F447989

General Info

Members Datasets Scaffolds Average Seq Length
457 210 914 372

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10012045|Ga0157372_100120456
Length 388
Sequence MSGATNRAAQDAPIATDTSWKSFDAGALANNATAALRAYDPGHDLPALRKRFGAEIAELGSNENPLGPSPRAVEAMRGALAETFRYPDPRGLSLKTALSARLGVGTDRIALGNGSHELLMLLAQCFADSTHSVVFSQYGFAVFPIATAAAGAIALRVPALPRSHPSAPYGHDLDAIAAAVRADTRIVYLANPNNPTGTWFDDAALDDFVARVPRDVLIVVDEAYSEYVDASGLTSALRLAGRYPNLVVTRTFSKAYGLAGLRIGYFIAHPSVVEVIERLRESFNVNNVALAAAEAALSDAEHLAEVRAFNGAERAWLVDALKSRGYAPLPSQTNFVLVDVGGDAAQFEKRLFERGVIVRPMQGYGFRDAVRISVGNRTENQRLADALP

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
100 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
101 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
102 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
103 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
104 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
105 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
106 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
107 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
108 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
109 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
110 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
111 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
112 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
113 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
119 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
120 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
122 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
125 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
126 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
127 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
128 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
129 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
130 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
131 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
132 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
133 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
134 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
139 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
140 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
141 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
142 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
143 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
144 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
151 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
152 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
155 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
160 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
189 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
190 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
191 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
192 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
195 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
198 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
199 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
200 2734482264 Dyella sp. AD052 Isolate Unclassified
201 2738543009 Luteibacter sp. OK325 Isolate Unclassified
202 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
203 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
204 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
205 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
206 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
207 2919085039 Luteibacter sp. 1214 Isolate Unclassified
208 2919404418 Luteibacter sp. 3190 Isolate Unclassified
209 2941471342 Luteibacter sp. 621 Isolate Unclassified
210 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.53
Metatranscriptomes 2.41
Isolates 3.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.06
Nodule 0
Rhizoplane 1.75
Rhizosphere 85.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10012045 3300013307 Bacteria 9210
2 JGI24741J21665_1000508 3300001915 Bacteria 11879
3 JGI24741J21665_1002123 3300001915 Bacteria 5285
4 JGI24740J21852_10000081 3300001979 Bacteria 32518
5 JGI24740J21852_10002090 3300001979 Bacteria 9129
6 Ga0006562J51391_1050537 3300003578 Bacteria 2655
7 Ga0065165_1000028 3300005262 Bacteria 224430
8 Ga0070658_10010731 3300005327 Bacteria 7342
9 Ga0070658_10114265 3300005327 Bacteria 2238
10 Ga0070683_100026310 3300005329 Bacteria 5237
11 Ga0070666_10000003 3300005335 Bacteria 463666
12 Ga0070666_10069848 3300005335 Bacteria 2389
13 Ga0070680_100000209 3300005336 Bacteria 38470
14 Ga0070680_100002696 3300005336 Bacteria 13168
15 Ga0070680_100015175 3300005336 Bacteria 6033
16 Ga0070680_100037724 3300005336 Bacteria 3905
17 Ga0070660_100081084 3300005339 Bacteria 2547
18 Ga0070691_10006882 3300005341 Bacteria 5201
19 Ga0070691_10012736 3300005341 Bacteria 3853
20 Ga0070691_10060046 3300005341 Bacteria 1827
21 Ga0070661_100009557 3300005344 Bacteria 6718
22 Ga0070661_100009838 3300005344 Bacteria 6633
23 Ga0070661_100069158 3300005344 Bacteria 2596
24 Ga0070661_100104867 3300005344 Bacteria 2106
25 Ga0070661_100112416 3300005344 Bacteria 2035
26 Ga0070692_10003232 3300005345 Bacteria 6561
27 Ga0070692_10006577 3300005345 Bacteria 5056
28 Ga0070692_10009325 3300005345 Bacteria 4423
29 Ga0070673_100379615 3300005364 Bacteria 1260
30 Ga0070667_100000173 3300005367 Bacteria 79829
31 Ga0070667_100008807 3300005367 Bacteria 8361
32 Ga0070667_100190929 3300005367 Bacteria 1815
33 Ga0070667_100282996 3300005367 Bacteria 1489
34 Ga0070663_100000433 3300005455 Bacteria 22073
35 Ga0070663_100015908 3300005455 Bacteria 4870
36 Ga0070663_100023286 3300005455 Bacteria 4149
37 Ga0070663_100187448 3300005455 Bacteria 1608
38 Ga0070662_100103912 3300005457 Bacteria 2155
39 Ga0070681_10000007 3300005458 Bacteria 159821
40 Ga0070681_10000397 3300005458 Bacteria 35263
41 Ga0070681_10001146 3300005458 Bacteria 22848
42 Ga0070681_10003054 3300005458 Bacteria 15517
43 Ga0070681_10007619 3300005458 Bacteria 10581
44 Ga0070679_100000412 3300005530 Bacteria 36448
45 Ga0070679_100004752 3300005530 Bacteria 12528
46 Ga0070679_100019076 3300005530 Bacteria 6663
47 Ga0070679_100094387 3300005530 Bacteria 2978
48 Ga0070684_100059656 3300005535 Bacteria 3336
49 Ga0068853_100000439 3300005539 Bacteria 28384
50 Ga0068853_100017370 3300005539 Bacteria 5941
51 Ga0068853_100039571 3300005539 Bacteria 4022
52 Ga0068853_100220291 3300005539 Bacteria 1733
53 Ga0068853_100228231 3300005539 Bacteria 1702
54 Ga0070696_100020716 3300005546 Bacteria 4455
55 Ga0070696_100172692 3300005546 Bacteria 1599
56 Ga0070693_100041423 3300005547 Bacteria 2591
57 Ga0070665_100000095 3300005548 Bacteria 170459
58 Ga0070665_100016693 3300005548 Bacteria 7357
59 Ga0070665_100089669 3300005548 Bacteria 3081
60 Ga0070665_100135651 3300005548 Bacteria 2463
61 Ga0068855_100001280 3300005563 Bacteria 31168
62 Ga0068855_100037409 3300005563 Bacteria 5771
63 Ga0068855_100119819 3300005563 Bacteria 3013
64 Ga0070664_100110949 3300005564 Bacteria 2394
65 Ga0070664_100110963 3300005564 Bacteria 2394
66 Ga0068857_100059269 3300005577 Bacteria 3400
67 Ga0068857_100238473 3300005577 Bacteria 1664
68 Ga0068854_100007759 3300005578 Bacteria 6862
69 Ga0068854_100060638 3300005578 Bacteria 2738
70 Ga0068856_100086758 3300005614 Bacteria 3110
71 Ga0068856_100293622 3300005614 Bacteria 1642
72 Ga0068852_100015996 3300005616 Bacteria 5840
73 Ga0068852_100076624 3300005616 Bacteria 2953
74 Ga0068852_100369324 3300005616 Bacteria 1405
75 Ga0068859_100000208 3300005617 Bacteria 58155
76 Ga0068863_100031233 3300005841 Bacteria 5084
77 Ga0068858_100143020 3300005842 Bacteria 2246
78 Ga0068858_100288130 3300005842 Bacteria 1565
79 Ga0068860_100093592 3300005843 Bacteria 2864
80 Ga0068862_100000707 3300005844 Bacteria 34098
81 Ga0097621_100017131 3300006237 Bacteria 5497
82 Ga0097620_100000208 3300006931 Bacteria 58155
83 Ga0105240_10178986 3300009093 Bacteria 2504
84 Ga0105240_10247216 3300009093 Bacteria 2065
85 Ga0105248_10004348 3300009177 Bacteria 15668
86 Ga0105237_10000345 3300009545 Bacteria 65477
87 Ga0105237_10220671 3300009545 Bacteria 1896
88 Ga0105238_10000186 3300009551 Bacteria 68293
89 Ga0105238_10007356 3300009551 Bacteria 11025
90 Ga0105249_10000175 3300009553 Bacteria 74934
91 Ga0105249_10005249 3300009553 Bacteria 11183
92 Ga0105239_10028102 3300010375 Bacteria 6189
93 Ga0105239_10081197 3300010375 Bacteria 3569
94 Ga0157373_10012677 3300013100 Bacteria 6197
95 Ga0157373_10015464 3300013100 Bacteria 5579
96 Ga0157373_10038026 3300013100 Bacteria 3449
97 Ga0157373_10049712 3300013100 Bacteria 2987
98 Ga0157371_10023393 3300013102 Bacteria 4518
99 Ga0157371_10042158 3300013102 Bacteria 3254
100 Ga0157370_10000124 3300013104 Bacteria 91398
101 Ga0157370_10007635 3300013104 Bacteria 11740
102 Ga0157370_10016867 3300013104 Bacteria 7382
103 Ga0157370_10027982 3300013104 Bacteria 5551
104 Ga0157369_10000406 3300013105 Bacteria 57192
105 Ga0163162_10000209 3300013306 Bacteria 54322
106 Ga0157372_10005109 3300013307 Bacteria 13947
107 Ga0157372_10038188 3300013307 Bacteria 5299
108 Ga0157372_10069936 3300013307 Bacteria 3948
109 Ga0157372_10197662 3300013307 Bacteria 2329
110 Ga0182008_10002192 3300014497 Bacteria 12398
111 Ga0157376_10105876 3300014969 Bacteria 2467
112 Ga0182006_1000367 3300015261 Bacteria 37426
113 Ga0182006_1000510 3300015261 Bacteria 29601
114 Ga0182007_10007807 3300015262 Bacteria 4449
115 Ga0182005_1000129 3300015265 Bacteria 53573
116 Ga0182005_1002462 3300015265 Bacteria 6597
117 Ga0163161_10003032 3300017792 Bacteria 11858
118 Ga0197907_10743544 3300020069 Bacteria 1505
119 Ga0206356_10588647 3300020070 Bacteria 3784
120 Ga0206356_10754312 3300020070 Bacteria 6713
121 Ga0206354_10319638 3300020081 Bacteria 8969
122 Ga0206354_10842667 3300020081 Bacteria 1598
123 Ga0206354_10850882 3300020081 Bacteria 2769
124 Ga0206353_10413362 3300020082 Bacteria 4023
125 Ga0206353_11387623 3300020082 Bacteria 7305
126 Ga0206353_11654005 3300020082 Bacteria 3342
127 Ga0154015_1063321 3300020610 Bacteria 5540
128 Ga0209674_100300 3300025226 Bacteria 34463
129 Ga0209129_1000194 3300025258 Bacteria 80824
130 Ga0207656_10057094 3300025321 Bacteria 1703
131 Ga0207680_10000006 3300025903 Bacteria 635950
132 Ga0207647_10000006 3300025904 Bacteria 214791
133 Ga0207647_10000229 3300025904 Bacteria 46400
134 Ga0207647_10015631 3300025904 Bacteria 5196
135 Ga0207705_10000128 3300025909 Bacteria 83519
136 Ga0207705_10001240 3300025909 Bacteria 20526
137 Ga0207705_10001241 3300025909 Bacteria 20523
138 Ga0207705_10001617 3300025909 Bacteria 17880
139 Ga0207705_10002071 3300025909 Bacteria 15590
140 Ga0207705_10010095 3300025909 Bacteria 6874
141 Ga0207705_10057153 3300025909 Bacteria 2814
142 Ga0207707_10000383 3300025912 Bacteria 46195
143 Ga0207707_10000665 3300025912 Bacteria 34141
144 Ga0207707_10001116 3300025912 Bacteria 25500
145 Ga0207707_10001756 3300025912 Bacteria 19911
146 Ga0207707_10003727 3300025912 Bacteria 13495
147 Ga0207707_10003792 3300025912 Bacteria 13399
148 Ga0207707_10007845 3300025912 Bacteria 9281
149 Ga0207695_10001748 3300025913 Bacteria 34501
150 Ga0207695_10007277 3300025913 Bacteria 14136
151 Ga0207695_10022640 3300025913 Bacteria 7124
152 Ga0207671_10001184 3300025914 Bacteria 31016
153 Ga0207660_10001148 3300025917 Bacteria 17671
154 Ga0207660_10001455 3300025917 Bacteria 15902
155 Ga0207660_10004398 3300025917 Bacteria 9186
156 Ga0207660_10007940 3300025917 Bacteria 6864
157 Ga0207660_10012405 3300025917 Bacteria 5575
158 Ga0207657_10005512 3300025919 Bacteria 13212
159 Ga0207657_10005547 3300025919 Bacteria 13175
160 Ga0207657_10028735 3300025919 Bacteria 5068
161 Ga0207657_10030086 3300025919 Bacteria 4933
162 Ga0207657_10095570 3300025919 Bacteria 2472
163 Ga0207649_10000493 3300025920 Bacteria 28027
164 Ga0207649_10010189 3300025920 Bacteria 5161
165 Ga0207649_10036055 3300025920 Bacteria 2976
166 Ga0207649_10036821 3300025920 Bacteria 2950
167 Ga0207649_10045629 3300025920 Bacteria 2688
168 Ga0207652_10000030 3300025921 Bacteria 144884
169 Ga0207652_10000820 3300025921 Bacteria 29635
170 Ga0207652_10000846 3300025921 Bacteria 29174
171 Ga0207652_10001343 3300025921 Bacteria 21834
172 Ga0207652_10001614 3300025921 Bacteria 19816
173 Ga0207652_10001631 3300025921 Bacteria 19706
174 Ga0207652_10002369 3300025921 Bacteria 15935
175 Ga0207652_10067165 3300025921 Bacteria 3108
176 Ga0207694_10000559 3300025924 Bacteria 33677
177 Ga0207694_10004810 3300025924 Bacteria 10485
178 Ga0207690_10000327 3300025932 Bacteria 31748
179 Ga0207690_10000878 3300025932 Bacteria 19199
180 Ga0207691_10127731 3300025940 Bacteria 2248
181 Ga0207711_10003763 3300025941 Bacteria 13059
182 Ga0207661_10005841 3300025944 Bacteria 8683
183 Ga0207661_10008408 3300025944 Bacteria 7375
184 Ga0207661_10128814 3300025944 Bacteria 2164
185 Ga0207679_10067180 3300025945 Bacteria 2689
186 Ga0207667_10000634 3300025949 Bacteria 45497
187 Ga0207667_10000818 3300025949 Bacteria 40208
188 Ga0207667_10005607 3300025949 Bacteria 15316
189 Ga0207667_10010062 3300025949 Bacteria 11086
190 Ga0207667_10013287 3300025949 Bacteria 9431
191 Ga0207667_10017782 3300025949 Bacteria 7995
192 Ga0207667_10034921 3300025949 Bacteria 5397
193 Ga0207667_10074537 3300025949 Bacteria 3525
194 Ga0207712_10000600 3300025961 Bacteria 28673
195 Ga0207640_10000520 3300025981 Bacteria 23233
196 Ga0207640_10001662 3300025981 Bacteria 11932
197 Ga0207640_10001858 3300025981 Bacteria 11317
198 Ga0207640_10035122 3300025981 Bacteria 3135
199 Ga0207658_10000111 3300025986 Bacteria 89180
200 Ga0207658_10017720 3300025986 Bacteria 4909
201 Ga0207658_10165691 3300025986 Bacteria 1815
202 Ga0207677_10041477 3300026023 Bacteria 3044
203 Ga0207703_10268105 3300026035 Bacteria 1546
204 Ga0207639_10006418 3300026041 Bacteria 7994
205 Ga0207639_10011793 3300026041 Bacteria 6077
206 Ga0207639_10028359 3300026041 Bacteria 4086
207 Ga0207639_10106264 3300026041 Bacteria 2278
208 Ga0207678_10001607 3300026067 Bacteria 20786
209 Ga0207678_10003697 3300026067 Bacteria 13747
210 Ga0207678_10003892 3300026067 Bacteria 13425
211 Ga0207678_10014414 3300026067 Bacteria 6950
212 Ga0207678_10015604 3300026067 Bacteria 6679
213 Ga0207678_10041938 3300026067 Bacteria 3967
214 Ga0207678_10080456 3300026067 Bacteria 2790
215 Ga0207678_10100629 3300026067 Bacteria 2469
216 Ga0207702_10001094 3300026078 Bacteria 27736
217 Ga0207702_10030702 3300026078 Bacteria 4476
218 Ga0207641_10016805 3300026088 Bacteria 5992
219 Ga0207674_10006195 3300026116 Bacteria 14101
220 Ga0207674_10022125 3300026116 Bacteria 6834
221 Ga0207674_10042767 3300026116 Bacteria 4676
222 Ga0207674_10157596 3300026116 Bacteria 2225
223 Ga0207698_10000597 3300026142 Bacteria 21126
224 Ga0207698_10001254 3300026142 Bacteria 14828
225 Ga0207698_10005025 3300026142 Bacteria 8113
226 Ga0207698_10008313 3300026142 Bacteria 6555
227 Ga0207698_10384650 3300026142 Bacteria 1336
228 Ga0268266_10000001 3300028379 Bacteria 4040580
229 Ga0268266_10000043 3300028379 Bacteria 316604
230 Ga0268265_10001803 3300028380 Bacteria 17141
231 Ga0307412_10000686 3300031911 Bacteria 19583
232 Ga0307510_10000454 3300033180 Bacteria 39887
233 Ga0395899_0014996 3300037312 Bacteria 5912
234 Ga0395899_0143928 3300037312 Bacteria 1694
235 Ga0395900_0000033 3300037418 Bacteria 260271
236 Ga0395900_0003368 3300037418 Bacteria 17260
237 Ga0395898_0089130 3300037466 Bacteria 2969
238 Ga0395901_0004448 3300038443 Bacteria 14135
239 Ga0439436_0000059 3300041404 Bacteria 30728
240 Ga0439436_0039496 3300041404 Bacteria 1355
241 Ga0439465_0000593 3300041413 Bacteria 10952
242 Ga0451791_0677250 3300041451 Bacteria 4555
243 Ga0451793_0536422 3300041452 Bacteria 1432
244 Ga0451793_1693730 3300041452 Bacteria 2639
245 Ga0451800_0698893 3300041459 Bacteria 1903
246 Ga0451833_0100325 3300041491 Bacteria 2525
247 Ga0451837_0920784 3300041494 Bacteria 4731
248 Ga0451843_1112653 3300041509 Bacteria 1834
249 Ga0451853_2952463 3300041512 Bacteria 1437
250 Ga0450908_000386 3300042184 Bacteria 8488
251 Ga0439459_0010089 3300042438 Bacteria 1640
252 Ga0451577_0061725 3300042876 Bacteria 3342
253 Ga0466972_0001022 3300044658 Bacteria 13418
254 Ga0466982_0000311 3300044672 Bacteria 13456
255 Ga0466970_0000664 3300044765 Bacteria 16885
256 Ga0466957_0029828 3300044842 Bacteria 3255
257 Ga0466959_0064335 3300045049 Bacteria 2663
258 Ga0495617_000374 3300046452 Bacteria 24806
259 Ga0495617_003254 3300046452 Bacteria 6164
260 Ga0495638_0000075 3300046460 Bacteria 161068
261 Ga0495638_0000509 3300046460 Bacteria 45817
262 Ga0495638_0023072 3300046460 Bacteria 4076
263 Ga0495650_0006533 3300046471 Bacteria 7246
264 Ga0495584_0000799 3300046491 Bacteria 20746
265 Ga0495585_0000028 3300046492 Bacteria 146662
266 Ga0495585_0003940 3300046492 Bacteria 9818
267 Ga0495607_0000072 3300046501 Bacteria 100135
268 Ga0495607_0000275 3300046501 Bacteria 55331
269 Ga0495607_0090540 3300046501 Bacteria 1658
270 Ga0495583_0009474 3300046506 Bacteria 5812
271 Ga0495606_0001637 3300046507 Bacteria 29186
272 Ga0495606_0003290 3300046507 Bacteria 17288
273 Ga0495606_0006660 3300046507 Bacteria 10596
274 Ga0495606_0087498 3300046507 Bacteria 1923
275 Ga0495610_0000665 3300046512 Bacteria 33471
276 Ga0495610_0031587 3300046512 Bacteria 2761
277 Ga0495616_0000089 3300046513 Bacteria 77466
278 Ga0495616_0012808 3300046513 Bacteria 4745
279 Ga0495620_0000258 3300046515 Bacteria 39294
280 Ga0495620_0000381 3300046515 Bacteria 30173
281 Ga0495631_0000732 3300046518 Bacteria 21100
282 Ga0495631_0001272 3300046518 Bacteria 15542
283 Ga0495632_0000020 3300046519 Bacteria 210606
284 Ga0495643_0023875 3300046522 Bacteria 3472
285 Ga0495648_0002515 3300046524 Bacteria 16829
286 Ga0495648_0015592 3300046524 Bacteria 5511
287 Ga0495609_0003428 3300046538 Bacteria 9087
288 Ga0495622_0102696 3300046557 Bacteria 1310
289 Ga0495668_0007966 3300046616 Bacteria 6680
290 Ga0495611_0000001 3300046648 Bacteria 2628469
291 Ga0495611_0000114 3300046648 Bacteria 56705
292 Ga0495625_0000001 3300046660 Bacteria 1641829
293 Ga0495625_0023937 3300046660 Bacteria 4657
294 Ga0495625_0047291 3300046660 Bacteria 3103
295 Ga0495625_0085558 3300046660 Bacteria 2188
296 Ga0495661_0002622 3300046665 Bacteria 13777
297 Ga0495670_0000718 3300046691 Bacteria 15794
298 Ga0495671_0000683 3300046692 Bacteria 24539
299 Ga0495649_0023062 3300046694 Bacteria 3477
300 Ga0495589_0000120 3300046794 Bacteria 73521
301 Ga0495660_0000395 3300046810 Bacteria 37740
302 Ga0495660_0000667 3300046810 Bacteria 26462
303 Ga0495683_0005608 3300047323 Bacteria 6955
304 Ga0495679_000001 3300047446 Bacteria 1607568
305 Ga0495673_0000001 3300047469 Bacteria 1630730
306 Ga0495673_0000010 3300047469 Bacteria 709599
307 Ga0495673_0005916 3300047469 Bacteria 7297
308 Ga0495686_0000085 3300047472 Bacteria 198128
309 Ga0495686_0002593 3300047472 Bacteria 16796
310 Ga0495686_0003449 3300047472 Bacteria 13698
311 Ga0495686_0043591 3300047472 Bacteria 2843
312 Ga0496101_0009856 3300048904 Bacteria 6293
313 Ga0496102_0106052 3300048905 Bacteria 2615
314 Ga0496106_0002860 3300048909 Bacteria 12820
315 Ga0496115_0253631 3300048918 Bacteria 1448
316 Ga0496117_0018674 3300048920 Bacteria 5732
317 Ga0496117_0036326 3300048920 Bacteria 3688
318 Ga0496117_0057518 3300048920 Bacteria 2700
319 Ga0496118_0001524 3300048921 Bacteria 34491
320 Ga0496118_0001999 3300048921 Bacteria 28907
321 Ga0496118_0009239 3300048921 Bacteria 10008
322 Ga0496118_0047515 3300048921 Bacteria 3325
323 Ga0496119_0028086 3300048922 Bacteria 3849
324 Ga0496121_0000129 3300048924 Bacteria 168148
325 Ga0496121_0008944 3300048924 Bacteria 11623
326 Ga0496121_0012562 3300048924 Bacteria 9212
327 Ga0496121_0041380 3300048924 Bacteria 4027
328 Ga0496121_0095664 3300048924 Bacteria 2307
329 Ga0496121_0143409 3300048924 Bacteria 1768
330 Ga0496122_0000129 3300048925 Bacteria 173688
331 Ga0496122_0018266 3300048925 Bacteria 6492
332 Ga0496122_0054367 3300048925 Bacteria 3008
333 Ga0496123_0000113 3300048926 Bacteria 163689
334 Ga0496123_0015306 3300048926 Bacteria 6300
335 Ga0496123_0051750 3300048926 Bacteria 2732
336 Ga0496123_0086679 3300048926 Bacteria 1877
337 Ga0496124_0002625 3300048927 Bacteria 23145
338 Ga0496124_0003138 3300048927 Bacteria 20478
339 Ga0496124_0151301 3300048927 Bacteria 1820
340 Ga0496125_0016544 3300048928 Bacteria 7076
341 Ga0496126_0011159 3300048929 Bacteria 9325
342 Ga0495678_000180 3300049459 Bacteria 72870
343 Ga0495682_0003260 3300049460 Bacteria 7267
344 Ga0501031_0016832 3300049568 Bacteria 4747
345 Ga0501032_0005690 3300049569 Bacteria 9230
346 Ga0501032_0014382 3300049569 Bacteria 5605
347 Ga0501033_0001261 3300049570 Bacteria 22597
348 Ga0501033_0006756 3300049570 Bacteria 8960
349 Ga0501033_0012659 3300049570 Bacteria 6434
350 Ga0501034_0000996 3300049571 Bacteria 40586
351 Ga0501034_0004225 3300049571 Bacteria 16037
352 Ga0501034_0006908 3300049571 Bacteria 12130
353 Ga0501036_0003471 3300049572 Bacteria 12599
354 Ga0501036_0016802 3300049572 Bacteria 6113
355 Ga0501037_0004013 3300049573 Bacteria 10672
356 Ga0501037_0019046 3300049573 Bacteria 5060
357 Ga0501037_0029148 3300049573 Bacteria 4077
358 Ga0501037_0039584 3300049573 Bacteria 3470
359 Ga0501038_0011224 3300049574 Bacteria 8178
360 Ga0501038_0079766 3300049574 Bacteria 2759
361 Ga0501038_0094817 3300049574 Bacteria 2494
362 Ga0501039_0001920 3300049575 Bacteria 15395
363 Ga0501039_0021871 3300049575 Bacteria 4907
364 Ga0501039_0146210 3300049575 Bacteria 1857
365 Ga0501042_0007082 3300049578 Bacteria 7327
366 Ga0501043_0003663 3300049579 Bacteria 12617
367 Ga0501043_0009934 3300049579 Bacteria 7461
368 Ga0501043_0014324 3300049579 Bacteria 6205
369 Ga0501043_0082866 3300049579 Bacteria 2521
370 Ga0501046_0003806 3300049580 Bacteria 13803
371 Ga0501046_0019108 3300049580 Bacteria 5684
372 Ga0501046_0030144 3300049580 Bacteria 4403
373 Ga0501047_0003575 3300049581 Bacteria 14673
374 Ga0501047_0008082 3300049581 Bacteria 9926
375 Ga0501047_0037579 3300049581 Bacteria 4681
376 Ga0501047_0118175 3300049581 Bacteria 2533
377 Ga0501047_0216904 3300049581 Bacteria 1770
378 Ga0501048_0023270 3300049582 Bacteria 4531
379 Ga0501048_0030511 3300049582 Bacteria 3900
380 Ga0501067_0014176 3300049583 Bacteria 4415
381 Ga0501069_0001352 3300049585 Bacteria 12030
382 Ga0501069_0019860 3300049585 Bacteria 3635
383 Ga0501069_0043432 3300049585 Bacteria 2488
384 Ga0501070_0000105 3300049586 Bacteria 73931
385 Ga0501070_0003456 3300049586 Bacteria 13698
386 Ga0501070_0009646 3300049586 Bacteria 8160
387 Ga0501070_0010485 3300049586 Bacteria 7836
388 Ga0501070_0014707 3300049586 Bacteria 6583
389 Ga0501070_0016696 3300049586 Bacteria 6165
390 Ga0501070_0065097 3300049586 Bacteria 3018
391 Ga0501070_0071039 3300049586 Bacteria 2882
392 Ga0501070_0122508 3300049586 Bacteria 2149
393 Ga0501070_0369577 3300049586 Bacteria 1163
394 Ga0501071_0008642 3300049587 Bacteria 6733
395 Ga0501071_0026196 3300049587 Bacteria 4090
396 Ga0501071_0124498 3300049587 Bacteria 1912
397 Ga0501072_0022764 3300049588 Bacteria 4862
398 Ga0501073_0001778 3300049589 Bacteria 16022
399 Ga0501073_0006604 3300049589 Bacteria 8633
400 Ga0501073_0056625 3300049589 Bacteria 2742
401 Ga0501073_0067512 3300049589 Bacteria 2493
402 Ga0501073_0111284 3300049589 Bacteria 1899
403 Ga0501074_0000516 3300049590 Bacteria 23722
404 Ga0501074_0002080 3300049590 Bacteria 13835
405 Ga0501074_0008362 3300049590 Bacteria 7501
406 Ga0501074_0044213 3300049590 Bacteria 3225
407 Ga0501077_0026680 3300049593 Bacteria 3667
408 Ga0501079_0201173 3300049741 Bacteria 1556
409 Ga0501080_0001981 3300049742 Bacteria 17643
410 Ga0501080_0003935 3300049742 Bacteria 13149
411 Ga0501080_0012270 3300049742 Bacteria 7849
412 Ga0501080_0014585 3300049742 Bacteria 7239
413 Ga0501080_0055849 3300049742 Bacteria 3677
414 Ga0501080_0074216 3300049742 Bacteria 3164
415 Ga0501083_0013038 3300049744 Bacteria 5807
416 Ga0501083_0177828 3300049744 Bacteria 1390
417 Ga0501035_0010176 3300049822 Bacteria 8729
418 Ga0501035_0015634 3300049822 Bacteria 7005
419 Ga0501035_0017031 3300049822 Bacteria 6697
420 Ga0501035_0021075 3300049822 Bacteria 5992
421 Ga0501035_0035965 3300049822 Bacteria 4492
422 Ga0501044_0006698 3300049823 Bacteria 12705
423 Ga0501044_0008876 3300049823 Bacteria 10988
424 Ga0501044_0010138 3300049823 Bacteria 10240
425 Ga0501044_0011297 3300049823 Bacteria 9678
426 Ga0501044_0023997 3300049823 Bacteria 6480
427 Ga0501044_0036880 3300049823 Bacteria 5113
428 Ga0501044_0052391 3300049823 Bacteria 4205
429 Ga0501044_0095202 3300049823 Bacteria 3001
430 Ga0501044_0210580 3300049823 Bacteria 1898
431 Ga0501045_0017093 3300049824 Bacteria 5150
432 nmdc:mga0sz30_51648_c1 3300050516 Bacteria 1744
433 nmdc:mga0sz30_56447_c1 3300050516 Bacteria 1672
434 Ga0500610_0003179 3300053079 Bacteria 6250
435 Ga0500643_000080 3300053087 Bacteria 103235
436 Ga0500643_006055 3300053087 Bacteria 5112
437 Ga0500651_0000066 3300053093 Bacteria 69313
438 Ga0500651_0005514 3300053093 Bacteria 7229
439 Ga0500555_001068 3300053103 Bacteria 9212
440 Ga0500568_0001880 3300053139 Bacteria 12928
441 Ga0500633_0037876 3300053160 Bacteria 1603
442 Ga0500645_003771 3300053730 Bacteria 6036
443 Ga0501082_0043780 3300060353 Bacteria 3861
444 2595448400 2593339238 Bacteria 4182970
445 2595451701 2593339239 Bacteria 4124669
446 2721028214 2718218334 Bacteria 4765486
447 2735836290 2734482264 Unclassified 5014763
448 2739227655 2738543009 Bacteria 4944499
449 2819563516 2818991440 Bacteria 4774720
450 2842915385 2842914999 Bacteria 4419378
451 2842921706 2842918807 Bacteria 4289178
452 2884339957 2884338543 Bacteria 4610696
453 2904464174 2904463128 Bacteria 4775606
454 2919085968 2919085039 Bacteria 4532964
455 2919404778 2919404418 Bacteria 4232372
456 2941472328 2941471342 Bacteria 5018624
457 2953997720 2953994433 Bacteria 4303959
458 Ga0157372_10012045
459 JGI24741J21665_1000508
460 JGI24741J21665_1002123
461 JGI24740J21852_10000081
462 JGI24740J21852_10002090
463 Ga0006562J51391_1050537
464 Ga0065165_1000028
465 Ga0070658_10010731
466 Ga0070658_10114265
467 Ga0070683_100026310
468 Ga0070666_10000003
469 Ga0070666_10069848
470 Ga0070680_100000209
471 Ga0070680_100002696
472 Ga0070680_100015175
473 Ga0070680_100037724
474 Ga0070660_100081084
475 Ga0070691_10006882
476 Ga0070691_10012736
477 Ga0070691_10060046
478 Ga0070661_100009557
479 Ga0070661_100009838
480 Ga0070661_100069158
481 Ga0070661_100104867
482 Ga0070661_100112416
483 Ga0070692_10003232
484 Ga0070692_10006577
485 Ga0070692_10009325
486 Ga0070673_100379615
487 Ga0070667_100000173
488 Ga0070667_100008807
489 Ga0070667_100190929
490 Ga0070667_100282996
491 Ga0070663_100000433
492 Ga0070663_100015908
493 Ga0070663_100023286
494 Ga0070663_100187448
495 Ga0070662_100103912
496 Ga0070681_10000007
497 Ga0070681_10000397
498 Ga0070681_10001146
499 Ga0070681_10003054
500 Ga0070681_10007619
501 Ga0070679_100000412
502 Ga0070679_100004752
503 Ga0070679_100019076
504 Ga0070679_100094387
505 Ga0070684_100059656
506 Ga0068853_100000439
507 Ga0068853_100017370
508 Ga0068853_100039571
509 Ga0068853_100220291
510 Ga0068853_100228231
511 Ga0070696_100020716
512 Ga0070696_100172692
513 Ga0070693_100041423
514 Ga0070665_100000095
515 Ga0070665_100016693
516 Ga0070665_100089669
517 Ga0070665_100135651
518 Ga0068855_100001280
519 Ga0068855_100037409
520 Ga0068855_100119819
521 Ga0070664_100110949
522 Ga0070664_100110963
523 Ga0068857_100059269
524 Ga0068857_100238473
525 Ga0068854_100007759
526 Ga0068854_100060638
527 Ga0068856_100086758
528 Ga0068856_100293622
529 Ga0068852_100015996
530 Ga0068852_100076624
531 Ga0068852_100369324
532 Ga0068859_100000208
533 Ga0068863_100031233
534 Ga0068858_100143020
535 Ga0068858_100288130
536 Ga0068860_100093592
537 Ga0068862_100000707
538 Ga0097621_100017131
539 Ga0097620_100000208
540 Ga0105240_10178986
541 Ga0105240_10247216
542 Ga0105248_10004348
543 Ga0105237_10000345
544 Ga0105237_10220671
545 Ga0105238_10000186
546 Ga0105238_10007356
547 Ga0105249_10000175
548 Ga0105249_10005249
549 Ga0105239_10028102
550 Ga0105239_10081197
551 Ga0157373_10012677
552 Ga0157373_10015464
553 Ga0157373_10038026
554 Ga0157373_10049712
555 Ga0157371_10023393
556 Ga0157371_10042158
557 Ga0157370_10000124
558 Ga0157370_10007635
559 Ga0157370_10016867
560 Ga0157370_10027982
561 Ga0157369_10000406
562 Ga0163162_10000209
563 Ga0157372_10005109
564 Ga0157372_10038188
565 Ga0157372_10069936
566 Ga0157372_10197662
567 Ga0182008_10002192
568 Ga0157376_10105876
569 Ga0182006_1000367
570 Ga0182006_1000510
571 Ga0182007_10007807
572 Ga0182005_1000129
573 Ga0182005_1002462
574 Ga0163161_10003032
575 Ga0197907_10743544
576 Ga0206356_10588647
577 Ga0206356_10754312
578 Ga0206354_10319638
579 Ga0206354_10842667
580 Ga0206354_10850882
581 Ga0206353_10413362
582 Ga0206353_11387623
583 Ga0206353_11654005
584 Ga0154015_1063321
585 Ga0209674_100300
586 Ga0209129_1000194
587 Ga0207656_10057094
588 Ga0207680_10000006
589 Ga0207647_10000006
590 Ga0207647_10000229
591 Ga0207647_10015631
592 Ga0207705_10000128
593 Ga0207705_10001240
594 Ga0207705_10001241
595 Ga0207705_10001617
596 Ga0207705_10002071
597 Ga0207705_10010095
598 Ga0207705_10057153
599 Ga0207707_10000383
600 Ga0207707_10000665
601 Ga0207707_10001116
602 Ga0207707_10001756
603 Ga0207707_10003727
604 Ga0207707_10003792
605 Ga0207707_10007845
606 Ga0207695_10001748
607 Ga0207695_10007277
608 Ga0207695_10022640
609 Ga0207671_10001184
610 Ga0207660_10001148
611 Ga0207660_10001455
612 Ga0207660_10004398
613 Ga0207660_10007940
614 Ga0207660_10012405
615 Ga0207657_10005512
616 Ga0207657_10005547
617 Ga0207657_10028735
618 Ga0207657_10030086
619 Ga0207657_10095570
620 Ga0207649_10000493
621 Ga0207649_10010189
622 Ga0207649_10036055
623 Ga0207649_10036821
624 Ga0207649_10045629
625 Ga0207652_10000030
626 Ga0207652_10000820
627 Ga0207652_10000846
628 Ga0207652_10001343
629 Ga0207652_10001614
630 Ga0207652_10001631
631 Ga0207652_10002369
632 Ga0207652_10067165
633 Ga0207694_10000559
634 Ga0207694_10004810
635 Ga0207690_10000327
636 Ga0207690_10000878
637 Ga0207691_10127731
638 Ga0207711_10003763
639 Ga0207661_10005841
640 Ga0207661_10008408
641 Ga0207661_10128814
642 Ga0207679_10067180
643 Ga0207667_10000634
644 Ga0207667_10000818
645 Ga0207667_10005607
646 Ga0207667_10010062
647 Ga0207667_10013287
648 Ga0207667_10017782
649 Ga0207667_10034921
650 Ga0207667_10074537
651 Ga0207712_10000600
652 Ga0207640_10000520
653 Ga0207640_10001662
654 Ga0207640_10001858
655 Ga0207640_10035122
656 Ga0207658_10000111
657 Ga0207658_10017720
658 Ga0207658_10165691
659 Ga0207677_10041477
660 Ga0207703_10268105
661 Ga0207639_10006418
662 Ga0207639_10011793
663 Ga0207639_10028359
664 Ga0207639_10106264
665 Ga0207678_10001607
666 Ga0207678_10003697
667 Ga0207678_10003892
668 Ga0207678_10014414
669 Ga0207678_10015604
670 Ga0207678_10041938
671 Ga0207678_10080456
672 Ga0207678_10100629
673 Ga0207702_10001094
674 Ga0207702_10030702
675 Ga0207641_10016805
676 Ga0207674_10006195
677 Ga0207674_10022125
678 Ga0207674_10042767
679 Ga0207674_10157596
680 Ga0207698_10000597
681 Ga0207698_10001254
682 Ga0207698_10005025
683 Ga0207698_10008313
684 Ga0207698_10384650
685 Ga0268266_10000001
686 Ga0268266_10000043
687 Ga0268265_10001803
688 Ga0307412_10000686
689 Ga0307510_10000454
690 Ga0395899_0014996
691 Ga0395899_0143928
692 Ga0395900_0000033
693 Ga0395900_0003368
694 Ga0395898_0089130
695 Ga0395901_0004448
696 Ga0439436_0000059
697 Ga0439436_0039496
698 Ga0439465_0000593
699 Ga0451791_0677250
700 Ga0451793_0536422
701 Ga0451793_1693730
702 Ga0451800_0698893
703 Ga0451833_0100325
704 Ga0451837_0920784
705 Ga0451843_1112653
706 Ga0451853_2952463
707 Ga0450908_000386
708 Ga0439459_0010089
709 Ga0451577_0061725
710 Ga0466972_0001022
711 Ga0466982_0000311
712 Ga0466970_0000664
713 Ga0466957_0029828
714 Ga0466959_0064335
715 Ga0495617_000374
716 Ga0495617_003254
717 Ga0495638_0000075
718 Ga0495638_0000509
719 Ga0495638_0023072
720 Ga0495650_0006533
721 Ga0495584_0000799
722 Ga0495585_0000028
723 Ga0495585_0003940
724 Ga0495607_0000072
725 Ga0495607_0000275
726 Ga0495607_0090540
727 Ga0495583_0009474
728 Ga0495606_0001637
729 Ga0495606_0003290
730 Ga0495606_0006660
731 Ga0495606_0087498
732 Ga0495610_0000665
733 Ga0495610_0031587
734 Ga0495616_0000089
735 Ga0495616_0012808
736 Ga0495620_0000258
737 Ga0495620_0000381
738 Ga0495631_0000732
739 Ga0495631_0001272
740 Ga0495632_0000020
741 Ga0495643_0023875
742 Ga0495648_0002515
743 Ga0495648_0015592
744 Ga0495609_0003428
745 Ga0495622_0102696
746 Ga0495668_0007966
747 Ga0495611_0000001
748 Ga0495611_0000114
749 Ga0495625_0000001
750 Ga0495625_0023937
751 Ga0495625_0047291
752 Ga0495625_0085558
753 Ga0495661_0002622
754 Ga0495670_0000718
755 Ga0495671_0000683
756 Ga0495649_0023062
757 Ga0495589_0000120
758 Ga0495660_0000395
759 Ga0495660_0000667
760 Ga0495683_0005608
761 Ga0495679_000001
762 Ga0495673_0000001
763 Ga0495673_0000010
764 Ga0495673_0005916
765 Ga0495686_0000085
766 Ga0495686_0002593
767 Ga0495686_0003449
768 Ga0495686_0043591
769 Ga0496101_0009856
770 Ga0496102_0106052
771 Ga0496106_0002860
772 Ga0496115_0253631
773 Ga0496117_0018674
774 Ga0496117_0036326
775 Ga0496117_0057518
776 Ga0496118_0001524
777 Ga0496118_0001999
778 Ga0496118_0009239
779 Ga0496118_0047515
780 Ga0496119_0028086
781 Ga0496121_0000129
782 Ga0496121_0008944
783 Ga0496121_0012562
784 Ga0496121_0041380
785 Ga0496121_0095664
786 Ga0496121_0143409
787 Ga0496122_0000129
788 Ga0496122_0018266
789 Ga0496122_0054367
790 Ga0496123_0000113
791 Ga0496123_0015306
792 Ga0496123_0051750
793 Ga0496123_0086679
794 Ga0496124_0002625
795 Ga0496124_0003138
796 Ga0496124_0151301
797 Ga0496125_0016544
798 Ga0496126_0011159
799 Ga0495678_000180
800 Ga0495682_0003260
801 Ga0501031_0016832
802 Ga0501032_0005690
803 Ga0501032_0014382
804 Ga0501033_0001261
805 Ga0501033_0006756
806 Ga0501033_0012659
807 Ga0501034_0000996
808 Ga0501034_0004225
809 Ga0501034_0006908
810 Ga0501036_0003471
811 Ga0501036_0016802
812 Ga0501037_0004013
813 Ga0501037_0019046
814 Ga0501037_0029148
815 Ga0501037_0039584
816 Ga0501038_0011224
817 Ga0501038_0079766
818 Ga0501038_0094817
819 Ga0501039_0001920
820 Ga0501039_0021871
821 Ga0501039_0146210
822 Ga0501042_0007082
823 Ga0501043_0003663
824 Ga0501043_0009934
825 Ga0501043_0014324
826 Ga0501043_0082866
827 Ga0501046_0003806
828 Ga0501046_0019108
829 Ga0501046_0030144
830 Ga0501047_0003575
831 Ga0501047_0008082
832 Ga0501047_0037579
833 Ga0501047_0118175
834 Ga0501047_0216904
835 Ga0501048_0023270
836 Ga0501048_0030511
837 Ga0501067_0014176
838 Ga0501069_0001352
839 Ga0501069_0019860
840 Ga0501069_0043432
841 Ga0501070_0000105
842 Ga0501070_0003456
843 Ga0501070_0009646
844 Ga0501070_0010485
845 Ga0501070_0014707
846 Ga0501070_0016696
847 Ga0501070_0065097
848 Ga0501070_0071039
849 Ga0501070_0122508
850 Ga0501070_0369577
851 Ga0501071_0008642
852 Ga0501071_0026196
853 Ga0501071_0124498
854 Ga0501072_0022764
855 Ga0501073_0001778
856 Ga0501073_0006604
857 Ga0501073_0056625
858 Ga0501073_0067512
859 Ga0501073_0111284
860 Ga0501074_0000516
861 Ga0501074_0002080
862 Ga0501074_0008362
863 Ga0501074_0044213
864 Ga0501077_0026680
865 Ga0501079_0201173
866 Ga0501080_0001981
867 Ga0501080_0003935
868 Ga0501080_0012270
869 Ga0501080_0014585
870 Ga0501080_0055849
871 Ga0501080_0074216
872 Ga0501083_0013038
873 Ga0501083_0177828
874 Ga0501035_0010176
875 Ga0501035_0015634
876 Ga0501035_0017031
877 Ga0501035_0021075
878 Ga0501035_0035965
879 Ga0501044_0006698
880 Ga0501044_0008876
881 Ga0501044_0010138
882 Ga0501044_0011297
883 Ga0501044_0023997
884 Ga0501044_0036880
885 Ga0501044_0052391
886 Ga0501044_0095202
887 Ga0501044_0210580
888 Ga0501045_0017093
889 nmdc:mga0sz30_51648_c1
890 nmdc:mga0sz30_56447_c1
891 Ga0500610_0003179
892 Ga0500643_000080
893 Ga0500643_006055
894 Ga0500651_0000066
895 Ga0500651_0005514
896 Ga0500555_001068
897 Ga0500568_0001880
898 Ga0500633_0037876
899 Ga0500645_003771
900 Ga0501082_0043780
901 2595448400
902 2595451701
903 2721028214
904 2735836290
905 2739227655
906 2819563516
907 2842915385
908 2842921706
909 2884339957
910 2904464174
911 2919085968
912 2919404778
913 2941472328
914 2953997720

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

54

387

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r5z-assembly2.cif.gz_D crystal structure of rv3772 encoded aminotransferase 0.9471 2 312
3ffh-assembly1.cif.gz_B the crystal structure of histidinol-phosphate aminotransferase from listeria innocua clip11262. 0.9416 10 312
3ly1-assembly1.cif.gz_B crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution 0.9352 2 312
3get-assembly1.cif.gz_A crystal structure of putative histidinol-phosphate aminotransferase (np_281508.1) from campylobacter jejuni at 2.01 a resolution 0.9306 2 312
4wbt-assembly2.cif.gz_B-3 crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate 0.9294 2 313
ID Description Score Start End Superfamily
af_Q2G087_68_261_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9689 20 218 3.40.640.10
af_Q2G087_68_261_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9543 20 218 3.40.640.10
4r5zC02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.952 2 222 3.40.640.10
af_P9WML5_24_353_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.95 2 312 3.50.50.60
3ffhA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9409 13 222 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A522RIB0-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9904 211 313 GO:0008483
GO:0009058
GO:0030170
AF-A0A1I6H5W0-F1-model_v4 Histidinol-phosphate aminotransferase (EC 2.6.1.9) (Imidazole acetol-phosphate transaminase) 0.981 2 312 GO:0000105
GO:0004400
GO:0030170
AF-A0A522RIB0-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.981 211 313 GO:0008483
GO:0009058
GO:0030170
AF-A0A7C7SAE3-F1-model_v4 deleted 0.9802 2 312
AF-A0A2D7S3X9-F1-model_v4 Histidinol-phosphate aminotransferase (EC 2.6.1.9) (Imidazole acetol-phosphate transaminase) 0.9769 8 312 GO:0000105
GO:0004400
GO:0030170

Map