F447979

General Info

Members Datasets Scaffolds Average Seq Length
457 211 914 224

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10093304|Ga0114129_100933045
Length 254
Sequence MAFIEVAGLSKSYPAAEATARSRAKDRSTLGRVLRRRGPRPPGAEQGPVVSVLRGLDLTLERGDMIAIVGASGVGKSTLLHVLGGLDSIDSGSIRIGDTDIGRLSDGALVAFRNRHVGFVFQFHHLLPEFTALENAEMPMRIARRPPADRREHATQLLQRVGLGERLEHRPGMLSGGEQQRVAIARALVMNPTVLLADEPTGDLDEHTAETLHDLLREMHREHGLTSIIATHNPRLAAACDRVLRLEEGRLRES

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
145 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
146 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
147 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
148 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
149 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
150 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
151 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
152 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
164 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
196 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.6
Nodule 0
Rhizoplane 1.75
Rhizosphere 93.65
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10093304 3300009147 Bacteria 4170
2 Ga0065712_10073344 3300005290 Bacteria 4422
3 Ga0065712_10075394 3300005290 Bacteria 3848
4 Ga0065712_10245453 3300005290 Bacteria 973
5 Ga0065715_10007153 3300005293 Bacteria 3149
6 Ga0065715_10010037 3300005293 Bacteria 2479
7 Ga0065715_10108527 3300005293 Bacteria 2714
8 Ga0065715_10128111 3300005293 Bacteria 2067
9 Ga0065707_10000733 3300005295 Bacteria 28954
10 Ga0065707_10055312 3300005295 Bacteria 903
11 Ga0065707_10316050 3300005295 Bacteria 975
12 Ga0070683_100005427 3300005329 Bacteria 10650
13 Ga0070670_100009909 3300005331 Bacteria 8137
14 Ga0070670_100029940 3300005331 Bacteria 4687
15 Ga0070670_100047580 3300005331 Bacteria 3691
16 Ga0070670_100152595 3300005331 Bacteria 2000
17 Ga0070670_100319239 3300005331 Bacteria 1361
18 Ga0070677_10146776 3300005333 Bacteria 1094
19 Ga0068869_100046674 3300005334 Bacteria 3124
20 Ga0068869_100560475 3300005334 Bacteria 961
21 Ga0070666_10065931 3300005335 Bacteria 2457
22 Ga0068868_100055737 3300005338 Bacteria 3120
23 Ga0068868_100124512 3300005338 Bacteria 2104
24 Ga0070689_100021373 3300005340 Bacteria 4817
25 Ga0070689_100129616 3300005340 Bacteria 2022
26 Ga0070687_100047077 3300005343 Bacteria 2210
27 Ga0070661_100731052 3300005344 Bacteria 808
28 Ga0070668_100155016 3300005347 Bacteria 1855
29 Ga0070669_100143509 3300005353 Bacteria 1843
30 Ga0070669_100190192 3300005353 Bacteria 1610
31 Ga0070669_100226454 3300005353 Bacteria 1480
32 Ga0070669_100706469 3300005353 Bacteria 852
33 Ga0070669_100795130 3300005353 Bacteria 804
34 Ga0070675_100105668 3300005354 Bacteria 2376
35 Ga0070675_100716816 3300005354 Bacteria 912
36 Ga0070675_100848512 3300005354 Bacteria 836
37 Ga0070671_100057249 3300005355 Bacteria 3244
38 Ga0070671_100183100 3300005355 Bacteria 1774
39 Ga0070674_100019663 3300005356 Bacteria 4294
40 Ga0070674_100332708 3300005356 Bacteria 1221
41 Ga0070673_100000530 3300005364 Bacteria 20544
42 Ga0070673_100116147 3300005364 Bacteria 2226
43 Ga0070673_100337333 3300005364 Bacteria 1335
44 Ga0070688_100283152 3300005365 Bacteria 1192
45 Ga0070688_100631726 3300005365 Bacteria 823
46 Ga0070659_100032407 3300005366 Bacteria 4053
47 Ga0070659_100152101 3300005366 Bacteria 1888
48 Ga0070659_100269699 3300005366 Bacteria 1414
49 Ga0070667_100735808 3300005367 Bacteria 914
50 Ga0070705_100092631 3300005440 Bacteria 1887
51 Ga0070700_100389620 3300005441 Bacteria 1044
52 Ga0070694_100066327 3300005444 Bacteria 2476
53 Ga0070663_100738518 3300005455 Bacteria 839
54 Ga0070678_100512535 3300005456 Bacteria 1060
55 Ga0070678_100595703 3300005456 Bacteria 986
56 Ga0070678_100928407 3300005456 Bacteria 797
57 Ga0070662_100320370 3300005457 Bacteria 1264
58 Ga0070681_10271894 3300005458 Bacteria 1606
59 Ga0070685_10226194 3300005466 Bacteria 1228
60 Ga0070685_10509081 3300005466 Bacteria 853
61 Ga0070706_100153042 3300005467 Bacteria 2153
62 Ga0070706_100893277 3300005467 Bacteria 821
63 Ga0070707_100067366 3300005468 Bacteria 3444
64 Ga0070707_100628010 3300005468 Bacteria 1037
65 Ga0070698_100116148 3300005471 Bacteria 2640
66 Ga0070699_100091859 3300005518 Bacteria 2654
67 Ga0070699_100108348 3300005518 Bacteria 2438
68 Ga0070679_100382810 3300005530 Bacteria 1353
69 Ga0070684_100703437 3300005535 Bacteria 942
70 Ga0070697_100138018 3300005536 Bacteria 2049
71 Ga0070672_100007131 3300005543 Bacteria 7560
72 Ga0070672_100181540 3300005543 Bacteria 1754
73 Ga0070672_100287372 3300005543 Bacteria 1392
74 Ga0070686_100126370 3300005544 Bacteria 1762
75 Ga0070696_100286997 3300005546 Bacteria 1256
76 Ga0070693_100018764 3300005547 Bacteria 3617
77 Ga0070665_100090787 3300005548 Bacteria 3061
78 Ga0070665_100219955 3300005548 Bacteria 1899
79 Ga0070704_100053018 3300005549 Bacteria 2865
80 Ga0070704_100057887 3300005549 Bacteria 2758
81 Ga0070704_100094039 3300005549 Bacteria 2242
82 Ga0070702_100316661 3300005615 Bacteria 1085
83 Ga0068859_100910155 3300005617 Bacteria 964
84 Ga0068864_100364625 3300005618 Bacteria 1366
85 Ga0068866_10047634 3300005718 Bacteria 2162
86 Ga0068866_10486263 3300005718 Bacteria 814
87 Ga0068861_100028454 3300005719 Bacteria 4078
88 Ga0068861_100710835 3300005719 Bacteria 935
89 Ga0068863_100162091 3300005841 Bacteria 2143
90 Ga0068863_100190475 3300005841 Bacteria 1971
91 Ga0068858_100064790 3300005842 Bacteria 3382
92 Ga0068860_100193231 3300005843 Bacteria 1970
93 Ga0068860_100586193 3300005843 Bacteria 1120
94 Ga0068862_100103200 3300005844 Bacteria 2497
95 Ga0068862_100222377 3300005844 Bacteria 1710
96 Ga0068862_100299216 3300005844 Bacteria 1480
97 Ga0068862_100464766 3300005844 Bacteria 1195
98 Ga0068862_100616421 3300005844 Bacteria 1043
99 Ga0068862_101134404 3300005844 Bacteria 778
100 Ga0081455_10039169 3300005937 Bacteria 4191
101 Ga0075365_10217823 3300006038 Bacteria 1339
102 Ga0075364_10003997 3300006051 Bacteria 8465
103 Ga0075364_10067868 3300006051 Bacteria 2345
104 Ga0070716_100376134 3300006173 Bacteria 1014
105 Ga0075362_10005384 3300006177 Bacteria 4678
106 Ga0075367_10004497 3300006178 Bacteria 6817
107 Ga0075367_10004903 3300006178 Bacteria 6592
108 Ga0075367_10467245 3300006178 Bacteria 800
109 Ga0075366_10008953 3300006195 Bacteria 5580
110 Ga0075366_10028923 3300006195 Bacteria 3254
111 Ga0075366_10065604 3300006195 Bacteria 2159
112 Ga0097621_100009398 3300006237 Bacteria 7095
113 Ga0068871_100042515 3300006358 Bacteria 3648
114 Ga0068871_100878569 3300006358 Bacteria 830
115 Ga0075428_100476955 3300006844 Bacteria 1335
116 Ga0075428_100625742 3300006844 Bacteria 1149
117 Ga0075430_100028705 3300006846 Bacteria 4724
118 Ga0075430_100066521 3300006846 Bacteria 3026
119 Ga0075430_100165929 3300006846 Bacteria 1837
120 Ga0075430_100368582 3300006846 Bacteria 1186
121 Ga0075431_100020217 3300006847 Bacteria 6801
122 Ga0075431_100165803 3300006847 Bacteria 2271
123 Ga0075431_100462628 3300006847 Bacteria 1263
124 Ga0075433_10001292 3300006852 Bacteria 18326
125 Ga0075433_10012944 3300006852 Bacteria 6762
126 Ga0075433_10536169 3300006852 Bacteria 1029
127 Ga0075434_100002212 3300006871 Bacteria 16962
128 Ga0075434_100052546 3300006871 Bacteria 4049
129 Ga0075434_100402591 3300006871 Bacteria 1390
130 Ga0075434_100543207 3300006871 Bacteria 1182
131 Ga0075429_100093409 3300006880 Bacteria 2624
132 Ga0075429_100108352 3300006880 Bacteria 2428
133 Ga0075429_100255842 3300006880 Bacteria 1533
134 Ga0068865_100190547 3300006881 Bacteria 1585
135 Ga0097620_100910049 3300006931 Bacteria 964
136 Ga0075435_100001214 3300007076 Bacteria 16502
137 Ga0075435_100001367 3300007076 Bacteria 15741
138 Ga0075435_100138387 3300007076 Bacteria 2041
139 Ga0075435_100296692 3300007076 Bacteria 1382
140 Ga0075435_100359345 3300007076 Bacteria 1249
141 Ga0075435_100362223 3300007076 Bacteria 1244
142 Ga0105240_10113774 3300009093 Bacteria 3270
143 Ga0105240_10500152 3300009093 Bacteria 1352
144 Ga0111539_10001033 3300009094 Bacteria 36485
145 Ga0111539_10001074 3300009094 Bacteria 36076
146 Ga0111539_10001197 3300009094 Bacteria 34523
147 Ga0111539_10030996 3300009094 Bacteria 6497
148 Ga0111539_10036826 3300009094 Bacteria 5912
149 Ga0111539_10089057 3300009094 Bacteria 3626
150 Ga0111539_10090540 3300009094 Bacteria 3595
151 Ga0111539_10097829 3300009094 Bacteria 3447
152 Ga0111539_10103532 3300009094 Bacteria 3341
153 Ga0111539_10736478 3300009094 Bacteria 1147
154 Ga0105245_10042549 3300009098 Bacteria 4053
155 Ga0105245_10148725 3300009098 Bacteria 2213
156 Ga0105245_10427142 3300009098 Bacteria 1329
157 Ga0114129_10013048 3300009147 Bacteria 11835
158 Ga0114129_10030759 3300009147 Bacteria 7592
159 Ga0114129_10033542 3300009147 Bacteria 7255
160 Ga0114129_10127178 3300009147 Bacteria 3503
161 Ga0114129_10208320 3300009147 Bacteria 2645
162 Ga0114129_10352006 3300009147 Bacteria 1951
163 Ga0114129_10603879 3300009147 Bacteria 1421
164 Ga0105243_10073210 3300009148 Bacteria 2775
165 Ga0105242_10020391 3300009176 Bacteria 5197
166 Ga0105242_10117021 3300009176 Bacteria 2281
167 Ga0105242_10373564 3300009176 Bacteria 1323
168 Ga0105242_10667243 3300009176 Bacteria 1013
169 Ga0105248_10051837 3300009177 Bacteria 4604
170 Ga0105248_10128781 3300009177 Bacteria 2855
171 Ga0105248_10131051 3300009177 Bacteria 2829
172 Ga0105248_10429300 3300009177 Bacteria 1488
173 Ga0105248_10438712 3300009177 Bacteria 1471
174 Ga0105248_10554978 3300009177 Bacteria 1296
175 Ga0105248_10572707 3300009177 Bacteria 1274
176 Ga0105238_10124370 3300009551 Bacteria 2558
177 Ga0105249_10225800 3300009553 Bacteria 1845
178 Ga0105249_10939769 3300009553 Bacteria 932
179 Ga0105249_11026719 3300009553 Bacteria 894
180 Ga0105239_11023793 3300010375 Bacteria 950
181 Ga0105246_10649146 3300011119 Bacteria 918
182 Ga0157369_10409278 3300013105 Bacteria 1407
183 Ga0157374_10631436 3300013296 Bacteria 1082
184 Ga0163162_10500471 3300013306 Bacteria 1345
185 Ga0157372_10158349 3300013307 Bacteria 2616
186 Ga0157375_10087995 3300013308 Bacteria 3160
187 Ga0157375_10146088 3300013308 Bacteria 2496
188 Ga0163163_10032930 3300014325 Bacteria 5009
189 Ga0163163_11321038 3300014325 Bacteria 783
190 Ga0157380_10026251 3300014326 Bacteria 4422
191 Ga0157380_10078736 3300014326 Bacteria 2690
192 Ga0157380_10099893 3300014326 Bacteria 2414
193 Ga0157380_10357117 3300014326 Bacteria 1370
194 Ga0157379_10220577 3300014968 Bacteria 1718
195 Ga0157379_10513311 3300014968 Bacteria 1112
196 Ga0157376_10049889 3300014969 Bacteria 3469
197 Ga0157376_10155028 3300014969 Bacteria 2070
198 Ga0157376_10229922 3300014969 Bacteria 1722
199 Ga0207697_10000351 3300025315 Bacteria 25735
200 Ga0207642_10038993 3300025899 Bacteria 2060
201 Ga0207688_10010691 3300025901 Bacteria 4994
202 Ga0207688_10188825 3300025901 Bacteria 1231
203 Ga0207680_10073005 3300025903 Bacteria 2132
204 Ga0207645_10099793 3300025907 Bacteria 1872
205 Ga0207645_10146882 3300025907 Bacteria 1537
206 Ga0207705_10445443 3300025909 Bacteria 1004
207 Ga0207684_10735777 3300025910 Bacteria 837
208 Ga0207707_10333967 3300025912 Bacteria 1307
209 Ga0207707_10424829 3300025912 Bacteria 1139
210 Ga0207662_10005872 3300025918 Bacteria 6582
211 Ga0207662_10241286 3300025918 Bacteria 1183
212 Ga0207652_10768651 3300025921 Bacteria 857
213 Ga0207681_10058112 3300025923 Bacteria 2647
214 Ga0207681_10178729 3300025923 Bacteria 1615
215 Ga0207681_10196223 3300025923 Bacteria 1547
216 Ga0207681_10365704 3300025923 Bacteria 1158
217 Ga0207681_10756447 3300025923 Bacteria 810
218 Ga0207694_10191630 3300025924 Bacteria 1661
219 Ga0207650_10033553 3300025925 Bacteria 3718
220 Ga0207659_10100397 3300025926 Bacteria 2180
221 Ga0207659_10129810 3300025926 Bacteria 1943
222 Ga0207659_10250853 3300025926 Bacteria 1436
223 Ga0207687_10132844 3300025927 Bacteria 1879
224 Ga0207644_10066888 3300025931 Bacteria 2618
225 Ga0207690_10223469 3300025932 Bacteria 1442
226 Ga0207686_10056435 3300025934 Bacteria 2468
227 Ga0207686_10117878 3300025934 Bacteria 1802
228 Ga0207686_10122124 3300025934 Bacteria 1774
229 Ga0207686_10316952 3300025934 Bacteria 1164
230 Ga0207709_10149262 3300025935 Bacteria 1617
231 Ga0207670_10065974 3300025936 Bacteria 2485
232 Ga0207670_10172933 3300025936 Bacteria 1621
233 Ga0207669_10265562 3300025937 Bacteria 1286
234 Ga0207669_10831864 3300025937 Bacteria 767
235 Ga0207704_10141651 3300025938 Bacteria 1683
236 Ga0207691_10015944 3300025940 Bacteria 7138
237 Ga0207691_10065005 3300025940 Bacteria 3303
238 Ga0207691_10294394 3300025940 Bacteria 1395
239 Ga0207711_10120445 3300025941 Bacteria 2342
240 Ga0207711_10147592 3300025941 Bacteria 2120
241 Ga0207711_10556099 3300025941 Bacteria 1070
242 Ga0207689_10069002 3300025942 Bacteria 2905
243 Ga0207689_10086852 3300025942 Bacteria 2570
244 Ga0207661_10001781 3300025944 Bacteria 14728
245 Ga0207661_10353085 3300025944 Bacteria 1327
246 Ga0207679_10288576 3300025945 Bacteria 1410
247 Ga0207667_10764487 3300025949 Bacteria 965
248 Ga0207651_10011333 3300025960 Bacteria 4987
249 Ga0207651_10092510 3300025960 Bacteria 2218
250 Ga0207651_10481861 3300025960 Bacteria 1069
251 Ga0207651_10674028 3300025960 Bacteria 909
252 Ga0207677_10057323 3300026023 Bacteria 2674
253 Ga0207677_10087284 3300026023 Bacteria 2258
254 Ga0207677_10382068 3300026023 Bacteria 1189
255 Ga0207677_10593147 3300026023 Bacteria 971
256 Ga0207703_10145430 3300026035 Bacteria 2061
257 Ga0207708_10250109 3300026075 Bacteria 1428
258 Ga0207641_10092570 3300026088 Bacteria 2648
259 Ga0207641_10180718 3300026088 Bacteria 1932
260 Ga0207641_10212925 3300026088 Bacteria 1788
261 Ga0207641_10342097 3300026088 Bacteria 1424
262 Ga0207641_10882223 3300026088 Bacteria 888
263 Ga0207648_10013129 3300026089 Bacteria 7721
264 Ga0207648_10022969 3300026089 Bacteria 5593
265 Ga0207674_10005749 3300026116 Bacteria 14716
266 Ga0207675_100030794 3300026118 Bacteria 4997
267 Ga0207675_100273806 3300026118 Bacteria 1639
268 Ga0207675_100474138 3300026118 Bacteria 1243
269 Ga0207675_100904766 3300026118 Bacteria 899
270 Ga0207683_10065233 3300026121 Bacteria 3210
271 Ga0207683_10087354 3300026121 Bacteria 2773
272 Ga0207683_10153269 3300026121 Bacteria 2080
273 Ga0207683_10387050 3300026121 Bacteria 1286
274 Ga0207698_10582342 3300026142 Bacteria 1101
275 Ga0207698_10670213 3300026142 Bacteria 1029
276 Ga0207428_10005489 3300027907 Bacteria 11818
277 Ga0207428_10018980 3300027907 Bacteria 5863
278 Ga0207428_10082888 3300027907 Bacteria 2502
279 Ga0207428_10086377 3300027907 Bacteria 2442
280 Ga0268266_10069510 3300028379 Bacteria 3051
281 Ga0268266_10279490 3300028379 Bacteria 1552
282 Ga0268265_10659335 3300028380 Bacteria 1007
283 Ga0307408_100219060 3300031548 Bacteria 1552
284 Ga0307405_10516730 3300031731 Bacteria 960
285 Ga0307405_10717429 3300031731 Bacteria 830
286 Ga0307407_10475285 3300031903 Bacteria 912
287 Ga0307412_10083549 3300031911 Bacteria 2214
288 Ga0307412_10121536 3300031911 Bacteria 1881
289 Ga0307412_10259845 3300031911 Bacteria 1353
290 Ga0307409_100070685 3300031995 Bacteria 2772
291 Ga0307409_100933147 3300031995 Bacteria 883
292 Ga0307416_100078425 3300032002 Bacteria 2779
293 Ga0307416_100184787 3300032002 Bacteria 1958
294 Ga0307416_100307350 3300032002 Bacteria 1580
295 Ga0307411_10167923 3300032005 Bacteria 1651
296 Ga0307411_10259734 3300032005 Bacteria 1371
297 Ga0307411_10340937 3300032005 Bacteria 1218
298 Ga0307411_10518640 3300032005 Bacteria 1011
299 Ga0307415_100562720 3300032126 Bacteria 1008
300 Ga0307415_100783959 3300032126 Bacteria 868
301 Ga0373943_0023324 3300035170 Bacteria 2877
302 Ga0373935_0344761 3300035692 Bacteria 1061
303 Ga0373947_0392472 3300035725 Bacteria 935
304 Ga0373925_0572992 3300037068 Bacteria 929
305 Ga0395905_0884474 3300037471 Bacteria 796
306 Ga0439453_0002385 3300041408 Bacteria 2585
307 Ga0451807_0783981 3300041486 Bacteria 1130
308 Ga0439433_0093800 3300041999 Bacteria 740
309 Ga0439449_0079513 3300042007 Bacteria 1209
310 Ga0439455_0089456 3300042012 Bacteria 843
311 Ga0450896_016505 3300042133 Bacteria 1061
312 Ga0439434_0087266 3300042435 Bacteria 995
313 Ga0439435_0013298 3300042436 Bacteria 2010
314 Ga0439435_0042164 3300042436 Bacteria 1280
315 Ga0439460_0062693 3300042461 Bacteria 1138
316 Ga0451577_0002220 3300042876 Bacteria 23636
317 Ga0453684_0014387 3300044712 Bacteria 12665
318 Ga0466957_0499674 3300044842 Bacteria 843
319 Ga0451576_0059754 3300045051 Bacteria 3979
320 Ga0495603_0111491 3300046455 Bacteria 1596
321 Ga0495629_0161804 3300046459 Bacteria 1555
322 Ga0495638_0004530 3300046460 Bacteria 10528
323 Ga0495628_0045506 3300046516 Bacteria 3489
324 Ga0495644_0218223 3300046523 Bacteria 737
325 Ga0495666_0201421 3300046526 Bacteria 915
326 Ga0495659_0274051 3300046664 Bacteria 708
327 Ga0495669_0003095 3300046684 Bacteria 6842
328 Ga0496108_0105316 3300048911 Bacteria 2408
329 Ga0496110_0095231 3300048913 Bacteria 2666
330 Ga0496112_0021138 3300048915 Bacteria 6184
331 Ga0496112_0615748 3300048915 Bacteria 1017
332 Ga0496114_0064776 3300048917 Bacteria 3062
333 Ga0496114_0107916 3300048917 Bacteria 2383
334 Ga0496114_0156815 3300048917 Bacteria 1977
335 Ga0501031_0054979 3300049568 Bacteria 2594
336 Ga0501032_0218492 3300049569 Bacteria 1241
337 Ga0501033_0018540 3300049570 Bacteria 5260
338 Ga0501036_0017329 3300049572 Bacteria 6020
339 Ga0501036_0026862 3300049572 Bacteria 4864
340 Ga0501036_0081208 3300049572 Bacteria 2740
341 Ga0501036_0513547 3300049572 Bacteria 997
342 Ga0501037_0124328 3300049573 Bacteria 1853
343 Ga0501038_0393297 3300049574 Bacteria 1073
344 Ga0501039_0161473 3300049575 Bacteria 1761
345 Ga0501039_0176278 3300049575 Bacteria 1681
346 Ga0501040_0001841 3300049576 Bacteria 13631
347 Ga0501040_0034811 3300049576 Bacteria 3412
348 Ga0501040_0516212 3300049576 Bacteria 861
349 Ga0501041_0002518 3300049577 Bacteria 10438
350 Ga0501041_0106525 3300049577 Bacteria 1738
351 Ga0501041_0390189 3300049577 Bacteria 881
352 Ga0501042_0005163 3300049578 Bacteria 8386
353 Ga0501042_0239823 3300049578 Bacteria 1308
354 Ga0501043_0077926 3300049579 Bacteria 2604
355 Ga0501046_0007208 3300049580 Bacteria 9775
356 Ga0501046_0551477 3300049580 Bacteria 822
357 Ga0501048_0054478 3300049582 Bacteria 2841
358 Ga0501048_0219842 3300049582 Bacteria 1347
359 Ga0501068_0017529 3300049584 Bacteria 4143
360 Ga0501068_0143071 3300049584 Bacteria 1500
361 Ga0501068_0245637 3300049584 Bacteria 1140
362 Ga0501071_0006388 3300049587 Bacteria 7651
363 Ga0501071_0009277 3300049587 Bacteria 6546
364 Ga0501071_0012294 3300049587 Bacteria 5801
365 Ga0501071_0052910 3300049587 Bacteria 2928
366 Ga0501071_0556757 3300049587 Bacteria 881
367 Ga0501072_0037315 3300049588 Bacteria 3811
368 Ga0501072_0107106 3300049588 Bacteria 2223
369 Ga0501072_0173594 3300049588 Bacteria 1720
370 Ga0501072_0665974 3300049588 Bacteria 819
371 Ga0501073_0133304 3300049589 Bacteria 1722
372 Ga0501075_0000178 3300049591 Bacteria 33062
373 Ga0501075_0001111 3300049591 Bacteria 17320
374 Ga0501075_0003263 3300049591 Bacteria 10860
375 Ga0501075_0162525 3300049591 Bacteria 1704
376 Ga0501075_0712603 3300049591 Bacteria 764
377 Ga0501076_0000324 3300049592 Bacteria 29536
378 Ga0501076_0001198 3300049592 Bacteria 17207
379 Ga0501076_0054947 3300049592 Bacteria 3157
380 Ga0501076_0058019 3300049592 Bacteria 3075
381 Ga0501076_0110798 3300049592 Bacteria 2219
382 Ga0501076_0234068 3300049592 Bacteria 1502
383 Ga0501076_0251651 3300049592 Bacteria 1446
384 Ga0501077_0045411 3300049593 Bacteria 2791
385 Ga0501077_0331436 3300049593 Bacteria 970
386 Ga0501079_0004744 3300049741 Bacteria 10072
387 Ga0501079_0134576 3300049741 Bacteria 1924
388 Ga0501079_0654175 3300049741 Bacteria 827
389 Ga0501080_0127463 3300049742 Bacteria 2356
390 Ga0501080_0147891 3300049742 Bacteria 2172
391 Ga0501080_0317806 3300049742 Bacteria 1410
392 Ga0501081_0000289 3300049743 Bacteria 26773
393 Ga0501081_0013613 3300049743 Bacteria 5347
394 Ga0501081_0053714 3300049743 Bacteria 2782
395 Ga0501081_0080053 3300049743 Bacteria 2286
396 Ga0501081_0245473 3300049743 Bacteria 1306
397 Ga0501081_0443365 3300049743 Bacteria 964
398 Ga0501081_0447820 3300049743 Bacteria 959
399 Ga0501081_0547346 3300049743 Bacteria 864
400 Ga0501035_0045265 3300049822 Bacteria 3959
401 Ga0501045_0000988 3300049824 Bacteria 18614
402 Ga0501045_0018321 3300049824 Bacteria 4980
403 Ga0501045_0078155 3300049824 Bacteria 2439
404 Ga0501045_0157588 3300049824 Bacteria 1689
405 nmdc:mga00v17_191660_c1 3300050491 Bacteria 1320
406 nmdc:mga00v17_351163_c1 3300050491 Bacteria 959
407 nmdc:mga00v17_62702_c1 3300050491 Bacteria 2288
408 nmdc:mga0yw44_164768_c1 3300050492 Bacteria 1453
409 nmdc:mga0k408_14390_c1 3300050493 Bacteria 4358
410 nmdc:mga0k408_15693_c1 3300050493 Bacteria 4193
411 nmdc:mga0k408_27039_c1 3300050493 Bacteria 3256
412 nmdc:mga0k408_42425_c1 3300050493 Bacteria 2620
413 nmdc:mga0k408_76189_c1 3300050493 Bacteria 1960
414 nmdc:mga06z11_12054_c1 3300050494 Bacteria 3749
415 nmdc:mga06z11_47115_c1 3300050494 Bacteria 2188
416 nmdc:mga05p37_1043401_c1 3300050507 Bacteria 863
417 nmdc:mga05p37_145761_c1 3300050507 Bacteria 2900
418 nmdc:mga05p37_43643_c1 3300050507 Bacteria 5516
419 nmdc:mga05p37_52143_c1 3300050507 Bacteria 5031
420 nmdc:mga05p37_75455_c1 3300050507 Bacteria 4150
421 nmdc:mga09592_245291_c1 3300050508 Bacteria 1552
422 nmdc:mga0qj67_115903_c1 3300050509 Bacteria 2165
423 nmdc:mga0qj67_197828_c1 3300050509 Bacteria 1633
424 nmdc:mga0qj67_343679_c1 3300050509 Bacteria 1207
425 nmdc:mga0qj67_67962_c1 3300050509 Bacteria 2840
426 nmdc:mga06r32_182054_c1 3300050510 Bacteria 2087
427 nmdc:mga06r32_200425_c1 3300050510 Bacteria 1984
428 nmdc:mga06r32_239364_c1 3300050510 Bacteria 1803
429 nmdc:mga06r32_51955_c1 3300050510 Bacteria 3924
430 nmdc:mga06r32_562968_c1 3300050510 Bacteria 1113
431 nmdc:mga06r32_64387_c1 3300050510 Bacteria 3535
432 nmdc:mga08y16_141488_c1 3300050511 Bacteria 2501
433 nmdc:mga08y16_146196_c1 3300050511 Bacteria 2457
434 nmdc:mga08y16_27179_c1 3300050511 Bacteria 6029
435 nmdc:mga08y16_445_c1 3300050511 Bacteria 38283
436 nmdc:mga08y16_632_c1 3300050511 Bacteria 33000
437 nmdc:mga08y16_845304_c1 3300050511 Bacteria 905
438 nmdc:mga0n895_121759_c1 3300050512 Bacteria 2630
439 nmdc:mga0n895_32936_c1 3300050512 Bacteria 4977
440 nmdc:mga0rr50_121676_c2 3300050513 Bacteria 1788
441 nmdc:mga0rr50_1704_c1 3300050513 Bacteria 12133
442 nmdc:mga0rr50_275306_c1 3300050513 Bacteria 1403
443 nmdc:mga0rr50_43117_c1 3300050513 Bacteria 3299
444 nmdc:mga0rr50_468589_c1 3300050513 Bacteria 1069
445 nmdc:mga08x19_103321_c1 3300050514 Bacteria 1893
446 nmdc:mga08x19_354354_c1 3300050514 Bacteria 1025
447 nmdc:mga0a205_265622_c1 3300050515 Bacteria 1593
448 nmdc:mga0a205_47_c1 3300050515 Bacteria 65667
449 nmdc:mga0a205_57406_c1 3300050515 Bacteria 3759
450 nmdc:mga0a205_66239_c1 3300050515 Bacteria 3490
451 Ga0495619_0085831 3300053085 Bacteria 2127
452 Ga0501084_0716300 3300054114 Bacteria 844
453 Ga0590071_004641 3300059421 Bacteria 3323
454 Ga0501082_0001496 3300060353 Bacteria 20567
455 Ga0501082_0063881 3300060353 Bacteria 3170
456 Ga0501082_0804960 3300060353 Bacteria 822
457 Ga0530510_0037952 3300061734 Bacteria 3475
458 Ga0114129_10093304
459 Ga0065712_10073344
460 Ga0065712_10075394
461 Ga0065712_10245453
462 Ga0065715_10007153
463 Ga0065715_10010037
464 Ga0065715_10108527
465 Ga0065715_10128111
466 Ga0065707_10000733
467 Ga0065707_10055312
468 Ga0065707_10316050
469 Ga0070683_100005427
470 Ga0070670_100009909
471 Ga0070670_100029940
472 Ga0070670_100047580
473 Ga0070670_100152595
474 Ga0070670_100319239
475 Ga0070677_10146776
476 Ga0068869_100046674
477 Ga0068869_100560475
478 Ga0070666_10065931
479 Ga0068868_100055737
480 Ga0068868_100124512
481 Ga0070689_100021373
482 Ga0070689_100129616
483 Ga0070687_100047077
484 Ga0070661_100731052
485 Ga0070668_100155016
486 Ga0070669_100143509
487 Ga0070669_100190192
488 Ga0070669_100226454
489 Ga0070669_100706469
490 Ga0070669_100795130
491 Ga0070675_100105668
492 Ga0070675_100716816
493 Ga0070675_100848512
494 Ga0070671_100057249
495 Ga0070671_100183100
496 Ga0070674_100019663
497 Ga0070674_100332708
498 Ga0070673_100000530
499 Ga0070673_100116147
500 Ga0070673_100337333
501 Ga0070688_100283152
502 Ga0070688_100631726
503 Ga0070659_100032407
504 Ga0070659_100152101
505 Ga0070659_100269699
506 Ga0070667_100735808
507 Ga0070705_100092631
508 Ga0070700_100389620
509 Ga0070694_100066327
510 Ga0070663_100738518
511 Ga0070678_100512535
512 Ga0070678_100595703
513 Ga0070678_100928407
514 Ga0070662_100320370
515 Ga0070681_10271894
516 Ga0070685_10226194
517 Ga0070685_10509081
518 Ga0070706_100153042
519 Ga0070706_100893277
520 Ga0070707_100067366
521 Ga0070707_100628010
522 Ga0070698_100116148
523 Ga0070699_100091859
524 Ga0070699_100108348
525 Ga0070679_100382810
526 Ga0070684_100703437
527 Ga0070697_100138018
528 Ga0070672_100007131
529 Ga0070672_100181540
530 Ga0070672_100287372
531 Ga0070686_100126370
532 Ga0070696_100286997
533 Ga0070693_100018764
534 Ga0070665_100090787
535 Ga0070665_100219955
536 Ga0070704_100053018
537 Ga0070704_100057887
538 Ga0070704_100094039
539 Ga0070702_100316661
540 Ga0068859_100910155
541 Ga0068864_100364625
542 Ga0068866_10047634
543 Ga0068866_10486263
544 Ga0068861_100028454
545 Ga0068861_100710835
546 Ga0068863_100162091
547 Ga0068863_100190475
548 Ga0068858_100064790
549 Ga0068860_100193231
550 Ga0068860_100586193
551 Ga0068862_100103200
552 Ga0068862_100222377
553 Ga0068862_100299216
554 Ga0068862_100464766
555 Ga0068862_100616421
556 Ga0068862_101134404
557 Ga0081455_10039169
558 Ga0075365_10217823
559 Ga0075364_10003997
560 Ga0075364_10067868
561 Ga0070716_100376134
562 Ga0075362_10005384
563 Ga0075367_10004497
564 Ga0075367_10004903
565 Ga0075367_10467245
566 Ga0075366_10008953
567 Ga0075366_10028923
568 Ga0075366_10065604
569 Ga0097621_100009398
570 Ga0068871_100042515
571 Ga0068871_100878569
572 Ga0075428_100476955
573 Ga0075428_100625742
574 Ga0075430_100028705
575 Ga0075430_100066521
576 Ga0075430_100165929
577 Ga0075430_100368582
578 Ga0075431_100020217
579 Ga0075431_100165803
580 Ga0075431_100462628
581 Ga0075433_10001292
582 Ga0075433_10012944
583 Ga0075433_10536169
584 Ga0075434_100002212
585 Ga0075434_100052546
586 Ga0075434_100402591
587 Ga0075434_100543207
588 Ga0075429_100093409
589 Ga0075429_100108352
590 Ga0075429_100255842
591 Ga0068865_100190547
592 Ga0097620_100910049
593 Ga0075435_100001214
594 Ga0075435_100001367
595 Ga0075435_100138387
596 Ga0075435_100296692
597 Ga0075435_100359345
598 Ga0075435_100362223
599 Ga0105240_10113774
600 Ga0105240_10500152
601 Ga0111539_10001033
602 Ga0111539_10001074
603 Ga0111539_10001197
604 Ga0111539_10030996
605 Ga0111539_10036826
606 Ga0111539_10089057
607 Ga0111539_10090540
608 Ga0111539_10097829
609 Ga0111539_10103532
610 Ga0111539_10736478
611 Ga0105245_10042549
612 Ga0105245_10148725
613 Ga0105245_10427142
614 Ga0114129_10013048
615 Ga0114129_10030759
616 Ga0114129_10033542
617 Ga0114129_10127178
618 Ga0114129_10208320
619 Ga0114129_10352006
620 Ga0114129_10603879
621 Ga0105243_10073210
622 Ga0105242_10020391
623 Ga0105242_10117021
624 Ga0105242_10373564
625 Ga0105242_10667243
626 Ga0105248_10051837
627 Ga0105248_10128781
628 Ga0105248_10131051
629 Ga0105248_10429300
630 Ga0105248_10438712
631 Ga0105248_10554978
632 Ga0105248_10572707
633 Ga0105238_10124370
634 Ga0105249_10225800
635 Ga0105249_10939769
636 Ga0105249_11026719
637 Ga0105239_11023793
638 Ga0105246_10649146
639 Ga0157369_10409278
640 Ga0157374_10631436
641 Ga0163162_10500471
642 Ga0157372_10158349
643 Ga0157375_10087995
644 Ga0157375_10146088
645 Ga0163163_10032930
646 Ga0163163_11321038
647 Ga0157380_10026251
648 Ga0157380_10078736
649 Ga0157380_10099893
650 Ga0157380_10357117
651 Ga0157379_10220577
652 Ga0157379_10513311
653 Ga0157376_10049889
654 Ga0157376_10155028
655 Ga0157376_10229922
656 Ga0207697_10000351
657 Ga0207642_10038993
658 Ga0207688_10010691
659 Ga0207688_10188825
660 Ga0207680_10073005
661 Ga0207645_10099793
662 Ga0207645_10146882
663 Ga0207705_10445443
664 Ga0207684_10735777
665 Ga0207707_10333967
666 Ga0207707_10424829
667 Ga0207662_10005872
668 Ga0207662_10241286
669 Ga0207652_10768651
670 Ga0207681_10058112
671 Ga0207681_10178729
672 Ga0207681_10196223
673 Ga0207681_10365704
674 Ga0207681_10756447
675 Ga0207694_10191630
676 Ga0207650_10033553
677 Ga0207659_10100397
678 Ga0207659_10129810
679 Ga0207659_10250853
680 Ga0207687_10132844
681 Ga0207644_10066888
682 Ga0207690_10223469
683 Ga0207686_10056435
684 Ga0207686_10117878
685 Ga0207686_10122124
686 Ga0207686_10316952
687 Ga0207709_10149262
688 Ga0207670_10065974
689 Ga0207670_10172933
690 Ga0207669_10265562
691 Ga0207669_10831864
692 Ga0207704_10141651
693 Ga0207691_10015944
694 Ga0207691_10065005
695 Ga0207691_10294394
696 Ga0207711_10120445
697 Ga0207711_10147592
698 Ga0207711_10556099
699 Ga0207689_10069002
700 Ga0207689_10086852
701 Ga0207661_10001781
702 Ga0207661_10353085
703 Ga0207679_10288576
704 Ga0207667_10764487
705 Ga0207651_10011333
706 Ga0207651_10092510
707 Ga0207651_10481861
708 Ga0207651_10674028
709 Ga0207677_10057323
710 Ga0207677_10087284
711 Ga0207677_10382068
712 Ga0207677_10593147
713 Ga0207703_10145430
714 Ga0207708_10250109
715 Ga0207641_10092570
716 Ga0207641_10180718
717 Ga0207641_10212925
718 Ga0207641_10342097
719 Ga0207641_10882223
720 Ga0207648_10013129
721 Ga0207648_10022969
722 Ga0207674_10005749
723 Ga0207675_100030794
724 Ga0207675_100273806
725 Ga0207675_100474138
726 Ga0207675_100904766
727 Ga0207683_10065233
728 Ga0207683_10087354
729 Ga0207683_10153269
730 Ga0207683_10387050
731 Ga0207698_10582342
732 Ga0207698_10670213
733 Ga0207428_10005489
734 Ga0207428_10018980
735 Ga0207428_10082888
736 Ga0207428_10086377
737 Ga0268266_10069510
738 Ga0268266_10279490
739 Ga0268265_10659335
740 Ga0307408_100219060
741 Ga0307405_10516730
742 Ga0307405_10717429
743 Ga0307407_10475285
744 Ga0307412_10083549
745 Ga0307412_10121536
746 Ga0307412_10259845
747 Ga0307409_100070685
748 Ga0307409_100933147
749 Ga0307416_100078425
750 Ga0307416_100184787
751 Ga0307416_100307350
752 Ga0307411_10167923
753 Ga0307411_10259734
754 Ga0307411_10340937
755 Ga0307411_10518640
756 Ga0307415_100562720
757 Ga0307415_100783959
758 Ga0373943_0023324
759 Ga0373935_0344761
760 Ga0373947_0392472
761 Ga0373925_0572992
762 Ga0395905_0884474
763 Ga0439453_0002385
764 Ga0451807_0783981
765 Ga0439433_0093800
766 Ga0439449_0079513
767 Ga0439455_0089456
768 Ga0450896_016505
769 Ga0439434_0087266
770 Ga0439435_0013298
771 Ga0439435_0042164
772 Ga0439460_0062693
773 Ga0451577_0002220
774 Ga0453684_0014387
775 Ga0466957_0499674
776 Ga0451576_0059754
777 Ga0495603_0111491
778 Ga0495629_0161804
779 Ga0495638_0004530
780 Ga0495628_0045506
781 Ga0495644_0218223
782 Ga0495666_0201421
783 Ga0495659_0274051
784 Ga0495669_0003095
785 Ga0496108_0105316
786 Ga0496110_0095231
787 Ga0496112_0021138
788 Ga0496112_0615748
789 Ga0496114_0064776
790 Ga0496114_0107916
791 Ga0496114_0156815
792 Ga0501031_0054979
793 Ga0501032_0218492
794 Ga0501033_0018540
795 Ga0501036_0017329
796 Ga0501036_0026862
797 Ga0501036_0081208
798 Ga0501036_0513547
799 Ga0501037_0124328
800 Ga0501038_0393297
801 Ga0501039_0161473
802 Ga0501039_0176278
803 Ga0501040_0001841
804 Ga0501040_0034811
805 Ga0501040_0516212
806 Ga0501041_0002518
807 Ga0501041_0106525
808 Ga0501041_0390189
809 Ga0501042_0005163
810 Ga0501042_0239823
811 Ga0501043_0077926
812 Ga0501046_0007208
813 Ga0501046_0551477
814 Ga0501048_0054478
815 Ga0501048_0219842
816 Ga0501068_0017529
817 Ga0501068_0143071
818 Ga0501068_0245637
819 Ga0501071_0006388
820 Ga0501071_0009277
821 Ga0501071_0012294
822 Ga0501071_0052910
823 Ga0501071_0556757
824 Ga0501072_0037315
825 Ga0501072_0107106
826 Ga0501072_0173594
827 Ga0501072_0665974
828 Ga0501073_0133304
829 Ga0501075_0000178
830 Ga0501075_0001111
831 Ga0501075_0003263
832 Ga0501075_0162525
833 Ga0501075_0712603
834 Ga0501076_0000324
835 Ga0501076_0001198
836 Ga0501076_0054947
837 Ga0501076_0058019
838 Ga0501076_0110798
839 Ga0501076_0234068
840 Ga0501076_0251651
841 Ga0501077_0045411
842 Ga0501077_0331436
843 Ga0501079_0004744
844 Ga0501079_0134576
845 Ga0501079_0654175
846 Ga0501080_0127463
847 Ga0501080_0147891
848 Ga0501080_0317806
849 Ga0501081_0000289
850 Ga0501081_0013613
851 Ga0501081_0053714
852 Ga0501081_0080053
853 Ga0501081_0245473
854 Ga0501081_0443365
855 Ga0501081_0447820
856 Ga0501081_0547346
857 Ga0501035_0045265
858 Ga0501045_0000988
859 Ga0501045_0018321
860 Ga0501045_0078155
861 Ga0501045_0157588
862 nmdc:mga00v17_191660_c1
863 nmdc:mga00v17_351163_c1
864 nmdc:mga00v17_62702_c1
865 nmdc:mga0yw44_164768_c1
866 nmdc:mga0k408_14390_c1
867 nmdc:mga0k408_15693_c1
868 nmdc:mga0k408_27039_c1
869 nmdc:mga0k408_42425_c1
870 nmdc:mga0k408_76189_c1
871 nmdc:mga06z11_12054_c1
872 nmdc:mga06z11_47115_c1
873 nmdc:mga05p37_1043401_c1
874 nmdc:mga05p37_145761_c1
875 nmdc:mga05p37_43643_c1
876 nmdc:mga05p37_52143_c1
877 nmdc:mga05p37_75455_c1
878 nmdc:mga09592_245291_c1
879 nmdc:mga0qj67_115903_c1
880 nmdc:mga0qj67_197828_c1
881 nmdc:mga0qj67_343679_c1
882 nmdc:mga0qj67_67962_c1
883 nmdc:mga06r32_182054_c1
884 nmdc:mga06r32_200425_c1
885 nmdc:mga06r32_239364_c1
886 nmdc:mga06r32_51955_c1
887 nmdc:mga06r32_562968_c1
888 nmdc:mga06r32_64387_c1
889 nmdc:mga08y16_141488_c1
890 nmdc:mga08y16_146196_c1
891 nmdc:mga08y16_27179_c1
892 nmdc:mga08y16_445_c1
893 nmdc:mga08y16_632_c1
894 nmdc:mga08y16_845304_c1
895 nmdc:mga0n895_121759_c1
896 nmdc:mga0n895_32936_c1
897 nmdc:mga0rr50_121676_c2
898 nmdc:mga0rr50_1704_c1
899 nmdc:mga0rr50_275306_c1
900 nmdc:mga0rr50_43117_c1
901 nmdc:mga0rr50_468589_c1
902 nmdc:mga08x19_103321_c1
903 nmdc:mga08x19_354354_c1
904 nmdc:mga0a205_265622_c1
905 nmdc:mga0a205_47_c1
906 nmdc:mga0a205_57406_c1
907 nmdc:mga0a205_66239_c1
908 Ga0495619_0085831
909 Ga0501084_0716300
910 Ga0590071_004641
911 Ga0501082_0001496
912 Ga0501082_0063881
913 Ga0501082_0804960
914 Ga0530510_0037952

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

53

202

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cvl-assembly1.cif.gz_C crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein 0.9681 3 217
6cvl-assembly1.cif.gz_D crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein 0.968 3 217
5lj7-assembly1.cif.gz_B structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) 0.9614 1 219
3tif-assembly1.cif.gz_B dimeric structure of a post-hydrolysis state of the atp-binding cassette mj0796 bound to adp and pi 0.9608 4 218
7v8i-assembly1.cif.gz_F lolcd(e171q)e with bound amppnp in nanodiscs 0.9597 2 218
ID Description Score Start End Superfamily
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9563 22 217 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9498 1 218 3.40.50.300
af_P33594_1_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9447 1 219 3.40.50.300
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.94 1 217 3.40.50.300
af_P0A9T8_2_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9389 2 220 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A432QG91-F1-model_v4 ABC transporter ATP-binding protein 0.9759 1 219 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A432QG91-F1-model_v4 ABC transporter ATP-binding protein 0.9672 1 219 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A522CP16-F1-model_v4 ABC transporter ATP-binding protein 0.9667 1 219 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7C7VTW9-F1-model_v4 ATP-binding cassette domain-containing protein 0.9645 2 217 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A5C0AW49-F1-model_v4 ABC transporter ATP-binding protein 0.9624 2 219 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Map