F447989
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 457 | 210 | 914 | 372 |
Family's Representative Sequence
| Representative Sequence | 3300013307|Ga0157372_10012045|Ga0157372_100120456 |
| Length | 388 |
| Sequence | MSGATNRAAQDAPIATDTSWKSFDAGALANNATAALRAYDPGHDLPALRKRFGAEIAELGSNENPLGPSPRAVEAMRGALAETFRYPDPRGLSLKTALSARLGVGTDRIALGNGSHELLMLLAQCFADSTHSVVFSQYGFAVFPIATAAAGAIALRVPALPRSHPSAPYGHDLDAIAAAVRADTRIVYLANPNNPTGTWFDDAALDDFVARVPRDVLIVVDEAYSEYVDASGLTSALRLAGRYPNLVVTRTFSKAYGLAGLRIGYFIAHPSVVEVIERLRESFNVNNVALAAAEAALSDAEHLAEVRAFNGAERAWLVDALKSRGYAPLPSQTNFVLVDVGGDAAQFEKRLFERGVIVRPMQGYGFRDAVRISVGNRTENQRLADALP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 5 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 36 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 50 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 52 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 53 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 54 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 56 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 57 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 58 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 59 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 60 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 62 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 94 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 95 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 96 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 97 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 98 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 99 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 100 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 101 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 102 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 103 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 104 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 105 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 106 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 107 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 108 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 109 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 110 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 111 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 112 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 113 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 114 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 115 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 116 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 148 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 149 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 150 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 151 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 152 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 153 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 154 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 155 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 156 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 157 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 158 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 159 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 189 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 190 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 191 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 192 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 193 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 194 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 195 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 196 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 198 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 199 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 200 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 201 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 202 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 203 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 204 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 205 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 206 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 207 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 208 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 209 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 210 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.53 |
| Metatranscriptomes | 2.41 |
| Isolates | 3.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.06 |
| Nodule | 0 |
| Rhizoplane | 1.75 |
| Rhizosphere | 85.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157372_10012045 | 3300013307 | Bacteria | 9210 |
| 2 | JGI24741J21665_1000508 | 3300001915 | Bacteria | 11879 |
| 3 | JGI24741J21665_1002123 | 3300001915 | Bacteria | 5285 |
| 4 | JGI24740J21852_10000081 | 3300001979 | Bacteria | 32518 |
| 5 | JGI24740J21852_10002090 | 3300001979 | Bacteria | 9129 |
| 6 | Ga0006562J51391_1050537 | 3300003578 | Bacteria | 2655 |
| 7 | Ga0065165_1000028 | 3300005262 | Bacteria | 224430 |
| 8 | Ga0070658_10010731 | 3300005327 | Bacteria | 7342 |
| 9 | Ga0070658_10114265 | 3300005327 | Bacteria | 2238 |
| 10 | Ga0070683_100026310 | 3300005329 | Bacteria | 5237 |
| 11 | Ga0070666_10000003 | 3300005335 | Bacteria | 463666 |
| 12 | Ga0070666_10069848 | 3300005335 | Bacteria | 2389 |
| 13 | Ga0070680_100000209 | 3300005336 | Bacteria | 38470 |
| 14 | Ga0070680_100002696 | 3300005336 | Bacteria | 13168 |
| 15 | Ga0070680_100015175 | 3300005336 | Bacteria | 6033 |
| 16 | Ga0070680_100037724 | 3300005336 | Bacteria | 3905 |
| 17 | Ga0070660_100081084 | 3300005339 | Bacteria | 2547 |
| 18 | Ga0070691_10006882 | 3300005341 | Bacteria | 5201 |
| 19 | Ga0070691_10012736 | 3300005341 | Bacteria | 3853 |
| 20 | Ga0070691_10060046 | 3300005341 | Bacteria | 1827 |
| 21 | Ga0070661_100009557 | 3300005344 | Bacteria | 6718 |
| 22 | Ga0070661_100009838 | 3300005344 | Bacteria | 6633 |
| 23 | Ga0070661_100069158 | 3300005344 | Bacteria | 2596 |
| 24 | Ga0070661_100104867 | 3300005344 | Bacteria | 2106 |
| 25 | Ga0070661_100112416 | 3300005344 | Bacteria | 2035 |
| 26 | Ga0070692_10003232 | 3300005345 | Bacteria | 6561 |
| 27 | Ga0070692_10006577 | 3300005345 | Bacteria | 5056 |
| 28 | Ga0070692_10009325 | 3300005345 | Bacteria | 4423 |
| 29 | Ga0070673_100379615 | 3300005364 | Bacteria | 1260 |
| 30 | Ga0070667_100000173 | 3300005367 | Bacteria | 79829 |
| 31 | Ga0070667_100008807 | 3300005367 | Bacteria | 8361 |
| 32 | Ga0070667_100190929 | 3300005367 | Bacteria | 1815 |
| 33 | Ga0070667_100282996 | 3300005367 | Bacteria | 1489 |
| 34 | Ga0070663_100000433 | 3300005455 | Bacteria | 22073 |
| 35 | Ga0070663_100015908 | 3300005455 | Bacteria | 4870 |
| 36 | Ga0070663_100023286 | 3300005455 | Bacteria | 4149 |
| 37 | Ga0070663_100187448 | 3300005455 | Bacteria | 1608 |
| 38 | Ga0070662_100103912 | 3300005457 | Bacteria | 2155 |
| 39 | Ga0070681_10000007 | 3300005458 | Bacteria | 159821 |
| 40 | Ga0070681_10000397 | 3300005458 | Bacteria | 35263 |
| 41 | Ga0070681_10001146 | 3300005458 | Bacteria | 22848 |
| 42 | Ga0070681_10003054 | 3300005458 | Bacteria | 15517 |
| 43 | Ga0070681_10007619 | 3300005458 | Bacteria | 10581 |
| 44 | Ga0070679_100000412 | 3300005530 | Bacteria | 36448 |
| 45 | Ga0070679_100004752 | 3300005530 | Bacteria | 12528 |
| 46 | Ga0070679_100019076 | 3300005530 | Bacteria | 6663 |
| 47 | Ga0070679_100094387 | 3300005530 | Bacteria | 2978 |
| 48 | Ga0070684_100059656 | 3300005535 | Bacteria | 3336 |
| 49 | Ga0068853_100000439 | 3300005539 | Bacteria | 28384 |
| 50 | Ga0068853_100017370 | 3300005539 | Bacteria | 5941 |
| 51 | Ga0068853_100039571 | 3300005539 | Bacteria | 4022 |
| 52 | Ga0068853_100220291 | 3300005539 | Bacteria | 1733 |
| 53 | Ga0068853_100228231 | 3300005539 | Bacteria | 1702 |
| 54 | Ga0070696_100020716 | 3300005546 | Bacteria | 4455 |
| 55 | Ga0070696_100172692 | 3300005546 | Bacteria | 1599 |
| 56 | Ga0070693_100041423 | 3300005547 | Bacteria | 2591 |
| 57 | Ga0070665_100000095 | 3300005548 | Bacteria | 170459 |
| 58 | Ga0070665_100016693 | 3300005548 | Bacteria | 7357 |
| 59 | Ga0070665_100089669 | 3300005548 | Bacteria | 3081 |
| 60 | Ga0070665_100135651 | 3300005548 | Bacteria | 2463 |
| 61 | Ga0068855_100001280 | 3300005563 | Bacteria | 31168 |
| 62 | Ga0068855_100037409 | 3300005563 | Bacteria | 5771 |
| 63 | Ga0068855_100119819 | 3300005563 | Bacteria | 3013 |
| 64 | Ga0070664_100110949 | 3300005564 | Bacteria | 2394 |
| 65 | Ga0070664_100110963 | 3300005564 | Bacteria | 2394 |
| 66 | Ga0068857_100059269 | 3300005577 | Bacteria | 3400 |
| 67 | Ga0068857_100238473 | 3300005577 | Bacteria | 1664 |
| 68 | Ga0068854_100007759 | 3300005578 | Bacteria | 6862 |
| 69 | Ga0068854_100060638 | 3300005578 | Bacteria | 2738 |
| 70 | Ga0068856_100086758 | 3300005614 | Bacteria | 3110 |
| 71 | Ga0068856_100293622 | 3300005614 | Bacteria | 1642 |
| 72 | Ga0068852_100015996 | 3300005616 | Bacteria | 5840 |
| 73 | Ga0068852_100076624 | 3300005616 | Bacteria | 2953 |
| 74 | Ga0068852_100369324 | 3300005616 | Bacteria | 1405 |
| 75 | Ga0068859_100000208 | 3300005617 | Bacteria | 58155 |
| 76 | Ga0068863_100031233 | 3300005841 | Bacteria | 5084 |
| 77 | Ga0068858_100143020 | 3300005842 | Bacteria | 2246 |
| 78 | Ga0068858_100288130 | 3300005842 | Bacteria | 1565 |
| 79 | Ga0068860_100093592 | 3300005843 | Bacteria | 2864 |
| 80 | Ga0068862_100000707 | 3300005844 | Bacteria | 34098 |
| 81 | Ga0097621_100017131 | 3300006237 | Bacteria | 5497 |
| 82 | Ga0097620_100000208 | 3300006931 | Bacteria | 58155 |
| 83 | Ga0105240_10178986 | 3300009093 | Bacteria | 2504 |
| 84 | Ga0105240_10247216 | 3300009093 | Bacteria | 2065 |
| 85 | Ga0105248_10004348 | 3300009177 | Bacteria | 15668 |
| 86 | Ga0105237_10000345 | 3300009545 | Bacteria | 65477 |
| 87 | Ga0105237_10220671 | 3300009545 | Bacteria | 1896 |
| 88 | Ga0105238_10000186 | 3300009551 | Bacteria | 68293 |
| 89 | Ga0105238_10007356 | 3300009551 | Bacteria | 11025 |
| 90 | Ga0105249_10000175 | 3300009553 | Bacteria | 74934 |
| 91 | Ga0105249_10005249 | 3300009553 | Bacteria | 11183 |
| 92 | Ga0105239_10028102 | 3300010375 | Bacteria | 6189 |
| 93 | Ga0105239_10081197 | 3300010375 | Bacteria | 3569 |
| 94 | Ga0157373_10012677 | 3300013100 | Bacteria | 6197 |
| 95 | Ga0157373_10015464 | 3300013100 | Bacteria | 5579 |
| 96 | Ga0157373_10038026 | 3300013100 | Bacteria | 3449 |
| 97 | Ga0157373_10049712 | 3300013100 | Bacteria | 2987 |
| 98 | Ga0157371_10023393 | 3300013102 | Bacteria | 4518 |
| 99 | Ga0157371_10042158 | 3300013102 | Bacteria | 3254 |
| 100 | Ga0157370_10000124 | 3300013104 | Bacteria | 91398 |
| 101 | Ga0157370_10007635 | 3300013104 | Bacteria | 11740 |
| 102 | Ga0157370_10016867 | 3300013104 | Bacteria | 7382 |
| 103 | Ga0157370_10027982 | 3300013104 | Bacteria | 5551 |
| 104 | Ga0157369_10000406 | 3300013105 | Bacteria | 57192 |
| 105 | Ga0163162_10000209 | 3300013306 | Bacteria | 54322 |
| 106 | Ga0157372_10005109 | 3300013307 | Bacteria | 13947 |
| 107 | Ga0157372_10038188 | 3300013307 | Bacteria | 5299 |
| 108 | Ga0157372_10069936 | 3300013307 | Bacteria | 3948 |
| 109 | Ga0157372_10197662 | 3300013307 | Bacteria | 2329 |
| 110 | Ga0182008_10002192 | 3300014497 | Bacteria | 12398 |
| 111 | Ga0157376_10105876 | 3300014969 | Bacteria | 2467 |
| 112 | Ga0182006_1000367 | 3300015261 | Bacteria | 37426 |
| 113 | Ga0182006_1000510 | 3300015261 | Bacteria | 29601 |
| 114 | Ga0182007_10007807 | 3300015262 | Bacteria | 4449 |
| 115 | Ga0182005_1000129 | 3300015265 | Bacteria | 53573 |
| 116 | Ga0182005_1002462 | 3300015265 | Bacteria | 6597 |
| 117 | Ga0163161_10003032 | 3300017792 | Bacteria | 11858 |
| 118 | Ga0197907_10743544 | 3300020069 | Bacteria | 1505 |
| 119 | Ga0206356_10588647 | 3300020070 | Bacteria | 3784 |
| 120 | Ga0206356_10754312 | 3300020070 | Bacteria | 6713 |
| 121 | Ga0206354_10319638 | 3300020081 | Bacteria | 8969 |
| 122 | Ga0206354_10842667 | 3300020081 | Bacteria | 1598 |
| 123 | Ga0206354_10850882 | 3300020081 | Bacteria | 2769 |
| 124 | Ga0206353_10413362 | 3300020082 | Bacteria | 4023 |
| 125 | Ga0206353_11387623 | 3300020082 | Bacteria | 7305 |
| 126 | Ga0206353_11654005 | 3300020082 | Bacteria | 3342 |
| 127 | Ga0154015_1063321 | 3300020610 | Bacteria | 5540 |
| 128 | Ga0209674_100300 | 3300025226 | Bacteria | 34463 |
| 129 | Ga0209129_1000194 | 3300025258 | Bacteria | 80824 |
| 130 | Ga0207656_10057094 | 3300025321 | Bacteria | 1703 |
| 131 | Ga0207680_10000006 | 3300025903 | Bacteria | 635950 |
| 132 | Ga0207647_10000006 | 3300025904 | Bacteria | 214791 |
| 133 | Ga0207647_10000229 | 3300025904 | Bacteria | 46400 |
| 134 | Ga0207647_10015631 | 3300025904 | Bacteria | 5196 |
| 135 | Ga0207705_10000128 | 3300025909 | Bacteria | 83519 |
| 136 | Ga0207705_10001240 | 3300025909 | Bacteria | 20526 |
| 137 | Ga0207705_10001241 | 3300025909 | Bacteria | 20523 |
| 138 | Ga0207705_10001617 | 3300025909 | Bacteria | 17880 |
| 139 | Ga0207705_10002071 | 3300025909 | Bacteria | 15590 |
| 140 | Ga0207705_10010095 | 3300025909 | Bacteria | 6874 |
| 141 | Ga0207705_10057153 | 3300025909 | Bacteria | 2814 |
| 142 | Ga0207707_10000383 | 3300025912 | Bacteria | 46195 |
| 143 | Ga0207707_10000665 | 3300025912 | Bacteria | 34141 |
| 144 | Ga0207707_10001116 | 3300025912 | Bacteria | 25500 |
| 145 | Ga0207707_10001756 | 3300025912 | Bacteria | 19911 |
| 146 | Ga0207707_10003727 | 3300025912 | Bacteria | 13495 |
| 147 | Ga0207707_10003792 | 3300025912 | Bacteria | 13399 |
| 148 | Ga0207707_10007845 | 3300025912 | Bacteria | 9281 |
| 149 | Ga0207695_10001748 | 3300025913 | Bacteria | 34501 |
| 150 | Ga0207695_10007277 | 3300025913 | Bacteria | 14136 |
| 151 | Ga0207695_10022640 | 3300025913 | Bacteria | 7124 |
| 152 | Ga0207671_10001184 | 3300025914 | Bacteria | 31016 |
| 153 | Ga0207660_10001148 | 3300025917 | Bacteria | 17671 |
| 154 | Ga0207660_10001455 | 3300025917 | Bacteria | 15902 |
| 155 | Ga0207660_10004398 | 3300025917 | Bacteria | 9186 |
| 156 | Ga0207660_10007940 | 3300025917 | Bacteria | 6864 |
| 157 | Ga0207660_10012405 | 3300025917 | Bacteria | 5575 |
| 158 | Ga0207657_10005512 | 3300025919 | Bacteria | 13212 |
| 159 | Ga0207657_10005547 | 3300025919 | Bacteria | 13175 |
| 160 | Ga0207657_10028735 | 3300025919 | Bacteria | 5068 |
| 161 | Ga0207657_10030086 | 3300025919 | Bacteria | 4933 |
| 162 | Ga0207657_10095570 | 3300025919 | Bacteria | 2472 |
| 163 | Ga0207649_10000493 | 3300025920 | Bacteria | 28027 |
| 164 | Ga0207649_10010189 | 3300025920 | Bacteria | 5161 |
| 165 | Ga0207649_10036055 | 3300025920 | Bacteria | 2976 |
| 166 | Ga0207649_10036821 | 3300025920 | Bacteria | 2950 |
| 167 | Ga0207649_10045629 | 3300025920 | Bacteria | 2688 |
| 168 | Ga0207652_10000030 | 3300025921 | Bacteria | 144884 |
| 169 | Ga0207652_10000820 | 3300025921 | Bacteria | 29635 |
| 170 | Ga0207652_10000846 | 3300025921 | Bacteria | 29174 |
| 171 | Ga0207652_10001343 | 3300025921 | Bacteria | 21834 |
| 172 | Ga0207652_10001614 | 3300025921 | Bacteria | 19816 |
| 173 | Ga0207652_10001631 | 3300025921 | Bacteria | 19706 |
| 174 | Ga0207652_10002369 | 3300025921 | Bacteria | 15935 |
| 175 | Ga0207652_10067165 | 3300025921 | Bacteria | 3108 |
| 176 | Ga0207694_10000559 | 3300025924 | Bacteria | 33677 |
| 177 | Ga0207694_10004810 | 3300025924 | Bacteria | 10485 |
| 178 | Ga0207690_10000327 | 3300025932 | Bacteria | 31748 |
| 179 | Ga0207690_10000878 | 3300025932 | Bacteria | 19199 |
| 180 | Ga0207691_10127731 | 3300025940 | Bacteria | 2248 |
| 181 | Ga0207711_10003763 | 3300025941 | Bacteria | 13059 |
| 182 | Ga0207661_10005841 | 3300025944 | Bacteria | 8683 |
| 183 | Ga0207661_10008408 | 3300025944 | Bacteria | 7375 |
| 184 | Ga0207661_10128814 | 3300025944 | Bacteria | 2164 |
| 185 | Ga0207679_10067180 | 3300025945 | Bacteria | 2689 |
| 186 | Ga0207667_10000634 | 3300025949 | Bacteria | 45497 |
| 187 | Ga0207667_10000818 | 3300025949 | Bacteria | 40208 |
| 188 | Ga0207667_10005607 | 3300025949 | Bacteria | 15316 |
| 189 | Ga0207667_10010062 | 3300025949 | Bacteria | 11086 |
| 190 | Ga0207667_10013287 | 3300025949 | Bacteria | 9431 |
| 191 | Ga0207667_10017782 | 3300025949 | Bacteria | 7995 |
| 192 | Ga0207667_10034921 | 3300025949 | Bacteria | 5397 |
| 193 | Ga0207667_10074537 | 3300025949 | Bacteria | 3525 |
| 194 | Ga0207712_10000600 | 3300025961 | Bacteria | 28673 |
| 195 | Ga0207640_10000520 | 3300025981 | Bacteria | 23233 |
| 196 | Ga0207640_10001662 | 3300025981 | Bacteria | 11932 |
| 197 | Ga0207640_10001858 | 3300025981 | Bacteria | 11317 |
| 198 | Ga0207640_10035122 | 3300025981 | Bacteria | 3135 |
| 199 | Ga0207658_10000111 | 3300025986 | Bacteria | 89180 |
| 200 | Ga0207658_10017720 | 3300025986 | Bacteria | 4909 |
| 201 | Ga0207658_10165691 | 3300025986 | Bacteria | 1815 |
| 202 | Ga0207677_10041477 | 3300026023 | Bacteria | 3044 |
| 203 | Ga0207703_10268105 | 3300026035 | Bacteria | 1546 |
| 204 | Ga0207639_10006418 | 3300026041 | Bacteria | 7994 |
| 205 | Ga0207639_10011793 | 3300026041 | Bacteria | 6077 |
| 206 | Ga0207639_10028359 | 3300026041 | Bacteria | 4086 |
| 207 | Ga0207639_10106264 | 3300026041 | Bacteria | 2278 |
| 208 | Ga0207678_10001607 | 3300026067 | Bacteria | 20786 |
| 209 | Ga0207678_10003697 | 3300026067 | Bacteria | 13747 |
| 210 | Ga0207678_10003892 | 3300026067 | Bacteria | 13425 |
| 211 | Ga0207678_10014414 | 3300026067 | Bacteria | 6950 |
| 212 | Ga0207678_10015604 | 3300026067 | Bacteria | 6679 |
| 213 | Ga0207678_10041938 | 3300026067 | Bacteria | 3967 |
| 214 | Ga0207678_10080456 | 3300026067 | Bacteria | 2790 |
| 215 | Ga0207678_10100629 | 3300026067 | Bacteria | 2469 |
| 216 | Ga0207702_10001094 | 3300026078 | Bacteria | 27736 |
| 217 | Ga0207702_10030702 | 3300026078 | Bacteria | 4476 |
| 218 | Ga0207641_10016805 | 3300026088 | Bacteria | 5992 |
| 219 | Ga0207674_10006195 | 3300026116 | Bacteria | 14101 |
| 220 | Ga0207674_10022125 | 3300026116 | Bacteria | 6834 |
| 221 | Ga0207674_10042767 | 3300026116 | Bacteria | 4676 |
| 222 | Ga0207674_10157596 | 3300026116 | Bacteria | 2225 |
| 223 | Ga0207698_10000597 | 3300026142 | Bacteria | 21126 |
| 224 | Ga0207698_10001254 | 3300026142 | Bacteria | 14828 |
| 225 | Ga0207698_10005025 | 3300026142 | Bacteria | 8113 |
| 226 | Ga0207698_10008313 | 3300026142 | Bacteria | 6555 |
| 227 | Ga0207698_10384650 | 3300026142 | Bacteria | 1336 |
| 228 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 229 | Ga0268266_10000043 | 3300028379 | Bacteria | 316604 |
| 230 | Ga0268265_10001803 | 3300028380 | Bacteria | 17141 |
| 231 | Ga0307412_10000686 | 3300031911 | Bacteria | 19583 |
| 232 | Ga0307510_10000454 | 3300033180 | Bacteria | 39887 |
| 233 | Ga0395899_0014996 | 3300037312 | Bacteria | 5912 |
| 234 | Ga0395899_0143928 | 3300037312 | Bacteria | 1694 |
| 235 | Ga0395900_0000033 | 3300037418 | Bacteria | 260271 |
| 236 | Ga0395900_0003368 | 3300037418 | Bacteria | 17260 |
| 237 | Ga0395898_0089130 | 3300037466 | Bacteria | 2969 |
| 238 | Ga0395901_0004448 | 3300038443 | Bacteria | 14135 |
| 239 | Ga0439436_0000059 | 3300041404 | Bacteria | 30728 |
| 240 | Ga0439436_0039496 | 3300041404 | Bacteria | 1355 |
| 241 | Ga0439465_0000593 | 3300041413 | Bacteria | 10952 |
| 242 | Ga0451791_0677250 | 3300041451 | Bacteria | 4555 |
| 243 | Ga0451793_0536422 | 3300041452 | Bacteria | 1432 |
| 244 | Ga0451793_1693730 | 3300041452 | Bacteria | 2639 |
| 245 | Ga0451800_0698893 | 3300041459 | Bacteria | 1903 |
| 246 | Ga0451833_0100325 | 3300041491 | Bacteria | 2525 |
| 247 | Ga0451837_0920784 | 3300041494 | Bacteria | 4731 |
| 248 | Ga0451843_1112653 | 3300041509 | Bacteria | 1834 |
| 249 | Ga0451853_2952463 | 3300041512 | Bacteria | 1437 |
| 250 | Ga0450908_000386 | 3300042184 | Bacteria | 8488 |
| 251 | Ga0439459_0010089 | 3300042438 | Bacteria | 1640 |
| 252 | Ga0451577_0061725 | 3300042876 | Bacteria | 3342 |
| 253 | Ga0466972_0001022 | 3300044658 | Bacteria | 13418 |
| 254 | Ga0466982_0000311 | 3300044672 | Bacteria | 13456 |
| 255 | Ga0466970_0000664 | 3300044765 | Bacteria | 16885 |
| 256 | Ga0466957_0029828 | 3300044842 | Bacteria | 3255 |
| 257 | Ga0466959_0064335 | 3300045049 | Bacteria | 2663 |
| 258 | Ga0495617_000374 | 3300046452 | Bacteria | 24806 |
| 259 | Ga0495617_003254 | 3300046452 | Bacteria | 6164 |
| 260 | Ga0495638_0000075 | 3300046460 | Bacteria | 161068 |
| 261 | Ga0495638_0000509 | 3300046460 | Bacteria | 45817 |
| 262 | Ga0495638_0023072 | 3300046460 | Bacteria | 4076 |
| 263 | Ga0495650_0006533 | 3300046471 | Bacteria | 7246 |
| 264 | Ga0495584_0000799 | 3300046491 | Bacteria | 20746 |
| 265 | Ga0495585_0000028 | 3300046492 | Bacteria | 146662 |
| 266 | Ga0495585_0003940 | 3300046492 | Bacteria | 9818 |
| 267 | Ga0495607_0000072 | 3300046501 | Bacteria | 100135 |
| 268 | Ga0495607_0000275 | 3300046501 | Bacteria | 55331 |
| 269 | Ga0495607_0090540 | 3300046501 | Bacteria | 1658 |
| 270 | Ga0495583_0009474 | 3300046506 | Bacteria | 5812 |
| 271 | Ga0495606_0001637 | 3300046507 | Bacteria | 29186 |
| 272 | Ga0495606_0003290 | 3300046507 | Bacteria | 17288 |
| 273 | Ga0495606_0006660 | 3300046507 | Bacteria | 10596 |
| 274 | Ga0495606_0087498 | 3300046507 | Bacteria | 1923 |
| 275 | Ga0495610_0000665 | 3300046512 | Bacteria | 33471 |
| 276 | Ga0495610_0031587 | 3300046512 | Bacteria | 2761 |
| 277 | Ga0495616_0000089 | 3300046513 | Bacteria | 77466 |
| 278 | Ga0495616_0012808 | 3300046513 | Bacteria | 4745 |
| 279 | Ga0495620_0000258 | 3300046515 | Bacteria | 39294 |
| 280 | Ga0495620_0000381 | 3300046515 | Bacteria | 30173 |
| 281 | Ga0495631_0000732 | 3300046518 | Bacteria | 21100 |
| 282 | Ga0495631_0001272 | 3300046518 | Bacteria | 15542 |
| 283 | Ga0495632_0000020 | 3300046519 | Bacteria | 210606 |
| 284 | Ga0495643_0023875 | 3300046522 | Bacteria | 3472 |
| 285 | Ga0495648_0002515 | 3300046524 | Bacteria | 16829 |
| 286 | Ga0495648_0015592 | 3300046524 | Bacteria | 5511 |
| 287 | Ga0495609_0003428 | 3300046538 | Bacteria | 9087 |
| 288 | Ga0495622_0102696 | 3300046557 | Bacteria | 1310 |
| 289 | Ga0495668_0007966 | 3300046616 | Bacteria | 6680 |
| 290 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 291 | Ga0495611_0000114 | 3300046648 | Bacteria | 56705 |
| 292 | Ga0495625_0000001 | 3300046660 | Bacteria | 1641829 |
| 293 | Ga0495625_0023937 | 3300046660 | Bacteria | 4657 |
| 294 | Ga0495625_0047291 | 3300046660 | Bacteria | 3103 |
| 295 | Ga0495625_0085558 | 3300046660 | Bacteria | 2188 |
| 296 | Ga0495661_0002622 | 3300046665 | Bacteria | 13777 |
| 297 | Ga0495670_0000718 | 3300046691 | Bacteria | 15794 |
| 298 | Ga0495671_0000683 | 3300046692 | Bacteria | 24539 |
| 299 | Ga0495649_0023062 | 3300046694 | Bacteria | 3477 |
| 300 | Ga0495589_0000120 | 3300046794 | Bacteria | 73521 |
| 301 | Ga0495660_0000395 | 3300046810 | Bacteria | 37740 |
| 302 | Ga0495660_0000667 | 3300046810 | Bacteria | 26462 |
| 303 | Ga0495683_0005608 | 3300047323 | Bacteria | 6955 |
| 304 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 305 | Ga0495673_0000001 | 3300047469 | Bacteria | 1630730 |
| 306 | Ga0495673_0000010 | 3300047469 | Bacteria | 709599 |
| 307 | Ga0495673_0005916 | 3300047469 | Bacteria | 7297 |
| 308 | Ga0495686_0000085 | 3300047472 | Bacteria | 198128 |
| 309 | Ga0495686_0002593 | 3300047472 | Bacteria | 16796 |
| 310 | Ga0495686_0003449 | 3300047472 | Bacteria | 13698 |
| 311 | Ga0495686_0043591 | 3300047472 | Bacteria | 2843 |
| 312 | Ga0496101_0009856 | 3300048904 | Bacteria | 6293 |
| 313 | Ga0496102_0106052 | 3300048905 | Bacteria | 2615 |
| 314 | Ga0496106_0002860 | 3300048909 | Bacteria | 12820 |
| 315 | Ga0496115_0253631 | 3300048918 | Bacteria | 1448 |
| 316 | Ga0496117_0018674 | 3300048920 | Bacteria | 5732 |
| 317 | Ga0496117_0036326 | 3300048920 | Bacteria | 3688 |
| 318 | Ga0496117_0057518 | 3300048920 | Bacteria | 2700 |
| 319 | Ga0496118_0001524 | 3300048921 | Bacteria | 34491 |
| 320 | Ga0496118_0001999 | 3300048921 | Bacteria | 28907 |
| 321 | Ga0496118_0009239 | 3300048921 | Bacteria | 10008 |
| 322 | Ga0496118_0047515 | 3300048921 | Bacteria | 3325 |
| 323 | Ga0496119_0028086 | 3300048922 | Bacteria | 3849 |
| 324 | Ga0496121_0000129 | 3300048924 | Bacteria | 168148 |
| 325 | Ga0496121_0008944 | 3300048924 | Bacteria | 11623 |
| 326 | Ga0496121_0012562 | 3300048924 | Bacteria | 9212 |
| 327 | Ga0496121_0041380 | 3300048924 | Bacteria | 4027 |
| 328 | Ga0496121_0095664 | 3300048924 | Bacteria | 2307 |
| 329 | Ga0496121_0143409 | 3300048924 | Bacteria | 1768 |
| 330 | Ga0496122_0000129 | 3300048925 | Bacteria | 173688 |
| 331 | Ga0496122_0018266 | 3300048925 | Bacteria | 6492 |
| 332 | Ga0496122_0054367 | 3300048925 | Bacteria | 3008 |
| 333 | Ga0496123_0000113 | 3300048926 | Bacteria | 163689 |
| 334 | Ga0496123_0015306 | 3300048926 | Bacteria | 6300 |
| 335 | Ga0496123_0051750 | 3300048926 | Bacteria | 2732 |
| 336 | Ga0496123_0086679 | 3300048926 | Bacteria | 1877 |
| 337 | Ga0496124_0002625 | 3300048927 | Bacteria | 23145 |
| 338 | Ga0496124_0003138 | 3300048927 | Bacteria | 20478 |
| 339 | Ga0496124_0151301 | 3300048927 | Bacteria | 1820 |
| 340 | Ga0496125_0016544 | 3300048928 | Bacteria | 7076 |
| 341 | Ga0496126_0011159 | 3300048929 | Bacteria | 9325 |
| 342 | Ga0495678_000180 | 3300049459 | Bacteria | 72870 |
| 343 | Ga0495682_0003260 | 3300049460 | Bacteria | 7267 |
| 344 | Ga0501031_0016832 | 3300049568 | Bacteria | 4747 |
| 345 | Ga0501032_0005690 | 3300049569 | Bacteria | 9230 |
| 346 | Ga0501032_0014382 | 3300049569 | Bacteria | 5605 |
| 347 | Ga0501033_0001261 | 3300049570 | Bacteria | 22597 |
| 348 | Ga0501033_0006756 | 3300049570 | Bacteria | 8960 |
| 349 | Ga0501033_0012659 | 3300049570 | Bacteria | 6434 |
| 350 | Ga0501034_0000996 | 3300049571 | Bacteria | 40586 |
| 351 | Ga0501034_0004225 | 3300049571 | Bacteria | 16037 |
| 352 | Ga0501034_0006908 | 3300049571 | Bacteria | 12130 |
| 353 | Ga0501036_0003471 | 3300049572 | Bacteria | 12599 |
| 354 | Ga0501036_0016802 | 3300049572 | Bacteria | 6113 |
| 355 | Ga0501037_0004013 | 3300049573 | Bacteria | 10672 |
| 356 | Ga0501037_0019046 | 3300049573 | Bacteria | 5060 |
| 357 | Ga0501037_0029148 | 3300049573 | Bacteria | 4077 |
| 358 | Ga0501037_0039584 | 3300049573 | Bacteria | 3470 |
| 359 | Ga0501038_0011224 | 3300049574 | Bacteria | 8178 |
| 360 | Ga0501038_0079766 | 3300049574 | Bacteria | 2759 |
| 361 | Ga0501038_0094817 | 3300049574 | Bacteria | 2494 |
| 362 | Ga0501039_0001920 | 3300049575 | Bacteria | 15395 |
| 363 | Ga0501039_0021871 | 3300049575 | Bacteria | 4907 |
| 364 | Ga0501039_0146210 | 3300049575 | Bacteria | 1857 |
| 365 | Ga0501042_0007082 | 3300049578 | Bacteria | 7327 |
| 366 | Ga0501043_0003663 | 3300049579 | Bacteria | 12617 |
| 367 | Ga0501043_0009934 | 3300049579 | Bacteria | 7461 |
| 368 | Ga0501043_0014324 | 3300049579 | Bacteria | 6205 |
| 369 | Ga0501043_0082866 | 3300049579 | Bacteria | 2521 |
| 370 | Ga0501046_0003806 | 3300049580 | Bacteria | 13803 |
| 371 | Ga0501046_0019108 | 3300049580 | Bacteria | 5684 |
| 372 | Ga0501046_0030144 | 3300049580 | Bacteria | 4403 |
| 373 | Ga0501047_0003575 | 3300049581 | Bacteria | 14673 |
| 374 | Ga0501047_0008082 | 3300049581 | Bacteria | 9926 |
| 375 | Ga0501047_0037579 | 3300049581 | Bacteria | 4681 |
| 376 | Ga0501047_0118175 | 3300049581 | Bacteria | 2533 |
| 377 | Ga0501047_0216904 | 3300049581 | Bacteria | 1770 |
| 378 | Ga0501048_0023270 | 3300049582 | Bacteria | 4531 |
| 379 | Ga0501048_0030511 | 3300049582 | Bacteria | 3900 |
| 380 | Ga0501067_0014176 | 3300049583 | Bacteria | 4415 |
| 381 | Ga0501069_0001352 | 3300049585 | Bacteria | 12030 |
| 382 | Ga0501069_0019860 | 3300049585 | Bacteria | 3635 |
| 383 | Ga0501069_0043432 | 3300049585 | Bacteria | 2488 |
| 384 | Ga0501070_0000105 | 3300049586 | Bacteria | 73931 |
| 385 | Ga0501070_0003456 | 3300049586 | Bacteria | 13698 |
| 386 | Ga0501070_0009646 | 3300049586 | Bacteria | 8160 |
| 387 | Ga0501070_0010485 | 3300049586 | Bacteria | 7836 |
| 388 | Ga0501070_0014707 | 3300049586 | Bacteria | 6583 |
| 389 | Ga0501070_0016696 | 3300049586 | Bacteria | 6165 |
| 390 | Ga0501070_0065097 | 3300049586 | Bacteria | 3018 |
| 391 | Ga0501070_0071039 | 3300049586 | Bacteria | 2882 |
| 392 | Ga0501070_0122508 | 3300049586 | Bacteria | 2149 |
| 393 | Ga0501070_0369577 | 3300049586 | Bacteria | 1163 |
| 394 | Ga0501071_0008642 | 3300049587 | Bacteria | 6733 |
| 395 | Ga0501071_0026196 | 3300049587 | Bacteria | 4090 |
| 396 | Ga0501071_0124498 | 3300049587 | Bacteria | 1912 |
| 397 | Ga0501072_0022764 | 3300049588 | Bacteria | 4862 |
| 398 | Ga0501073_0001778 | 3300049589 | Bacteria | 16022 |
| 399 | Ga0501073_0006604 | 3300049589 | Bacteria | 8633 |
| 400 | Ga0501073_0056625 | 3300049589 | Bacteria | 2742 |
| 401 | Ga0501073_0067512 | 3300049589 | Bacteria | 2493 |
| 402 | Ga0501073_0111284 | 3300049589 | Bacteria | 1899 |
| 403 | Ga0501074_0000516 | 3300049590 | Bacteria | 23722 |
| 404 | Ga0501074_0002080 | 3300049590 | Bacteria | 13835 |
| 405 | Ga0501074_0008362 | 3300049590 | Bacteria | 7501 |
| 406 | Ga0501074_0044213 | 3300049590 | Bacteria | 3225 |
| 407 | Ga0501077_0026680 | 3300049593 | Bacteria | 3667 |
| 408 | Ga0501079_0201173 | 3300049741 | Bacteria | 1556 |
| 409 | Ga0501080_0001981 | 3300049742 | Bacteria | 17643 |
| 410 | Ga0501080_0003935 | 3300049742 | Bacteria | 13149 |
| 411 | Ga0501080_0012270 | 3300049742 | Bacteria | 7849 |
| 412 | Ga0501080_0014585 | 3300049742 | Bacteria | 7239 |
| 413 | Ga0501080_0055849 | 3300049742 | Bacteria | 3677 |
| 414 | Ga0501080_0074216 | 3300049742 | Bacteria | 3164 |
| 415 | Ga0501083_0013038 | 3300049744 | Bacteria | 5807 |
| 416 | Ga0501083_0177828 | 3300049744 | Bacteria | 1390 |
| 417 | Ga0501035_0010176 | 3300049822 | Bacteria | 8729 |
| 418 | Ga0501035_0015634 | 3300049822 | Bacteria | 7005 |
| 419 | Ga0501035_0017031 | 3300049822 | Bacteria | 6697 |
| 420 | Ga0501035_0021075 | 3300049822 | Bacteria | 5992 |
| 421 | Ga0501035_0035965 | 3300049822 | Bacteria | 4492 |
| 422 | Ga0501044_0006698 | 3300049823 | Bacteria | 12705 |
| 423 | Ga0501044_0008876 | 3300049823 | Bacteria | 10988 |
| 424 | Ga0501044_0010138 | 3300049823 | Bacteria | 10240 |
| 425 | Ga0501044_0011297 | 3300049823 | Bacteria | 9678 |
| 426 | Ga0501044_0023997 | 3300049823 | Bacteria | 6480 |
| 427 | Ga0501044_0036880 | 3300049823 | Bacteria | 5113 |
| 428 | Ga0501044_0052391 | 3300049823 | Bacteria | 4205 |
| 429 | Ga0501044_0095202 | 3300049823 | Bacteria | 3001 |
| 430 | Ga0501044_0210580 | 3300049823 | Bacteria | 1898 |
| 431 | Ga0501045_0017093 | 3300049824 | Bacteria | 5150 |
| 432 | nmdc:mga0sz30_51648_c1 | 3300050516 | Bacteria | 1744 |
| 433 | nmdc:mga0sz30_56447_c1 | 3300050516 | Bacteria | 1672 |
| 434 | Ga0500610_0003179 | 3300053079 | Bacteria | 6250 |
| 435 | Ga0500643_000080 | 3300053087 | Bacteria | 103235 |
| 436 | Ga0500643_006055 | 3300053087 | Bacteria | 5112 |
| 437 | Ga0500651_0000066 | 3300053093 | Bacteria | 69313 |
| 438 | Ga0500651_0005514 | 3300053093 | Bacteria | 7229 |
| 439 | Ga0500555_001068 | 3300053103 | Bacteria | 9212 |
| 440 | Ga0500568_0001880 | 3300053139 | Bacteria | 12928 |
| 441 | Ga0500633_0037876 | 3300053160 | Bacteria | 1603 |
| 442 | Ga0500645_003771 | 3300053730 | Bacteria | 6036 |
| 443 | Ga0501082_0043780 | 3300060353 | Bacteria | 3861 |
| 444 | 2595448400 | 2593339238 | Bacteria | 4182970 |
| 445 | 2595451701 | 2593339239 | Bacteria | 4124669 |
| 446 | 2721028214 | 2718218334 | Bacteria | 4765486 |
| 447 | 2735836290 | 2734482264 | Unclassified | 5014763 |
| 448 | 2739227655 | 2738543009 | Bacteria | 4944499 |
| 449 | 2819563516 | 2818991440 | Bacteria | 4774720 |
| 450 | 2842915385 | 2842914999 | Bacteria | 4419378 |
| 451 | 2842921706 | 2842918807 | Bacteria | 4289178 |
| 452 | 2884339957 | 2884338543 | Bacteria | 4610696 |
| 453 | 2904464174 | 2904463128 | Bacteria | 4775606 |
| 454 | 2919085968 | 2919085039 | Bacteria | 4532964 |
| 455 | 2919404778 | 2919404418 | Bacteria | 4232372 |
| 456 | 2941472328 | 2941471342 | Bacteria | 5018624 |
| 457 | 2953997720 | 2953994433 | Bacteria | 4303959 |
| 458 | Ga0157372_10012045 | |||
| 459 | JGI24741J21665_1000508 | |||
| 460 | JGI24741J21665_1002123 | |||
| 461 | JGI24740J21852_10000081 | |||
| 462 | JGI24740J21852_10002090 | |||
| 463 | Ga0006562J51391_1050537 | |||
| 464 | Ga0065165_1000028 | |||
| 465 | Ga0070658_10010731 | |||
| 466 | Ga0070658_10114265 | |||
| 467 | Ga0070683_100026310 | |||
| 468 | Ga0070666_10000003 | |||
| 469 | Ga0070666_10069848 | |||
| 470 | Ga0070680_100000209 | |||
| 471 | Ga0070680_100002696 | |||
| 472 | Ga0070680_100015175 | |||
| 473 | Ga0070680_100037724 | |||
| 474 | Ga0070660_100081084 | |||
| 475 | Ga0070691_10006882 | |||
| 476 | Ga0070691_10012736 | |||
| 477 | Ga0070691_10060046 | |||
| 478 | Ga0070661_100009557 | |||
| 479 | Ga0070661_100009838 | |||
| 480 | Ga0070661_100069158 | |||
| 481 | Ga0070661_100104867 | |||
| 482 | Ga0070661_100112416 | |||
| 483 | Ga0070692_10003232 | |||
| 484 | Ga0070692_10006577 | |||
| 485 | Ga0070692_10009325 | |||
| 486 | Ga0070673_100379615 | |||
| 487 | Ga0070667_100000173 | |||
| 488 | Ga0070667_100008807 | |||
| 489 | Ga0070667_100190929 | |||
| 490 | Ga0070667_100282996 | |||
| 491 | Ga0070663_100000433 | |||
| 492 | Ga0070663_100015908 | |||
| 493 | Ga0070663_100023286 | |||
| 494 | Ga0070663_100187448 | |||
| 495 | Ga0070662_100103912 | |||
| 496 | Ga0070681_10000007 | |||
| 497 | Ga0070681_10000397 | |||
| 498 | Ga0070681_10001146 | |||
| 499 | Ga0070681_10003054 | |||
| 500 | Ga0070681_10007619 | |||
| 501 | Ga0070679_100000412 | |||
| 502 | Ga0070679_100004752 | |||
| 503 | Ga0070679_100019076 | |||
| 504 | Ga0070679_100094387 | |||
| 505 | Ga0070684_100059656 | |||
| 506 | Ga0068853_100000439 | |||
| 507 | Ga0068853_100017370 | |||
| 508 | Ga0068853_100039571 | |||
| 509 | Ga0068853_100220291 | |||
| 510 | Ga0068853_100228231 | |||
| 511 | Ga0070696_100020716 | |||
| 512 | Ga0070696_100172692 | |||
| 513 | Ga0070693_100041423 | |||
| 514 | Ga0070665_100000095 | |||
| 515 | Ga0070665_100016693 | |||
| 516 | Ga0070665_100089669 | |||
| 517 | Ga0070665_100135651 | |||
| 518 | Ga0068855_100001280 | |||
| 519 | Ga0068855_100037409 | |||
| 520 | Ga0068855_100119819 | |||
| 521 | Ga0070664_100110949 | |||
| 522 | Ga0070664_100110963 | |||
| 523 | Ga0068857_100059269 | |||
| 524 | Ga0068857_100238473 | |||
| 525 | Ga0068854_100007759 | |||
| 526 | Ga0068854_100060638 | |||
| 527 | Ga0068856_100086758 | |||
| 528 | Ga0068856_100293622 | |||
| 529 | Ga0068852_100015996 | |||
| 530 | Ga0068852_100076624 | |||
| 531 | Ga0068852_100369324 | |||
| 532 | Ga0068859_100000208 | |||
| 533 | Ga0068863_100031233 | |||
| 534 | Ga0068858_100143020 | |||
| 535 | Ga0068858_100288130 | |||
| 536 | Ga0068860_100093592 | |||
| 537 | Ga0068862_100000707 | |||
| 538 | Ga0097621_100017131 | |||
| 539 | Ga0097620_100000208 | |||
| 540 | Ga0105240_10178986 | |||
| 541 | Ga0105240_10247216 | |||
| 542 | Ga0105248_10004348 | |||
| 543 | Ga0105237_10000345 | |||
| 544 | Ga0105237_10220671 | |||
| 545 | Ga0105238_10000186 | |||
| 546 | Ga0105238_10007356 | |||
| 547 | Ga0105249_10000175 | |||
| 548 | Ga0105249_10005249 | |||
| 549 | Ga0105239_10028102 | |||
| 550 | Ga0105239_10081197 | |||
| 551 | Ga0157373_10012677 | |||
| 552 | Ga0157373_10015464 | |||
| 553 | Ga0157373_10038026 | |||
| 554 | Ga0157373_10049712 | |||
| 555 | Ga0157371_10023393 | |||
| 556 | Ga0157371_10042158 | |||
| 557 | Ga0157370_10000124 | |||
| 558 | Ga0157370_10007635 | |||
| 559 | Ga0157370_10016867 | |||
| 560 | Ga0157370_10027982 | |||
| 561 | Ga0157369_10000406 | |||
| 562 | Ga0163162_10000209 | |||
| 563 | Ga0157372_10005109 | |||
| 564 | Ga0157372_10038188 | |||
| 565 | Ga0157372_10069936 | |||
| 566 | Ga0157372_10197662 | |||
| 567 | Ga0182008_10002192 | |||
| 568 | Ga0157376_10105876 | |||
| 569 | Ga0182006_1000367 | |||
| 570 | Ga0182006_1000510 | |||
| 571 | Ga0182007_10007807 | |||
| 572 | Ga0182005_1000129 | |||
| 573 | Ga0182005_1002462 | |||
| 574 | Ga0163161_10003032 | |||
| 575 | Ga0197907_10743544 | |||
| 576 | Ga0206356_10588647 | |||
| 577 | Ga0206356_10754312 | |||
| 578 | Ga0206354_10319638 | |||
| 579 | Ga0206354_10842667 | |||
| 580 | Ga0206354_10850882 | |||
| 581 | Ga0206353_10413362 | |||
| 582 | Ga0206353_11387623 | |||
| 583 | Ga0206353_11654005 | |||
| 584 | Ga0154015_1063321 | |||
| 585 | Ga0209674_100300 | |||
| 586 | Ga0209129_1000194 | |||
| 587 | Ga0207656_10057094 | |||
| 588 | Ga0207680_10000006 | |||
| 589 | Ga0207647_10000006 | |||
| 590 | Ga0207647_10000229 | |||
| 591 | Ga0207647_10015631 | |||
| 592 | Ga0207705_10000128 | |||
| 593 | Ga0207705_10001240 | |||
| 594 | Ga0207705_10001241 | |||
| 595 | Ga0207705_10001617 | |||
| 596 | Ga0207705_10002071 | |||
| 597 | Ga0207705_10010095 | |||
| 598 | Ga0207705_10057153 | |||
| 599 | Ga0207707_10000383 | |||
| 600 | Ga0207707_10000665 | |||
| 601 | Ga0207707_10001116 | |||
| 602 | Ga0207707_10001756 | |||
| 603 | Ga0207707_10003727 | |||
| 604 | Ga0207707_10003792 | |||
| 605 | Ga0207707_10007845 | |||
| 606 | Ga0207695_10001748 | |||
| 607 | Ga0207695_10007277 | |||
| 608 | Ga0207695_10022640 | |||
| 609 | Ga0207671_10001184 | |||
| 610 | Ga0207660_10001148 | |||
| 611 | Ga0207660_10001455 | |||
| 612 | Ga0207660_10004398 | |||
| 613 | Ga0207660_10007940 | |||
| 614 | Ga0207660_10012405 | |||
| 615 | Ga0207657_10005512 | |||
| 616 | Ga0207657_10005547 | |||
| 617 | Ga0207657_10028735 | |||
| 618 | Ga0207657_10030086 | |||
| 619 | Ga0207657_10095570 | |||
| 620 | Ga0207649_10000493 | |||
| 621 | Ga0207649_10010189 | |||
| 622 | Ga0207649_10036055 | |||
| 623 | Ga0207649_10036821 | |||
| 624 | Ga0207649_10045629 | |||
| 625 | Ga0207652_10000030 | |||
| 626 | Ga0207652_10000820 | |||
| 627 | Ga0207652_10000846 | |||
| 628 | Ga0207652_10001343 | |||
| 629 | Ga0207652_10001614 | |||
| 630 | Ga0207652_10001631 | |||
| 631 | Ga0207652_10002369 | |||
| 632 | Ga0207652_10067165 | |||
| 633 | Ga0207694_10000559 | |||
| 634 | Ga0207694_10004810 | |||
| 635 | Ga0207690_10000327 | |||
| 636 | Ga0207690_10000878 | |||
| 637 | Ga0207691_10127731 | |||
| 638 | Ga0207711_10003763 | |||
| 639 | Ga0207661_10005841 | |||
| 640 | Ga0207661_10008408 | |||
| 641 | Ga0207661_10128814 | |||
| 642 | Ga0207679_10067180 | |||
| 643 | Ga0207667_10000634 | |||
| 644 | Ga0207667_10000818 | |||
| 645 | Ga0207667_10005607 | |||
| 646 | Ga0207667_10010062 | |||
| 647 | Ga0207667_10013287 | |||
| 648 | Ga0207667_10017782 | |||
| 649 | Ga0207667_10034921 | |||
| 650 | Ga0207667_10074537 | |||
| 651 | Ga0207712_10000600 | |||
| 652 | Ga0207640_10000520 | |||
| 653 | Ga0207640_10001662 | |||
| 654 | Ga0207640_10001858 | |||
| 655 | Ga0207640_10035122 | |||
| 656 | Ga0207658_10000111 | |||
| 657 | Ga0207658_10017720 | |||
| 658 | Ga0207658_10165691 | |||
| 659 | Ga0207677_10041477 | |||
| 660 | Ga0207703_10268105 | |||
| 661 | Ga0207639_10006418 | |||
| 662 | Ga0207639_10011793 | |||
| 663 | Ga0207639_10028359 | |||
| 664 | Ga0207639_10106264 | |||
| 665 | Ga0207678_10001607 | |||
| 666 | Ga0207678_10003697 | |||
| 667 | Ga0207678_10003892 | |||
| 668 | Ga0207678_10014414 | |||
| 669 | Ga0207678_10015604 | |||
| 670 | Ga0207678_10041938 | |||
| 671 | Ga0207678_10080456 | |||
| 672 | Ga0207678_10100629 | |||
| 673 | Ga0207702_10001094 | |||
| 674 | Ga0207702_10030702 | |||
| 675 | Ga0207641_10016805 | |||
| 676 | Ga0207674_10006195 | |||
| 677 | Ga0207674_10022125 | |||
| 678 | Ga0207674_10042767 | |||
| 679 | Ga0207674_10157596 | |||
| 680 | Ga0207698_10000597 | |||
| 681 | Ga0207698_10001254 | |||
| 682 | Ga0207698_10005025 | |||
| 683 | Ga0207698_10008313 | |||
| 684 | Ga0207698_10384650 | |||
| 685 | Ga0268266_10000001 | |||
| 686 | Ga0268266_10000043 | |||
| 687 | Ga0268265_10001803 | |||
| 688 | Ga0307412_10000686 | |||
| 689 | Ga0307510_10000454 | |||
| 690 | Ga0395899_0014996 | |||
| 691 | Ga0395899_0143928 | |||
| 692 | Ga0395900_0000033 | |||
| 693 | Ga0395900_0003368 | |||
| 694 | Ga0395898_0089130 | |||
| 695 | Ga0395901_0004448 | |||
| 696 | Ga0439436_0000059 | |||
| 697 | Ga0439436_0039496 | |||
| 698 | Ga0439465_0000593 | |||
| 699 | Ga0451791_0677250 | |||
| 700 | Ga0451793_0536422 | |||
| 701 | Ga0451793_1693730 | |||
| 702 | Ga0451800_0698893 | |||
| 703 | Ga0451833_0100325 | |||
| 704 | Ga0451837_0920784 | |||
| 705 | Ga0451843_1112653 | |||
| 706 | Ga0451853_2952463 | |||
| 707 | Ga0450908_000386 | |||
| 708 | Ga0439459_0010089 | |||
| 709 | Ga0451577_0061725 | |||
| 710 | Ga0466972_0001022 | |||
| 711 | Ga0466982_0000311 | |||
| 712 | Ga0466970_0000664 | |||
| 713 | Ga0466957_0029828 | |||
| 714 | Ga0466959_0064335 | |||
| 715 | Ga0495617_000374 | |||
| 716 | Ga0495617_003254 | |||
| 717 | Ga0495638_0000075 | |||
| 718 | Ga0495638_0000509 | |||
| 719 | Ga0495638_0023072 | |||
| 720 | Ga0495650_0006533 | |||
| 721 | Ga0495584_0000799 | |||
| 722 | Ga0495585_0000028 | |||
| 723 | Ga0495585_0003940 | |||
| 724 | Ga0495607_0000072 | |||
| 725 | Ga0495607_0000275 | |||
| 726 | Ga0495607_0090540 | |||
| 727 | Ga0495583_0009474 | |||
| 728 | Ga0495606_0001637 | |||
| 729 | Ga0495606_0003290 | |||
| 730 | Ga0495606_0006660 | |||
| 731 | Ga0495606_0087498 | |||
| 732 | Ga0495610_0000665 | |||
| 733 | Ga0495610_0031587 | |||
| 734 | Ga0495616_0000089 | |||
| 735 | Ga0495616_0012808 | |||
| 736 | Ga0495620_0000258 | |||
| 737 | Ga0495620_0000381 | |||
| 738 | Ga0495631_0000732 | |||
| 739 | Ga0495631_0001272 | |||
| 740 | Ga0495632_0000020 | |||
| 741 | Ga0495643_0023875 | |||
| 742 | Ga0495648_0002515 | |||
| 743 | Ga0495648_0015592 | |||
| 744 | Ga0495609_0003428 | |||
| 745 | Ga0495622_0102696 | |||
| 746 | Ga0495668_0007966 | |||
| 747 | Ga0495611_0000001 | |||
| 748 | Ga0495611_0000114 | |||
| 749 | Ga0495625_0000001 | |||
| 750 | Ga0495625_0023937 | |||
| 751 | Ga0495625_0047291 | |||
| 752 | Ga0495625_0085558 | |||
| 753 | Ga0495661_0002622 | |||
| 754 | Ga0495670_0000718 | |||
| 755 | Ga0495671_0000683 | |||
| 756 | Ga0495649_0023062 | |||
| 757 | Ga0495589_0000120 | |||
| 758 | Ga0495660_0000395 | |||
| 759 | Ga0495660_0000667 | |||
| 760 | Ga0495683_0005608 | |||
| 761 | Ga0495679_000001 | |||
| 762 | Ga0495673_0000001 | |||
| 763 | Ga0495673_0000010 | |||
| 764 | Ga0495673_0005916 | |||
| 765 | Ga0495686_0000085 | |||
| 766 | Ga0495686_0002593 | |||
| 767 | Ga0495686_0003449 | |||
| 768 | Ga0495686_0043591 | |||
| 769 | Ga0496101_0009856 | |||
| 770 | Ga0496102_0106052 | |||
| 771 | Ga0496106_0002860 | |||
| 772 | Ga0496115_0253631 | |||
| 773 | Ga0496117_0018674 | |||
| 774 | Ga0496117_0036326 | |||
| 775 | Ga0496117_0057518 | |||
| 776 | Ga0496118_0001524 | |||
| 777 | Ga0496118_0001999 | |||
| 778 | Ga0496118_0009239 | |||
| 779 | Ga0496118_0047515 | |||
| 780 | Ga0496119_0028086 | |||
| 781 | Ga0496121_0000129 | |||
| 782 | Ga0496121_0008944 | |||
| 783 | Ga0496121_0012562 | |||
| 784 | Ga0496121_0041380 | |||
| 785 | Ga0496121_0095664 | |||
| 786 | Ga0496121_0143409 | |||
| 787 | Ga0496122_0000129 | |||
| 788 | Ga0496122_0018266 | |||
| 789 | Ga0496122_0054367 | |||
| 790 | Ga0496123_0000113 | |||
| 791 | Ga0496123_0015306 | |||
| 792 | Ga0496123_0051750 | |||
| 793 | Ga0496123_0086679 | |||
| 794 | Ga0496124_0002625 | |||
| 795 | Ga0496124_0003138 | |||
| 796 | Ga0496124_0151301 | |||
| 797 | Ga0496125_0016544 | |||
| 798 | Ga0496126_0011159 | |||
| 799 | Ga0495678_000180 | |||
| 800 | Ga0495682_0003260 | |||
| 801 | Ga0501031_0016832 | |||
| 802 | Ga0501032_0005690 | |||
| 803 | Ga0501032_0014382 | |||
| 804 | Ga0501033_0001261 | |||
| 805 | Ga0501033_0006756 | |||
| 806 | Ga0501033_0012659 | |||
| 807 | Ga0501034_0000996 | |||
| 808 | Ga0501034_0004225 | |||
| 809 | Ga0501034_0006908 | |||
| 810 | Ga0501036_0003471 | |||
| 811 | Ga0501036_0016802 | |||
| 812 | Ga0501037_0004013 | |||
| 813 | Ga0501037_0019046 | |||
| 814 | Ga0501037_0029148 | |||
| 815 | Ga0501037_0039584 | |||
| 816 | Ga0501038_0011224 | |||
| 817 | Ga0501038_0079766 | |||
| 818 | Ga0501038_0094817 | |||
| 819 | Ga0501039_0001920 | |||
| 820 | Ga0501039_0021871 | |||
| 821 | Ga0501039_0146210 | |||
| 822 | Ga0501042_0007082 | |||
| 823 | Ga0501043_0003663 | |||
| 824 | Ga0501043_0009934 | |||
| 825 | Ga0501043_0014324 | |||
| 826 | Ga0501043_0082866 | |||
| 827 | Ga0501046_0003806 | |||
| 828 | Ga0501046_0019108 | |||
| 829 | Ga0501046_0030144 | |||
| 830 | Ga0501047_0003575 | |||
| 831 | Ga0501047_0008082 | |||
| 832 | Ga0501047_0037579 | |||
| 833 | Ga0501047_0118175 | |||
| 834 | Ga0501047_0216904 | |||
| 835 | Ga0501048_0023270 | |||
| 836 | Ga0501048_0030511 | |||
| 837 | Ga0501067_0014176 | |||
| 838 | Ga0501069_0001352 | |||
| 839 | Ga0501069_0019860 | |||
| 840 | Ga0501069_0043432 | |||
| 841 | Ga0501070_0000105 | |||
| 842 | Ga0501070_0003456 | |||
| 843 | Ga0501070_0009646 | |||
| 844 | Ga0501070_0010485 | |||
| 845 | Ga0501070_0014707 | |||
| 846 | Ga0501070_0016696 | |||
| 847 | Ga0501070_0065097 | |||
| 848 | Ga0501070_0071039 | |||
| 849 | Ga0501070_0122508 | |||
| 850 | Ga0501070_0369577 | |||
| 851 | Ga0501071_0008642 | |||
| 852 | Ga0501071_0026196 | |||
| 853 | Ga0501071_0124498 | |||
| 854 | Ga0501072_0022764 | |||
| 855 | Ga0501073_0001778 | |||
| 856 | Ga0501073_0006604 | |||
| 857 | Ga0501073_0056625 | |||
| 858 | Ga0501073_0067512 | |||
| 859 | Ga0501073_0111284 | |||
| 860 | Ga0501074_0000516 | |||
| 861 | Ga0501074_0002080 | |||
| 862 | Ga0501074_0008362 | |||
| 863 | Ga0501074_0044213 | |||
| 864 | Ga0501077_0026680 | |||
| 865 | Ga0501079_0201173 | |||
| 866 | Ga0501080_0001981 | |||
| 867 | Ga0501080_0003935 | |||
| 868 | Ga0501080_0012270 | |||
| 869 | Ga0501080_0014585 | |||
| 870 | Ga0501080_0055849 | |||
| 871 | Ga0501080_0074216 | |||
| 872 | Ga0501083_0013038 | |||
| 873 | Ga0501083_0177828 | |||
| 874 | Ga0501035_0010176 | |||
| 875 | Ga0501035_0015634 | |||
| 876 | Ga0501035_0017031 | |||
| 877 | Ga0501035_0021075 | |||
| 878 | Ga0501035_0035965 | |||
| 879 | Ga0501044_0006698 | |||
| 880 | Ga0501044_0008876 | |||
| 881 | Ga0501044_0010138 | |||
| 882 | Ga0501044_0011297 | |||
| 883 | Ga0501044_0023997 | |||
| 884 | Ga0501044_0036880 | |||
| 885 | Ga0501044_0052391 | |||
| 886 | Ga0501044_0095202 | |||
| 887 | Ga0501044_0210580 | |||
| 888 | Ga0501045_0017093 | |||
| 889 | nmdc:mga0sz30_51648_c1 | |||
| 890 | nmdc:mga0sz30_56447_c1 | |||
| 891 | Ga0500610_0003179 | |||
| 892 | Ga0500643_000080 | |||
| 893 | Ga0500643_006055 | |||
| 894 | Ga0500651_0000066 | |||
| 895 | Ga0500651_0005514 | |||
| 896 | Ga0500555_001068 | |||
| 897 | Ga0500568_0001880 | |||
| 898 | Ga0500633_0037876 | |||
| 899 | Ga0500645_003771 | |||
| 900 | Ga0501082_0043780 | |||
| 901 | 2595448400 | |||
| 902 | 2595451701 | |||
| 903 | 2721028214 | |||
| 904 | 2735836290 | |||
| 905 | 2739227655 | |||
| 906 | 2819563516 | |||
| 907 | 2842915385 | |||
| 908 | 2842921706 | |||
| 909 | 2884339957 | |||
| 910 | 2904464174 | |||
| 911 | 2919085968 | |||
| 912 | 2919404778 | |||
| 913 | 2941472328 | |||
| 914 | 2953997720 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4r5z-assembly2.cif.gz_D | crystal structure of rv3772 encoded aminotransferase | 0.9471 | 2 | 312 |
| 3ffh-assembly1.cif.gz_B | the crystal structure of histidinol-phosphate aminotransferase from listeria innocua clip11262. | 0.9416 | 10 | 312 |
| 3ly1-assembly1.cif.gz_B | crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution | 0.9352 | 2 | 312 |
| 3get-assembly1.cif.gz_A | crystal structure of putative histidinol-phosphate aminotransferase (np_281508.1) from campylobacter jejuni at 2.01 a resolution | 0.9306 | 2 | 312 |
| 4wbt-assembly2.cif.gz_B-3 | crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate | 0.9294 | 2 | 313 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G087_68_261_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9689 | 20 | 218 | 3.40.640.10 |
| af_Q2G087_68_261_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9543 | 20 | 218 | 3.40.640.10 |
| 4r5zC02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.952 | 2 | 222 | 3.40.640.10 |
| af_P9WML5_24_353_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.95 | 2 | 312 | 3.50.50.60 |
| 3ffhA02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9409 | 13 | 222 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522RIB0-F1-model_v4 | Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | 0.9904 | 211 | 313 |
GO:0008483
GO:0009058 GO:0030170 |
| AF-A0A1I6H5W0-F1-model_v4 | Histidinol-phosphate aminotransferase (EC 2.6.1.9) (Imidazole acetol-phosphate transaminase) | 0.981 | 2 | 312 |
GO:0000105
GO:0004400 GO:0030170 |
| AF-A0A522RIB0-F1-model_v4 | Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | 0.981 | 211 | 313 |
GO:0008483
GO:0009058 GO:0030170 |
| AF-A0A7C7SAE3-F1-model_v4 | deleted | 0.9802 | 2 | 312 |
|
| AF-A0A2D7S3X9-F1-model_v4 | Histidinol-phosphate aminotransferase (EC 2.6.1.9) (Imidazole acetol-phosphate transaminase) | 0.9769 | 8 | 312 |
GO:0000105
GO:0004400 GO:0030170 |