 3300025920 Unclassified 659
213 Ga0207652_10265124 3300025921 Unclassified 1549
214 Ga0207681_11201495 3300025923 Bacteria 637
215 Ga0207694_10004535 3300025924 Bacteria 10830
216 Ga0207694_10011778 3300025924 Bacteria 6597
217 Ga0207650_10034353 3300025925 Bacteria 3677
218 Ga0207650_10073938 3300025925 Bacteria 2568
219 Ga0207659_10071796 3300025926 Bacteria 2529
220 Ga0207659_10161291 3300025926 Bacteria 1761
221 Ga0207687_10038316 3300025927 Bacteria 3276
222 Ga0207687_10223074 3300025927 Bacteria 1485
223 Ga0207700_10809378 3300025928 Bacteria 838
224 Ga0207664_10076982 3300025929 Bacteria 2702
225 Ga0207664_10228828 3300025929 Unclassified 1615
226 Ga0207664_10759615 3300025929 Unclassified 872
227 Ga0207644_10001116 3300025931 Bacteria 17225
228 Ga0207644_10035377 3300025931 Bacteria 3499
229 Ga0207644_10265193 3300025931 Unclassified 1374
230 Ga0207690_10003155 3300025932 Bacteria 9899
231 Ga0207690_10012506 3300025932 Bacteria 5079
232 Ga0207690_10233570 3300025932 Unclassified 1413
233 Ga0207690_10339492 3300025932 Unclassified 1185
234 Ga0207690_10660916 3300025932 Unclassified 857
235 Ga0207690_10832010 3300025932 Bacteria 764
236 Ga0207706_10035380 3300025933 Bacteria 4441
237 Ga0207706_10092860 3300025933 Bacteria 2654
238 Ga0207706_10262209 3300025933 Bacteria 1508
239 Ga0207706_11054296 3300025933 Bacteria 681
240 Ga0207686_10013322 3300025934 Bacteria 4548
241 Ga0207709_10149700 3300025935 Bacteria 1615
242 Ga0207669_10005310 3300025937 Bacteria 5767
243 Ga0207704_10058514 3300025938 Unclassified 2373
244 Ga0207665_10667520 3300025939 Bacteria 816
245 Ga0207691_10000892 3300025940 Bacteria 29583
246 Ga0207691_10166904 3300025940 Bacteria 1929
247 Ga0207711_10000047 3300025941 Bacteria 150849
248 Ga0207711_10011791 3300025941 Bacteria 7262
249 Ga0207711_10110893 3300025941 Bacteria 2440
250 Ga0207711_10144536 3300025941 Unclassified 2142
251 Ga0207661_10070331 3300025944 Unclassified 2857
252 Ga0207661_10967677 3300025944 Bacteria 784
253 Ga0207679_10126720 3300025945 Bacteria 2041
254 Ga0207679_10138307 3300025945 Bacteria 1965
255 Ga0207679_10508323 3300025945 Bacteria 1076
256 Ga0207679_10546549 3300025945 Bacteria 1039
257 Ga0207679_10756024 3300025945 Unclassified 884
258 Ga0207667_10022295 3300025949 Bacteria 6999
259 Ga0207667_10032969 3300025949 Bacteria 5575
260 Ga0207667_10314352 3300025949 Bacteria 1600
261 Ga0207667_10389153 3300025949 Unclassified 1420
262 Ga0207667_10912565 3300025949 Unclassified 870
263 Ga0207651_10002321 3300025960 Bacteria 9067
264 Ga0207651_10580073 3300025960 Bacteria 978
265 Ga0207651_10704719 3300025960 Bacteria 890
266 Ga0207651_10750670 3300025960 Bacteria 862
267 Ga0207640_10048478 3300025981 Bacteria 2746
268 Ga0207640_10158902 3300025981 Bacteria 1670
269 Ga0207640_10322645 3300025981 Unclassified 1230
270 Ga0207640_10487935 3300025981 Archaea 1023
271 Ga0207658_10046676 3300025986 Bacteria 3165
272 Ga0207658_11849962 3300025986 Bacteria 550
273 Ga0207677_10039687 3300026023 Bacteria 3097
274 Ga0207703_10065019 3300026035 Bacteria 2996
275 Ga0207639_10000136 3300026041 Bacteria 54387
276 Ga0207639_10079410 3300026041 Bacteria 2593
277 Ga0207639_10086373 3300026041 Unclassified 2498
278 Ga0207639_10145434 3300026041 Bacteria 1980
279 Ga0207639_10349614 3300026041 Bacteria 1320
280 Ga0207639_11124834 3300026041 Unclassified 737
281 Ga0207678_10009194 3300026067 Bacteria 8699
282 Ga0207678_11068721 3300026067 Unclassified 715
283 Ga0207702_10048488 3300026078 Bacteria 3582
284 Ga0207702_10055089 3300026078 Bacteria 3372
285 Ga0207702_10190799 3300026078 Bacteria 1893
286 Ga0207702_10525246 3300026078 Unclassified 1156
287 Ga0207702_11114693 3300026078 Unclassified 783
288 Ga0207641_10020798 3300026088 Bacteria 5393
289 Ga0207641_10044886 3300026088 Plasmid 3718
290 Ga0207641_10149060 3300026088 Bacteria 2117
291 Ga0207648_10021766 3300026089 Bacteria 5760
292 Ga0207676_10026365 3300026095 Bacteria 4323
293 Ga0207676_10569333 3300026095 Bacteria 1084
294 Ga0207674_10003719 3300026116 Bacteria 18629
295 Ga0207674_10028962 3300026116 Bacteria 5838
296 Ga0207675_102402127 3300026118 Bacteria 539
297 Ga0207683_10001298 3300026121 Bacteria 22583
298 Ga0207683_10018683 3300026121 Bacteria 5914
299 Ga0207698_10000606 3300026142 Bacteria 20992
300 Ga0207698_10010523 3300026142 Bacteria 5952
301 Ga0207698_10013579 3300026142 Bacteria 5382
302 Ga0207698_10034170 3300026142 Bacteria 3703
303 Ga0207698_10056051 3300026142 Bacteria 3041
304 Ga0207698_10165878 3300026142 Unclassified 1938
305 Ga0207698_10206134 3300026142 Unclassified 1765
306 Ga0207698_10402171 3300026142 Unclassified 1309
307 Ga0268266_10333992 3300028379 Unclassified 1421
308 Ga0307408_100000812 3300031548 Bacteria 24917
309 Ga0307413_10083511 3300031824 Bacteria 2055
310 Ga0307413_10794335 3300031824 Bacteria 795
311 Ga0307406_10000521 3300031901 Bacteria 22113
312 Ga0307407_11407543 3300031903 Bacteria 549
313 Ga0307409_102637420 3300031995 Bacteria 531
314 Ga0307416_100655213 3300032002 Bacteria 1135
315 Ga0307414_10339960 3300032004 Bacteria 1284
316 Ga0307411_10127404 3300032005 Bacteria 1854
317 Ga0373943_0286718 3300035170 Unclassified 932
318 Ga0373943_0370405 3300035170 Unclassified 823
319 Ga0373931_1127200 3300035691 Unclassified 535
320 Ga0395899_0001382 3300037312 Bacteria 20826
321 Ga0395899_0011485 3300037312 Bacteria 6779
322 Ga0395899_0038073 3300037312 Bacteria 3604
323 Ga0395899_0080330 3300037312 Bacteria 2373
324 Ga0395899_0080394 3300037312 Bacteria 2372
325 Ga0395899_0254279 3300037312 Unclassified 1204
326 Ga0395899_0328997 3300037312 Unclassified 1027
327 Ga0395899_0348253 3300037312 Bacteria 991
328 Ga0395899_0369208 3300037312 Bacteria 956
329 Ga0395900_0008469 3300037418 Bacteria 10576
330 Ga0395900_0015739 3300037418 Bacteria 7710
331 Ga0395900_0042628 3300037418 Bacteria 4676
332 Ga0395900_0052102 3300037418 Bacteria 4213
333 Ga0395900_0083592 3300037418 Bacteria 3279
334 Ga0395900_0089904 3300037418 Bacteria 3156
335 Ga0395900_0090938 3300037418 Bacteria 3136
336 Ga0395900_0164459 3300037418 Bacteria 2262
337 Ga0395900_0306814 3300037418 Bacteria 1571
338 Ga0395900_0338924 3300037418 Bacteria 1479
339 Ga0395900_0402208 3300037418 Bacteria 1333
340 Ga0395900_0405133 3300037418 Bacteria 1327
341 Ga0395900_0450414 3300037418 Unclassified 1243
342 Ga0395900_0522538 3300037418 Unclassified 1134
343 Ga0395900_0555087 3300037418 Unclassified 1093
344 Ga0395900_0889885 3300037418 Bacteria 814
345 Ga0395900_1035233 3300037418 Unclassified 740
346 Ga0395900_1734401 3300037418 Bacteria 535
347 Ga0395898_0001185 3300037466 Bacteria 39681
348 Ga0395898_0020458 3300037466 Bacteria 6721
349 Ga0395898_0041169 3300037466 Bacteria 4564
350 Ga0395898_0049203 3300037466 Bacteria 4131
351 Ga0395898_0076497 3300037466 Bacteria 3232
352 Ga0395898_0091973 3300037466 Bacteria 2917
353 Ga0395898_0117210 3300037466 Unclassified 2551
354 Ga0395898_0313921 3300037466 Unclassified 1495
355 Ga0395898_0510347 3300037466 Unclassified 1143
356 Ga0395898_0612336 3300037466 Unclassified 1032
357 Ga0395898_0675666 3300037466 Unclassified 975
358 Ga0395898_1026729 3300037466 Bacteria 760
359 Ga0395898_1224191 3300037466 Bacteria 681
360 Ga0395905_0001488 3300037471 Bacteria 28032
361 Ga0395905_0014681 3300037471 Bacteria 7471
362 Ga0395905_0031856 3300037471 Bacteria 4961
363 Ga0395905_0036038 3300037471 Bacteria 4646
364 Ga0395905_0053348 3300037471 Bacteria 3784
365 Ga0395905_0062751 3300037471 Bacteria 3475
366 Ga0395905_0070554 3300037471 Unclassified 3274
367 Ga0395905_0074226 3300037471 Unclassified 3187
368 Ga0395905_0092223 3300037471 Unclassified 2840
369 Ga0395905_0119008 3300037471 Bacteria 2482
370 Ga0395905_0120488 3300037471 Bacteria 2466
371 Ga0395905_0124623 3300037471 Unclassified 2422
372 Ga0395905_0144948 3300037471 Bacteria 2234
373 Ga0395905_0234268 3300037471 Bacteria 1716
374 Ga0395905_0316646 3300037471 Bacteria 1449
375 Ga0395905_0410991 3300037471 Unclassified 1248
376 Ga0395905_1091060 3300037471 Unclassified 701
377 Ga0436364_0266126 3300037853 Bacteria 565
378 Ga0436364_1385682 3300037853 Bacteria 5888
379 Ga0395901_0001163 3300038443 Bacteria 27959
380 Ga0395901_0023391 3300038443 Bacteria 6333
381 Ga0395901_0058387 3300038443 Bacteria 4013
382 Ga0395901_0070677 3300038443 Bacteria 3637
383 Ga0395901_0107596 3300038443 Bacteria 2927
384 Ga0395901_0190319 3300038443 Bacteria 2152
385 Ga0395901_0200626 3300038443 Unclassified 2091
386 Ga0395901_0295797 3300038443 Bacteria 1679
387 Ga0395901_0305899 3300038443 Bacteria 1647
388 Ga0395901_0317457 3300038443 Unclassified 1612
389 Ga0395901_0318858 3300038443 Unclassified 1608
390 Ga0395901_0334376 3300038443 Unclassified 1565
391 Ga0395901_0342396 3300038443 Bacteria 1544
392 Ga0395901_0463957 3300038443 Unclassified 1294
393 Ga0395901_0571372 3300038443 Unclassified 1143
394 Ga0395901_0701649 3300038443 Unclassified 1009
395 Ga0395901_1201227 3300038443 Unclassified 724
396 Ga0439458_0001158 3300042157 Bacteria 6681
397 Ga0466966_0011598 3300044684 Bacteria 5842
398 Ga0466966_0026869 3300044684 Unclassified 3755
399 Ga0466966_0088080 3300044684 Unclassified 1929
400 Ga0466966_0104805 3300044684 Unclassified 1746
401 Ga0466966_0382562 3300044684 Bacteria 846
402 Ga0466961_0284641 3300044693 Unclassified 1011
403 Ga0466963_0055636 3300044694 Bacteria 2631
404 Ga0466963_0129918 3300044694 Unclassified 1739
405 Ga0466963_0182249 3300044694 Bacteria 1466
406 Ga0466963_0231109 3300044694 Unclassified 1296
407 Ga0466964_0147819 3300044706 Unclassified 1086
408 Ga0466964_0220379 3300044706 Unclassified 921
409 Ga0466968_0368532 3300044735 Unclassified 700
410 Ga0466970_0121301 3300044765 Unclassified 1432
411 Ga0466957_0013241 3300044842 Bacteria 4784
412 Ga0466957_0150614 3300044842 Bacteria 1504
413 Ga0466957_0172924 3300044842 Bacteria 1408
414 Ga0466960_0224099 3300044901 Unclassified 1036
415 Ga0466960_0498148 3300044901 Unclassified 713
416 Ga0466959_0036609 3300045049 Bacteria 3626
417 Ga0466959_0100329 3300045049 Unclassified 2072
418 Ga0466959_0438012 3300045049 Bacteria 886
419 Ga0466958_0799829 3300045836 Unclassified 615
420 Ga0466967_0192920 3300045976 Unclassified 1926
421 Ga0466967_0279060 3300045976 Unclassified 1603
422 Ga0466967_0357915 3300045976 Bacteria 1413
423 Ga0466967_0405732 3300045976 Bacteria 1327
424 Ga0466967_0501192 3300045976 Unclassified 1191
425 Ga0466967_0736976 3300045976 Unclassified 977
426 Ga0496102_0054392 3300048905 Bacteria 3650
427 Ga0496102_0057568 3300048905 Unclassified 3550
428 Ga0496102_0257547 3300048905 Bacteria 1645
429 Ga0496103_0503035 3300048906 Bacteria 775
430 Ga0496104_0134801 3300048907 Bacteria 2372
431 Ga0496105_0191666 3300048908 Bacteria 1671
432 Ga0496106_0306171 3300048909 Bacteria 1275
433 Ga0496107_0004708 3300048910 Bacteria 9267
434 Ga0496108_0263629 3300048911 Bacteria 1499
435 Ga0496109_0057845 3300048912 Bacteria 3540
436 Ga0496109_0084781 3300048912 Bacteria 2924
437 Ga0496109_0172208 3300048912 Bacteria 2031
438 Ga0496110_0014418 3300048913 Bacteria 6562
439 Ga0496110_0048084 3300048913 Bacteria 3738
440 Ga0496110_0091986 3300048913 Bacteria 2714
441 Ga0496111_0017004 3300048914 Bacteria 5020
442 Ga0496111_0069665 3300048914 Unclassified 2558
443 Ga0496112_0006998 3300048915 Bacteria 9958
444 Ga0496112_0565495 3300048915 Bacteria 1070
445 Ga0496113_0056778 3300048916 Bacteria 2940
446 Ga0496113_0170527 3300048916 Bacteria 1723
447 Ga0496113_0198201 3300048916 Bacteria 1595
448 Ga0501047_0355292 3300049581 Unclassified 1302
449 Ga0501070_1137589 3300049586 Unclassified 601
450 Ga0501080_0072631 3300049742 Bacteria 3201
451 Ga0501044_0573241 3300049823 Unclassified 1024
452 Ga0501082_1406985 3300060353 Unclassified 609
453 Ga0466962_0023156 3300061719 Unclassified 2986
454 Ga0466962_0077264 3300061719 Unclassified 1591
455 Ga0466962_0136775 3300061719 Unclassified 1186
456 Ga0466962_0141092 3300061719 Unclassified 1167
457 Ga0466962_0204721 3300061719 Bacteria 965

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_0266126 Ga0436364_0266126_44_376 110
2 3300005354 Ga0070675_100058556 Ga0070675_1000585564 114
3 3300005367 Ga0070667_100018847 Ga0070667_1000188478 114
4 3300005455 Ga0070663_101903838 Ga0070663_1019038381 114
5 3300005456 Ga0070678_100000630 Ga0070678_10000063020 114
6 3300005457 Ga0070662_100060161 Ga0070662_1000601612 114
7 3300005466 Ga0070685_10075489 Ga0070685_100754894 114
8 3300005543 Ga0070672_100065271 Ga0070672_1000652713 114
9 3300005564 Ga0070664_100060948 Ga0070664_1000609484 114
10 3300005616 Ga0068852_100080784 Ga0068852_1000807843 114
11 3300005617 Ga0068859_100186071 Ga0068859_1001860715 114
12 3300005618 Ga0068864_100017956 Ga0068864_1000179565 114
13 3300005718 Ga0068866_10334973 Ga0068866_103349733 114
14 3300005841 Ga0068863_100029236 Ga0068863_1000292368 114
15 3300005842 Ga0068858_100003328 Ga0068858_10000332817 114
16 3300006931 Ga0097620_100186065 Ga0097620_1001860652 114
17 3300025920 Ga0207649_10136155 Ga0207649_101361554 114
18 3300025923 Ga0207681_11201495 Ga0207681_112014951 114
19 3300025926 Ga0207659_10161291 Ga0207659_101612913 114
20 3300025933 Ga0207706_10262209 Ga0207706_102622093 114
21 3300025940 Ga0207691_10000892 Ga0207691_1000089230 114
22 3300025941 Ga0207711_10110893 Ga0207711_101108935 114
23 3300025945 Ga0207679_10126720 Ga0207679_101267203 114
24 3300025986 Ga0207658_10046676 Ga0207658_100466765 114
25 3300026088 Ga0207641_10044886 Ga0207641_100448862 114
26 3300026095 Ga0207676_10026365 Ga0207676_100263655 114
27 3300026121 Ga0207683_10018683 Ga0207683_100186835 114
28 3300026142 Ga0207698_10165878 Ga0207698_101658782 114
29 3300048912 Ga0496109_0084781 Ga0496109_0084781_1170_1586 114
30 3300048913 Ga0496110_0014418 Ga0496110_0014418_2721_3137 114
31 3300037853 Ga0436364_1385682 Ga0436364_1385682_4441_4806 118
32 3300005335 Ga0070666_10002660 Ga0070666_100026605 119
33 3300005340 Ga0070689_100295410 Ga0070689_1002954101 119
34 3300005343 Ga0070687_100142062 Ga0070687_1001420621 119
35 3300005355 Ga0070671_100015139 Ga0070671_1000151394 119
36 3300005364 Ga0070673_100007942 Ga0070673_1000079424 119
37 3300005367 Ga0070667_100003204 Ga0070667_10000320415 119
38 3300005539 Ga0068853_100473343 Ga0068853_1004733431 119
39 3300005616 Ga0068852_100201573 Ga0068852_1002015732 119
40 3300005617 Ga0068859_100329468 Ga0068859_1003294682 119
41 3300006931 Ga0097620_100329504 Ga0097620_1003295042 119
42 3300009177 Ga0105248_10004260 Ga0105248_100042605 119
43 3300013297 Ga0157378_10213300 Ga0157378_102133002 119
44 3300025903 Ga0207680_10002682 Ga0207680_100026823 119
45 3300025918 Ga0207662_10156570 Ga0207662_101565702 119
46 3300025919 Ga0207657_10305696 Ga0207657_103056962 119
47 3300025927 Ga0207687_10223074 Ga0207687_102230742 119
48 3300025931 Ga0207644_10035377 Ga0207644_100353772 119
49 3300025937 Ga0207669_10005310 Ga0207669_100053102 119
50 3300025941 Ga0207711_10000047 Ga0207711_100000472 119
51 3300025960 Ga0207651_10002321 Ga0207651_100023217 119
52 3300037466 Ga0395898_0510347 Ga0395898_0510347_253_615 120
53 3300038443 Ga0395901_0463957 Ga0395901_0463957_301_663 120
54 3300031548 Ga0307408_100000812 Ga0307408_10000081216 122
55 3300031901 Ga0307406_10000521 Ga0307406_1000052112 122
56 3300035170 Ga0373943_0370405 Ga0373943_0370405_12_380 122
57 3300021388 Ga0213875_10226992 Ga0213875_102269922 123
58 3300025918 Ga0207662_10122990 Ga0207662_101229902 123
59 3300031995 Ga0307409_102637420 Ga0307409_1026374201 124
60 3300013100 Ga0157373_10047694 Ga0157373_100476941 125
61 3300013105 Ga0157369_10012242 Ga0157369_100122422 129
62 3300031824 Ga0307413_10083511 Ga0307413_100835112 129
63 3300031903 Ga0307407_11407543 Ga0307407_114075432 129
64 3300032004 Ga0307414_10339960 Ga0307414_103399602 129
65 3300032005 Ga0307411_10127404 Ga0307411_101274044 129
66 3300037312 Ga0395899_0080394 Ga0395899_0080394_1605_1994 129
67 3300037312 Ga0395899_0328997 Ga0395899_0328997_321_710 129
68 3300037418 Ga0395900_0042628 Ga0395900_0042628_3161_3550 129
69 3300037418 Ga0395900_0338924 Ga0395900_0338924_1044_1433 129
70 3300037466 Ga0395898_0049203 Ga0395898_0049203_3079_3468 129
71 3300037466 Ga0395898_0091973 Ga0395898_0091973_2174_2563 129
72 3300037471 Ga0395905_0074226 Ga0395905_0074226_1983_2372 129
73 3300037471 Ga0395905_0092223 Ga0395905_0092223_2367_2756 129
74 3300038443 Ga0395901_0305899 Ga0395901_0305899_814_1203 129
75 3300038443 Ga0395901_0317457 Ga0395901_0317457_314_703 129
76 3300013104 Ga0157370_10385852 Ga0157370_103858522 130
77 3300013105 Ga0157369_10565287 Ga0157369_105652871 130
78 3300037471 Ga0395905_0001488 Ga0395905_0001488_27329_27724 131
79 3300031824 Ga0307413_10794335 Ga0307413_107943352 136
80 3300001979 JGI24740J21852_10122091 JGI24740J21852_101220912 138
81 3300002067 JGI24735J21928_10057698 JGI24735J21928_100576982 138
82 3300005327 Ga0070658_10063050 Ga0070658_100630502 138
83 3300005327 Ga0070658_10204884 Ga0070658_102048842 138
84 3300005327 Ga0070658_10525304 Ga0070658_105253042 138
85 3300005327 Ga0070658_10596199 Ga0070658_105961992 138
86 3300005327 Ga0070658_10686776 Ga0070658_106867762 138
87 3300005329 Ga0070683_100058939 Ga0070683_1000589395 138
88 3300005329 Ga0070683_100152354 Ga0070683_1001523542 138
89 3300005329 Ga0070683_101022237 Ga0070683_1010222372 138
90 3300005330 Ga0070690_100038684 Ga0070690_1000386845 138
91 3300005331 Ga0070670_100063769 Ga0070670_1000637693 138
92 3300005331 Ga0070670_100104424 Ga0070670_1001044242 138
93 3300005331 Ga0070670_100679281 Ga0070670_1006792811 138
94 3300005336 Ga0070680_100002569 Ga0070680_1000025698 138
95 3300005336 Ga0070680_100208267 Ga0070680_1002082672 138
96 3300005336 Ga0070680_100814494 Ga0070680_1008144942 138
97 3300005337 Ga0070682_100683671 Ga0070682_1006836712 138
98 3300005338 Ga0068868_100357345 Ga0068868_1003573452 138
99 3300005338 Ga0068868_100432691 Ga0068868_1004326912 138
100 3300005339 Ga0070660_100006487 Ga0070660_1000064872 138
101 3300005339 Ga0070660_100021096 Ga0070660_1000210962 138
102 3300005339 Ga0070660_100032890 Ga0070660_1000328904 138
103 3300005339 Ga0070660_100112059 Ga0070660_1001120591 138
104 3300005339 Ga0070660_100705075 Ga0070660_1007050752 138
105 3300005343 Ga0070687_100239864 Ga0070687_1002398642 138
106 3300005344 Ga0070661_100025887 Ga0070661_1000258875 138
107 3300005344 Ga0070661_100042886 Ga0070661_1000428863 138
108 3300005344 Ga0070661_101175106 Ga0070661_1011751061 138
109 3300005354 Ga0070675_100479263 Ga0070675_1004792632 138
110 3300005364 Ga0070673_100391242 Ga0070673_1003912422 138
111 3300005364 Ga0070673_101212096 Ga0070673_1012120962 138
112 3300005365 Ga0070688_100473614 Ga0070688_1004736142 138
113 3300005366 Ga0070659_100006363 Ga0070659_1000063634 138
114 3300005366 Ga0070659_100024893 Ga0070659_1000248935 138
115 3300005366 Ga0070659_100130507 Ga0070659_1001305072 138
116 3300005366 Ga0070659_101665839 Ga0070659_1016658391 138
117 3300005367 Ga0070667_100050511 Ga0070667_1000505112 138
118 3300005367 Ga0070667_100149265 Ga0070667_1001492652 138
119 3300005435 Ga0070714_100024323 Ga0070714_1000243233 138
120 3300005436 Ga0070713_101171704 Ga0070713_1011717042 138
121 3300005455 Ga0070663_100344100 Ga0070663_1003441003 138
122 3300005455 Ga0070663_100742269 Ga0070663_1007422692 138
123 3300005455 Ga0070663_100826363 Ga0070663_1008263631 138
124 3300005456 Ga0070678_100028567 Ga0070678_1000285674 138
125 3300005457 Ga0070662_100025792 Ga0070662_1000257925 138
126 3300005457 Ga0070662_100143574 Ga0070662_1001435742 138
127 3300005457 Ga0070662_100826413 Ga0070662_1008264132 138
128 3300005457 Ga0070662_101106454 Ga0070662_1011064541 138
129 3300005458 Ga0070681_10037966 Ga0070681_100379662 138
130 3300005459 Ga0068867_100086920 Ga0068867_1000869201 138
131 3300005466 Ga0070685_10292189 Ga0070685_102921892 138
132 3300005530 Ga0070679_100149842 Ga0070679_1001498422 138
133 3300005530 Ga0070679_100166850 Ga0070679_1001668502 138
134 3300005530 Ga0070679_100621561 Ga0070679_1006215612 138
135 3300005535 Ga0070684_100206154 Ga0070684_1002061543 138
136 3300005539 Ga0068853_100005874 Ga0068853_1000058745 138
137 3300005539 Ga0068853_100016475 Ga0068853_1000164752 138
138 3300005539 Ga0068853_100107483 Ga0068853_1001074833 138
139 3300005539 Ga0068853_100501606 Ga0068853_1005016062 138
140 3300005539 Ga0068853_100761100 Ga0068853_1007611002 138
141 3300005547 Ga0070693_100003864 Ga0070693_1000038642 138
142 3300005548 Ga0070665_100579952 Ga0070665_1005799522 138
143 3300005563 Ga0068855_100015770 Ga0068855_1000157702 138
144 3300005563 Ga0068855_100016170 Ga0068855_1000161703 138
145 3300005563 Ga0068855_100090913 Ga0068855_1000909132 138
146 3300005563 Ga0068855_100494374 Ga0068855_1004943743 138
147 3300005563 Ga0068855_101114137 Ga0068855_1011141372 138
148 3300005564 Ga0070664_100034680 Ga0070664_1000346805 138
149 3300005564 Ga0070664_100161753 Ga0070664_1001617532 138
150 3300005564 Ga0070664_100172933 Ga0070664_1001729332 138
151 3300005577 Ga0068857_100032874 Ga0068857_1000328745 138
152 3300005577 Ga0068857_100129485 Ga0068857_1001294852 138
153 3300005577 Ga0068857_100767218 Ga0068857_1007672182 138
154 3300005578 Ga0068854_100003443 Ga0068854_1000034436 138
155 3300005578 Ga0068854_100030744 Ga0068854_1000307444 138
156 3300005578 Ga0068854_100086236 Ga0068854_1000862363 138
157 3300005578 Ga0068854_100228546 Ga0068854_1002285461 138
158 3300005578 Ga0068854_100453086 Ga0068854_1004530862 138
159 3300005614 Ga0068856_100007468 Ga0068856_1000074686 138
160 3300005614 Ga0068856_100132884 Ga0068856_1001328845 138
161 3300005614 Ga0068856_100155704 Ga0068856_1001557043 138
162 3300005614 Ga0068856_100524276 Ga0068856_1005242763 138
163 3300005614 Ga0068856_101056437 Ga0068856_1010564372 138
164 3300005616 Ga0068852_100000947 Ga0068852_1000009476 138
165 3300005616 Ga0068852_100003304 Ga0068852_1000033046 138
166 3300005616 Ga0068852_100128552 Ga0068852_1001285522 138
167 3300005616 Ga0068852_100168894 Ga0068852_1001688944 138
168 3300005616 Ga0068852_100207240 Ga0068852_1002072402 138
169 3300005616 Ga0068852_100260793 Ga0068852_1002607933 138
170 3300005618 Ga0068864_100001847 Ga0068864_1000018474 138
171 3300005618 Ga0068864_101723071 Ga0068864_1017230711 138
172 3300005718 Ga0068866_10010145 Ga0068866_100101454 138
173 3300005834 Ga0068851_10018509 Ga0068851_100185095 138
174 3300005834 Ga0068851_10019303 Ga0068851_100193032 138
175 3300005841 Ga0068863_100008161 Ga0068863_1000081614 138
176 3300005841 Ga0068863_100490162 Ga0068863_1004901622 138
177 3300005843 Ga0068860_100154651 Ga0068860_1001546514 138
178 3300005844 Ga0068862_102214053 Ga0068862_1022140531 138
179 3300006173 Ga0070716_100137632 Ga0070716_1001376322 138
180 3300006175 Ga0070712_100160038 Ga0070712_1001600381 138
181 3300006237 Ga0097621_100024161 Ga0097621_1000241612 138
182 3300006358 Ga0068871_100051641 Ga0068871_1000516414 138
183 3300006881 Ga0068865_100013506 Ga0068865_1000135064 138
184 3300009093 Ga0105240_10016062 Ga0105240_100160622 138
185 3300009098 Ga0105245_10070154 Ga0105245_100701545 138
186 3300009148 Ga0105243_10175099 Ga0105243_101750992 138
187 3300009174 Ga0105241_10293719 Ga0105241_102937192 138
188 3300009177 Ga0105248_10005172 Ga0105248_100051729 138
189 3300009545 Ga0105237_10007969 Ga0105237_100079696 138
190 3300009551 Ga0105238_10069422 Ga0105238_100694224 138
191 3300009551 Ga0105238_10087482 Ga0105238_100874823 138
192 3300009551 Ga0105238_10096455 Ga0105238_100964555 138
193 3300009551 Ga0105238_11529838 Ga0105238_115298382 138
194 3300010375 Ga0105239_10117833 Ga0105239_101178335 138
195 3300013100 Ga0157373_10001257 Ga0157373_1000125713 138
196 3300013100 Ga0157373_10917110 Ga0157373_109171102 138
197 3300013102 Ga0157371_10022517 Ga0157371_100225172 138
198 3300013102 Ga0157371_10030966 Ga0157371_100309662 138
199 3300013102 Ga0157371_10036237 Ga0157371_100362373 138
200 3300013102 Ga0157371_10513428 Ga0157371_105134282 138
201 3300013104 Ga0157370_10051091 Ga0157370_100510914 138
202 3300013104 Ga0157370_10052496 Ga0157370_100524963 138
203 3300013104 Ga0157370_10120010 Ga0157370_101200102 138
204 3300013104 Ga0157370_10209191 Ga0157370_102091913 138
205 3300013104 Ga0157370_10268615 Ga0157370_102686152 138
206 3300013105 Ga0157369_10004147 Ga0157369_1000414711 138
207 3300013105 Ga0157369_10040375 Ga0157369_100403755 138
208 3300013105 Ga0157369_10089390 Ga0157369_100893903 138
209 3300013105 Ga0157369_10089835 Ga0157369_100898353 138
210 3300013296 Ga0157374_10233723 Ga0157374_102337232 138
211 3300013296 Ga0157374_12031851 Ga0157374_120318512 138
212 3300013297 Ga0157378_10337744 Ga0157378_103377442 138
213 3300013307 Ga0157372_10003603 Ga0157372_100036035 138
214 3300013307 Ga0157372_10192248 Ga0157372_101922483 138
215 3300013307 Ga0157372_10425293 Ga0157372_104252933 138
216 3300013308 Ga0157375_10107233 Ga0157375_101072334 138
217 3300014325 Ga0163163_10062800 Ga0163163_100628005 138
218 3300014325 Ga0163163_10836240 Ga0163163_108362402 138
219 3300014968 Ga0157379_10276919 Ga0157379_102769192 138
220 3300014969 Ga0157376_10102818 Ga0157376_101028182 138
221 3300020081 Ga0206354_10018236 Ga0206354_100182362 138
222 3300020082 Ga0206353_10841971 Ga0206353_108419712 138
223 3300020082 Ga0206353_11031190 Ga0206353_110311902 138
224 3300025321 Ga0207656_10019858 Ga0207656_100198582 138
225 3300025899 Ga0207642_10169251 Ga0207642_101692513 138
226 3300025903 Ga0207680_10301756 Ga0207680_103017562 138
227 3300025903 Ga0207680_10414778 Ga0207680_104147782 138
228 3300025903 Ga0207680_11153253 Ga0207680_111532532 138
229 3300025904 Ga0207647_10002106 Ga0207647_100021068 138
230 3300025904 Ga0207647_10051546 Ga0207647_100515462 138
231 3300025907 Ga0207645_10079953 Ga0207645_100799533 138
232 3300025909 Ga0207705_10002105 Ga0207705_100021057 138
233 3300025909 Ga0207705_10050675 Ga0207705_100506755 138
234 3300025909 Ga0207705_10053383 Ga0207705_100533835 138
235 3300025909 Ga0207705_10064267 Ga0207705_100642672 138
236 3300025912 Ga0207707_10066036 Ga0207707_100660362 138
237 3300025913 Ga0207695_10024528 Ga0207695_100245282 138
238 3300025914 Ga0207671_10064861 Ga0207671_100648612 138
239 3300025915 Ga0207693_10241473 Ga0207693_102414732 138
240 3300025915 Ga0207693_10354722 Ga0207693_103547222 138
241 3300025917 Ga0207660_10367910 Ga0207660_103679102 138
242 3300025917 Ga0207660_10534194 Ga0207660_105341942 138
243 3300025917 Ga0207660_10740317 Ga0207660_107403172 138
244 3300025919 Ga0207657_10006364 Ga0207657_100063646 138
245 3300025919 Ga0207657_10010394 Ga0207657_100103942 138
246 3300025919 Ga0207657_10013074 Ga0207657_100130748 138
247 3300025919 Ga0207657_10110183 Ga0207657_101101834 138
248 3300025919 Ga0207657_10171059 Ga0207657_101710592 138
249 3300025919 Ga0207657_10441042 Ga0207657_104410422 138
250 3300025919 Ga0207657_10504432 Ga0207657_105044322 138
251 3300025920 Ga0207649_10004561 Ga0207649_100045612 138
252 3300025920 Ga0207649_10016272 Ga0207649_100162722 138
253 3300025920 Ga0207649_10135652 Ga0207649_101356522 138
254 3300025920 Ga0207649_10996797 Ga0207649_109967971 138
255 3300025921 Ga0207652_10265124 Ga0207652_102651242 138
256 3300025924 Ga0207694_10004535 Ga0207694_100045356 138
257 3300025924 Ga0207694_10011778 Ga0207694_100117786 138
258 3300025925 Ga0207650_10034353 Ga0207650_100343532 138
259 3300025925 Ga0207650_10073938 Ga0207650_100739382 138
260 3300025926 Ga0207659_10071796 Ga0207659_100717963 138
261 3300025927 Ga0207687_10038316 Ga0207687_100383165 138
262 3300025928 Ga0207700_10809378 Ga0207700_108093782 138
263 3300025929 Ga0207664_10076982 Ga0207664_100769825 138
264 3300025929 Ga0207664_10228828 Ga0207664_102288282 138
265 3300025929 Ga0207664_10759615 Ga0207664_107596152 138
266 3300025931 Ga0207644_10001116 Ga0207644_1000111612 138
267 3300025931 Ga0207644_10265193 Ga0207644_102651932 138
268 3300025932 Ga0207690_10003155 Ga0207690_100031558 138
269 3300025932 Ga0207690_10012506 Ga0207690_100125065 138
270 3300025932 Ga0207690_10233570 Ga0207690_102335702 138
271 3300025932 Ga0207690_10339492 Ga0207690_103394922 138
272 3300025932 Ga0207690_10660916 Ga0207690_106609162 138
273 3300025932 Ga0207690_10832010 Ga0207690_108320101 138
274 3300025933 Ga0207706_10035380 Ga0207706_100353802 138
275 3300025933 Ga0207706_10092860 Ga0207706_100928602 138
276 3300025933 Ga0207706_11054296 Ga0207706_110542962 138
277 3300025934 Ga0207686_10013322 Ga0207686_100133223 138
278 3300025935 Ga0207709_10149700 Ga0207709_101497002 138
279 3300025938 Ga0207704_10058514 Ga0207704_100585144 138
280 3300025939 Ga0207665_10667520 Ga0207665_106675202 138
281 3300025940 Ga0207691_10166904 Ga0207691_101669042 138
282 3300025941 Ga0207711_10011791 Ga0207711_100117916 138
283 3300025941 Ga0207711_10144536 Ga0207711_101445362 138
284 3300025944 Ga0207661_10070331 Ga0207661_100703314 138
285 3300025944 Ga0207661_10967677 Ga0207661_109676772 138
286 3300025945 Ga0207679_10138307 Ga0207679_101383073 138
287 3300025945 Ga0207679_10508323 Ga0207679_105083232 138
288 3300025945 Ga0207679_10546549 Ga0207679_105465492 138
289 3300025945 Ga0207679_10756024 Ga0207679_107560241 138
290 3300025949 Ga0207667_10022295 Ga0207667_100222958 138
291 3300025949 Ga0207667_10032969 Ga0207667_100329697 138
292 3300025949 Ga0207667_10314352 Ga0207667_103143522 138
293 3300025949 Ga0207667_10389153 Ga0207667_103891532 138
294 3300025949 Ga0207667_10912565 Ga0207667_109125651 138
295 3300025960 Ga0207651_10580073 Ga0207651_105800732 138
296 3300025960 Ga0207651_10704719 Ga0207651_107047191 138
297 3300025960 Ga0207651_10750670 Ga0207651_107506702 138
298 3300025981 Ga0207640_10048478 Ga0207640_100484782 138
299 3300025981 Ga0207640_10158902 Ga0207640_101589022 138
300 3300025981 Ga0207640_10322645 Ga0207640_103226452 138
301 3300025981 Ga0207640_10487935 Ga0207640_104879352 138
302 3300025986 Ga0207658_11849962 Ga0207658_118499621 138
303 3300026023 Ga0207677_10039687 Ga0207677_100396872 138
304 3300026035 Ga0207703_10065019 Ga0207703_100650191 138
305 3300026041 Ga0207639_10000136 Ga0207639_1000013646 138
306 3300026041 Ga0207639_10079410 Ga0207639_100794102 138
307 3300026041 Ga0207639_10086373 Ga0207639_100863734 138
308 3300026041 Ga0207639_10145434 Ga0207639_101454342 138
309 3300026041 Ga0207639_10349614 Ga0207639_103496142 138
310 3300026041 Ga0207639_11124834 Ga0207639_111248342 138
311 3300026067 Ga0207678_10009194 Ga0207678_100091948 138
312 3300026067 Ga0207678_11068721 Ga0207678_110687212 138
313 3300026078 Ga0207702_10048488 Ga0207702_100484883 138
314 3300026078 Ga0207702_10055089 Ga0207702_100550895 138
315 3300026078 Ga0207702_10190799 Ga0207702_101907992 138
316 3300026078 Ga0207702_10525246 Ga0207702_105252462 138
317 3300026078 Ga0207702_11114693 Ga0207702_111146932 138
318 3300026088 Ga0207641_10020798 Ga0207641_100207983 138
319 3300026088 Ga0207641_10149060 Ga0207641_101490602 138
320 3300026089 Ga0207648_10021766 Ga0207648_100217664 138
321 3300026095 Ga0207676_10569333 Ga0207676_105693332 138
322 3300026116 Ga0207674_10003719 Ga0207674_1000371910 138
323 3300026116 Ga0207674_10028962 Ga0207674_100289625 138
324 3300026118 Ga0207675_102402127 Ga0207675_1024021271 138
325 3300026121 Ga0207683_10001298 Ga0207683_100012984 138
326 3300026142 Ga0207698_10000606 Ga0207698_1000060611 138
327 3300026142 Ga0207698_10010523 Ga0207698_100105234 138
328 3300026142 Ga0207698_10013579 Ga0207698_100135795 138
329 3300026142 Ga0207698_10034170 Ga0207698_100341704 138
330 3300026142 Ga0207698_10056051 Ga0207698_100560513 138
331 3300026142 Ga0207698_10206134 Ga0207698_102061342 138
332 3300026142 Ga0207698_10402171 Ga0207698_104021712 138
333 3300028379 Ga0268266_10333992 Ga0268266_103339922 138
334 3300032002 Ga0307416_100655213 Ga0307416_1006552132 138
335 3300035170 Ga0373943_0286718 Ga0373943_0286718_358_774 138
336 3300035691 Ga0373931_1127200 Ga0373931_1127200_86_505 138
337 3300037312 Ga0395899_0001382 Ga0395899_0001382_21_440 138
338 3300037312 Ga0395899_0011485 Ga0395899_0011485_2928_3344 138
339 3300037312 Ga0395899_0038073 Ga0395899_0038073_1436_1855 138
340 3300037312 Ga0395899_0080330 Ga0395899_0080330_543_959 138
341 3300037312 Ga0395899_0254279 Ga0395899_0254279_520_936 138
342 3300037312 Ga0395899_0348253 Ga0395899_0348253_393_812 138
343 3300037312 Ga0395899_0369208 Ga0395899_0369208_411_830 138
344 3300037418 Ga0395900_0008469 Ga0395900_0008469_2759_3178 138
345 3300037418 Ga0395900_0015739 Ga0395900_0015739_1970_2389 138
346 3300037418 Ga0395900_0052102 Ga0395900_0052102_955_1374 138
347 3300037418 Ga0395900_0083592 Ga0395900_0083592_2377_2793 138
348 3300037418 Ga0395900_0089904 Ga0395900_0089904_1335_1754 138
349 3300037418 Ga0395900_0090938 Ga0395900_0090938_298_714 138
350 3300037418 Ga0395900_0164459 Ga0395900_0164459_776_1195 138
351 3300037418 Ga0395900_0306814 Ga0395900_0306814_571_987 138
352 3300037418 Ga0395900_0402208 Ga0395900_0402208_493_912 138
353 3300037418 Ga0395900_0405133 Ga0395900_0405133_883_1299 138
354 3300037418 Ga0395900_0450414 Ga0395900_0450414_487_903 138
355 3300037418 Ga0395900_0522538 Ga0395900_0522538_695_1114 138
356 3300037418 Ga0395900_0555087 Ga0395900_0555087_348_767 138
357 3300037418 Ga0395900_0889885 Ga0395900_0889885_100_519 138
358 3300037418 Ga0395900_1035233 Ga0395900_1035233_218_637 138
359 3300037418 Ga0395900_1734401 Ga0395900_1734401_51_467 138
360 3300037466 Ga0395898_0001185 Ga0395898_0001185_19304_19723 138
361 3300037466 Ga0395898_0020458 Ga0395898_0020458_1842_2261 138
362 3300037466 Ga0395898_0041169 Ga0395898_0041169_570_986 138
363 3300037466 Ga0395898_0076497 Ga0395898_0076497_1515_1931 138
364 3300037466 Ga0395898_0117210 Ga0395898_0117210_1975_2391 138
365 3300037466 Ga0395898_0313921 Ga0395898_0313921_595_1011 138
366 3300037466 Ga0395898_0612336 Ga0395898_0612336_47_466 138
367 3300037466 Ga0395898_0675666 Ga0395898_0675666_291_710 138
368 3300037466 Ga0395898_1026729 Ga0395898_1026729_328_744 138
369 3300037466 Ga0395898_1224191 Ga0395898_1224191_35_451 138
370 3300037471 Ga0395905_0014681 Ga0395905_0014681_6655_7074 138
371 3300037471 Ga0395905_0031856 Ga0395905_0031856_2608_3024 138
372 3300037471 Ga0395905_0036038 Ga0395905_0036038_1791_2210 138
373 3300037471 Ga0395905_0053348 Ga0395905_0053348_2063_2482 138
374 3300037471 Ga0395905_0062751 Ga0395905_0062751_695_1114 138
375 3300037471 Ga0395905_0070554 Ga0395905_0070554_846_1265 138
376 3300037471 Ga0395905_0119008 Ga0395905_0119008_1805_2221 138
377 3300037471 Ga0395905_0120488 Ga0395905_0120488_454_870 138
378 3300037471 Ga0395905_0124623 Ga0395905_0124623_1520_1936 138
379 3300037471 Ga0395905_0144948 Ga0395905_0144948_553_972 138
380 3300037471 Ga0395905_0234268 Ga0395905_0234268_775_1194 138
381 3300037471 Ga0395905_0316646 Ga0395905_0316646_934_1350 138
382 3300037471 Ga0395905_0410991 Ga0395905_0410991_571_987 138
383 3300037471 Ga0395905_1091060 Ga0395905_1091060_64_480 138
384 3300038443 Ga0395901_0001163 Ga0395901_0001163_6639_7058 138
385 3300038443 Ga0395901_0023391 Ga0395901_0023391_2840_3259 138
386 3300038443 Ga0395901_0058387 Ga0395901_0058387_2591_3010 138
387 3300038443 Ga0395901_0070677 Ga0395901_0070677_2404_2820 138
388 3300038443 Ga0395901_0107596 Ga0395901_0107596_2344_2763 138
389 3300038443 Ga0395901_0190319 Ga0395901_0190319_1536_1955 138
390 3300038443 Ga0395901_0200626 Ga0395901_0200626_302_721 138
391 3300038443 Ga0395901_0295797 Ga0395901_0295797_405_824 138
392 3300038443 Ga0395901_0318858 Ga0395901_0318858_571_987 138
393 3300038443 Ga0395901_0334376 Ga0395901_0334376_622_1038 138
394 3300038443 Ga0395901_0342396 Ga0395901_0342396_571_987 138
395 3300038443 Ga0395901_0571372 Ga0395901_0571372_209_625 138
396 3300038443 Ga0395901_0701649 Ga0395901_0701649_41_460 138
397 3300038443 Ga0395901_1201227 Ga0395901_1201227_260_676 138
398 3300042157 Ga0439458_0001158 Ga0439458_0001158_1169_1588 138
399 3300044684 Ga0466966_0011598 Ga0466966_0011598_3735_4151 138
400 3300044684 Ga0466966_0026869 Ga0466966_0026869_3294_3713 138
401 3300044684 Ga0466966_0088080 Ga0466966_0088080_1192_1611 138
402 3300044684 Ga0466966_0104805 Ga0466966_0104805_1041_1460 138
403 3300044684 Ga0466966_0382562 Ga0466966_0382562_17_436 138
404 3300044693 Ga0466961_0284641 Ga0466961_0284641_103_522 138
405 3300044694 Ga0466963_0055636 Ga0466963_0055636_1545_1964 138
406 3300044694 Ga0466963_0129918 Ga0466963_0129918_56_475 138
407 3300044694 Ga0466963_0182249 Ga0466963_0182249_181_600 138
408 3300044694 Ga0466963_0231109 Ga0466963_0231109_315_734 138
409 3300044706 Ga0466964_0147819 Ga0466964_0147819_651_1067 138
410 3300044706 Ga0466964_0220379 Ga0466964_0220379_308_727 138
411 3300044735 Ga0466968_0368532 Ga0466968_0368532_76_501 138
412 3300044765 Ga0466970_0121301 Ga0466970_0121301_78_497 138
413 3300044842 Ga0466957_0013241 Ga0466957_0013241_2336_2755 138
414 3300044842 Ga0466957_0150614 Ga0466957_0150614_379_798 138
415 3300044842 Ga0466957_0172924 Ga0466957_0172924_641_1060 138
416 3300044901 Ga0466960_0224099 Ga0466960_0224099_348_764 138
417 3300044901 Ga0466960_0498148 Ga0466960_0498148_259_678 138
418 3300045049 Ga0466959_0036609 Ga0466959_0036609_429_845 138
419 3300045049 Ga0466959_0100329 Ga0466959_0100329_612_1031 138
420 3300045049 Ga0466959_0438012 Ga0466959_0438012_140_559 138
421 3300045836 Ga0466958_0799829 Ga0466958_0799829_53_472 138
422 3300045976 Ga0466967_0192920 Ga0466967_0192920_584_1003 138
423 3300045976 Ga0466967_0279060 Ga0466967_0279060_987_1406 138
424 3300045976 Ga0466967_0357915 Ga0466967_0357915_777_1196 138
425 3300045976 Ga0466967_0405732 Ga0466967_0405732_73_492 138
426 3300045976 Ga0466967_0501192 Ga0466967_0501192_277_693 138
427 3300045976 Ga0466967_0736976 Ga0466967_0736976_439_858 138
428 3300048905 Ga0496102_0054392 Ga0496102_0054392_557_973 138
429 3300048905 Ga0496102_0057568 Ga0496102_0057568_401_817 138
430 3300048905 Ga0496102_0257547 Ga0496102_0257547_761_1180 138
431 3300048906 Ga0496103_0503035 Ga0496103_0503035_318_734 138
432 3300048907 Ga0496104_0134801 Ga0496104_0134801_713_1129 138
433 3300048908 Ga0496105_0191666 Ga0496105_0191666_153_569 138
434 3300048909 Ga0496106_0306171 Ga0496106_0306171_209_625 138
435 3300048910 Ga0496107_0004708 Ga0496107_0004708_8262_8678 138
436 3300048911 Ga0496108_0263629 Ga0496108_0263629_1002_1421 138
437 3300048912 Ga0496109_0057845 Ga0496109_0057845_244_660 138
438 3300048912 Ga0496109_0172208 Ga0496109_0172208_774_1193 138
439 3300048913 Ga0496110_0048084 Ga0496110_0048084_2145_2561 138
440 3300048913 Ga0496110_0091986 Ga0496110_0091986_1002_1421 138
441 3300048914 Ga0496111_0017004 Ga0496111_0017004_2586_3002 138
442 3300048914 Ga0496111_0069665 Ga0496111_0069665_810_1226 138
443 3300048915 Ga0496112_0006998 Ga0496112_0006998_1002_1421 138
444 3300048915 Ga0496112_0565495 Ga0496112_0565495_288_704 138
445 3300048916 Ga0496113_0056778 Ga0496113_0056778_1070_1489 138
446 3300048916 Ga0496113_0170527 Ga0496113_0170527_1122_1538 138
447 3300048916 Ga0496113_0198201 Ga0496113_0198201_245_661 138
448 3300049581 Ga0501047_0355292 Ga0501047_0355292_386_805 138
449 3300049586 Ga0501070_1137589 Ga0501070_1137589_149_568 138
450 3300049742 Ga0501080_0072631 Ga0501080_0072631_314_733 138
451 3300049823 Ga0501044_0573241 Ga0501044_0573241_414_833 138
452 3300060353 Ga0501082_1406985 Ga0501082_1406985_40_459 138
453 3300061719 Ga0466962_0023156 Ga0466962_0023156_2306_2725 138
454 3300061719 Ga0466962_0077264 Ga0466962_0077264_708_1127 138
455 3300061719 Ga0466962_0136775 Ga0466962_0136775_566_982 138
456 3300061719 Ga0466962_0141092 Ga0466962_0141092_171_590 138
457 3300061719 Ga0466962_0204721 Ga0466962_0204721_173_592 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

51

140

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yev-assembly2.cif.gz_B structure of caa3-type cytochrome oxidase 0.8257 48 135
3zoo-assembly4.cif.gz_D structure of the y46f mutant of human cytochrome c 0.7887 46 137
3zcf-assembly4.cif.gz_D structure of recombinant human cytochrome c 0.7886 46 137
3zoo-assembly2.cif.gz_B structure of the y46f mutant of human cytochrome c 0.7878 46 137
5exq-assembly2.cif.gz_B human cytochrome c y48h 0.7878 46 137
ID Description Score Start End Superfamily
2oz1D00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7776 46 136 1.10.760.10
1ql3A00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7694 46 136 1.10.760.10
1hroB00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.758 46 133 1.10.760.10
1yicA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7546 46 138 1.10.760.10
2c1dD00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7528 46 138 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A328LEB2-F1-model_v4 deleted 0.9699 46 136
AF-A0A2E3U4X0-F1-model_v4 Cytochrome C 0.9691 46 136 GO:0009055
GO:0020037
GO:0046872
AF-A0A5N7Y3T1-F1-model_v4 C-type cytochrome 0.9687 46 136 GO:0009055
GO:0020037
GO:0046872
AF-A0A3A8QAD7-F1-model_v4 Cytochrome c 0.9678 43 136 GO:0009055
GO:0020037
GO:0046872
AF-A0A431PV64-F1-model_v4 C-type cytochrome 0.9675 44 136 GO:0005886
GO:0009055
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
87.88 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map