F447964

General Info

Members Datasets Scaffolds Average Seq Length
457 176 914 332

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100285459|Ga0068857_1002854592
Length 342
Sequence VSVCTPYAGAMAVLVTGAAGFIGAATSARLLERGDEVVGIDNLNAYYDPRLKQARLTRLAEQHGNRFRFERVDFADAEALGRLADGIEIDAIVHLGAQAGVRYSLENPGAYIQSNLVGHANLLELARHRGPRHMVYASSSSVYGGNTSLPFRVEDRVDHPLSLYAATKKADELLSESYASLYRTPLTGLRFFTVYGPWGRPDMAMWIFTRALYAGEPLPLFNRGEMRRDFTYIDDIVAGVVACLDSPPADDGMAKAGGSTGPHALYNIGNSRSEDLMRVVELLERETGKTALLDPRPMQIGDVKETFADISAITRDHGFAPTTSIDQGVPRFVAWYRNYHQL

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
136 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
137 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
138 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
139 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
151 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
152 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
157 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
176 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 5.69
Rhizosphere 93.65
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_100285459 3300005577 Bacteria 1519
2 JGI24741J21665_1001631 3300001915 Bacteria 6248
3 JGI24741J21665_1013537 3300001915 Bacteria 1382
4 JGI24740J21852_10002961 3300001979 Bacteria 7533
5 JGI24740J21852_10004266 3300001979 Bacteria 6164
6 JGI24743J22301_10026893 3300001991 Bacteria 1121
7 JGI24735J21928_10023797 3300002067 Bacteria 1857
8 Ga0070658_10005551 3300005327 Bacteria 10234
9 Ga0070658_10017732 3300005327 Bacteria 5695
10 Ga0070658_10053689 3300005327 Bacteria 3271
11 Ga0070658_10054934 3300005327 Bacteria 3234
12 Ga0070658_10064636 3300005327 Bacteria 2984
13 Ga0070658_10256704 3300005327 Bacteria 1483
14 Ga0070676_10099455 3300005328 Bacteria 1794
15 Ga0070683_100005329 3300005329 Bacteria 10720
16 Ga0070683_100005954 3300005329 Bacteria 10207
17 Ga0070683_100319226 3300005329 Bacteria 1478
18 Ga0070683_100321603 3300005329 Bacteria 1472
19 Ga0070683_100376005 3300005329 Bacteria 1354
20 Ga0070683_100432602 3300005329 Bacteria 1255
21 Ga0070690_100008918 3300005330 Bacteria 5792
22 Ga0070670_100001001 3300005331 Bacteria 22252
23 Ga0070670_100012550 3300005331 Bacteria 7253
24 Ga0070670_100046189 3300005331 Bacteria 3745
25 Ga0070670_100072199 3300005331 Bacteria 2964
26 Ga0070680_100018341 3300005336 Bacteria 5528
27 Ga0070680_100107512 3300005336 Bacteria 2320
28 Ga0070680_100116246 3300005336 Bacteria 2229
29 Ga0068868_100146982 3300005338 Bacteria 1939
30 Ga0070660_100006172 3300005339 Bacteria 8292
31 Ga0070660_100011159 3300005339 Bacteria 6374
32 Ga0070660_100038807 3300005339 Bacteria 3617
33 Ga0070660_100142742 3300005339 Bacteria 1922
34 Ga0070660_100178345 3300005339 Bacteria 1718
35 Ga0070660_100244824 3300005339 Bacteria 1461
36 Ga0070660_100365353 3300005339 Bacteria 1190
37 Ga0070691_10000244 3300005341 Bacteria 18593
38 Ga0070661_100002207 3300005344 Bacteria 13385
39 Ga0070661_100041470 3300005344 Bacteria 3359
40 Ga0070661_100240262 3300005344 Bacteria 1394
41 Ga0070661_100271521 3300005344 Bacteria 1313
42 Ga0070692_10038842 3300005345 Bacteria 2428
43 Ga0070692_10051705 3300005345 Bacteria 2138
44 Ga0070669_100009572 3300005353 Bacteria 6900
45 Ga0070669_100027278 3300005353 Bacteria 4110
46 Ga0070675_100001926 3300005354 Bacteria 15354
47 Ga0070675_100005465 3300005354 Bacteria 9724
48 Ga0070671_100001542 3300005355 Bacteria 17326
49 Ga0070671_100005726 3300005355 Bacteria 9896
50 Ga0070671_100010433 3300005355 Bacteria 7452
51 Ga0070671_100096619 3300005355 Bacteria 2477
52 Ga0070671_100242370 3300005355 Bacteria 1531
53 Ga0070674_100160970 3300005356 Bacteria 1703
54 Ga0070673_100000993 3300005364 Bacteria 16083
55 Ga0070673_100001556 3300005364 Bacteria 13518
56 Ga0070673_100064786 3300005364 Bacteria 2912
57 Ga0070659_100004407 3300005366 Bacteria 10054
58 Ga0070659_100060144 3300005366 Bacteria 3001
59 Ga0070659_100060200 3300005366 Bacteria 2999
60 Ga0070659_100139429 3300005366 Bacteria 1974
61 Ga0070659_100195991 3300005366 Bacteria 1661
62 Ga0070659_100197347 3300005366 Bacteria 1655
63 Ga0070667_100006579 3300005367 Bacteria 9663
64 Ga0070667_100048225 3300005367 Bacteria 3585
65 Ga0070709_10016373 3300005434 Bacteria 4230
66 Ga0070714_100028814 3300005435 Bacteria 4610
67 Ga0070714_100097161 3300005435 Bacteria 2589
68 Ga0070713_100007373 3300005436 Bacteria 7713
69 Ga0070663_100053737 3300005455 Bacteria 2876
70 Ga0070663_100080816 3300005455 Bacteria 2388
71 Ga0070663_100100491 3300005455 Bacteria 2158
72 Ga0070663_100243113 3300005455 Bacteria 1422
73 Ga0070678_100008713 3300005456 Bacteria 6091
74 Ga0070678_100036450 3300005456 Bacteria 3443
75 Ga0070662_100007929 3300005457 Bacteria 6907
76 Ga0070662_100010620 3300005457 Bacteria 6055
77 Ga0070662_100020139 3300005457 Bacteria 4539
78 Ga0070662_100021145 3300005457 Bacteria 4441
79 Ga0070662_100026907 3300005457 Bacteria 3987
80 Ga0070662_100032174 3300005457 Bacteria 3685
81 Ga0070681_10129846 3300005458 Bacteria 2452
82 Ga0068867_100051705 3300005459 Bacteria 3031
83 Ga0068867_100149581 3300005459 Bacteria 1833
84 Ga0070685_10061136 3300005466 Bacteria 2205
85 Ga0070706_100074492 3300005467 Bacteria 3142
86 Ga0070684_100016889 3300005535 Bacteria 5977
87 Ga0070684_100262947 3300005535 Bacteria 1578
88 Ga0068853_100024647 3300005539 Bacteria 5046
89 Ga0068853_100045363 3300005539 Bacteria 3765
90 Ga0068853_100078154 3300005539 Bacteria 2891
91 Ga0068853_100195231 3300005539 Bacteria 1841
92 Ga0068853_100422952 3300005539 Bacteria 1249
93 Ga0068853_100517429 3300005539 Bacteria 1128
94 Ga0070672_100001499 3300005543 Bacteria 14494
95 Ga0070672_100022352 3300005543 Bacteria 4645
96 Ga0070672_100071231 3300005543 Bacteria 2765
97 Ga0070672_100436949 3300005543 Bacteria 1126
98 Ga0070665_100024564 3300005548 Bacteria 6072
99 Ga0070665_100036913 3300005548 Bacteria 4914
100 Ga0068855_100013518 3300005563 Bacteria 9842
101 Ga0068855_100173179 3300005563 Bacteria 2443
102 Ga0068855_100238395 3300005563 Bacteria 2033
103 Ga0068855_100458399 3300005563 Bacteria 1390
104 Ga0070664_100001393 3300005564 Bacteria 19281
105 Ga0070664_100015963 3300005564 Bacteria 6149
106 Ga0070664_100017601 3300005564 Bacteria 5868
107 Ga0070664_100053874 3300005564 Bacteria 3411
108 Ga0068857_100028285 3300005577 Bacteria 4946
109 Ga0068854_100003393 3300005578 Bacteria 9926
110 Ga0068854_100058791 3300005578 Bacteria 2777
111 Ga0068854_100154772 3300005578 Bacteria 1770
112 Ga0068854_100320343 3300005578 Bacteria 1260
113 Ga0068856_100005840 3300005614 Bacteria 12131
114 Ga0068856_100020909 3300005614 Bacteria 6360
115 Ga0068856_100050113 3300005614 Bacteria 4116
116 Ga0068856_100072558 3300005614 Bacteria 3408
117 Ga0068856_100109138 3300005614 Bacteria 2763
118 Ga0068856_100449856 3300005614 Bacteria 1309
119 Ga0068852_100025108 3300005616 Bacteria 4824
120 Ga0068852_100028475 3300005616 Bacteria 4573
121 Ga0068852_100032855 3300005616 Bacteria 4301
122 Ga0068852_100203013 3300005616 Bacteria 1876
123 Ga0068852_100227553 3300005616 Bacteria 1776
124 Ga0068864_100045541 3300005618 Bacteria 3763
125 Ga0068864_100051212 3300005618 Bacteria 3556
126 Ga0068851_10004800 3300005834 Bacteria 6117
127 Ga0068851_10024247 3300005834 Bacteria 2970
128 Ga0068851_10105599 3300005834 Bacteria 1499
129 Ga0068863_100058529 3300005841 Bacteria 3646
130 Ga0068858_100254354 3300005842 Bacteria 1669
131 Ga0081539_10018188 3300005985 Bacteria 4891
132 Ga0081539_10043397 3300005985 Bacteria 2607
133 Ga0070716_100018850 3300006173 Bacteria 3599
134 Ga0068871_100207924 3300006358 Bacteria 1692
135 Ga0068871_100359754 3300006358 Bacteria 1289
136 Ga0105240_10052886 3300009093 Bacteria 5102
137 Ga0105240_10068003 3300009093 Bacteria 4414
138 Ga0105245_10119409 3300009098 Bacteria 2461
139 Ga0105245_10308719 3300009098 Bacteria 1555
140 Ga0105243_10122233 3300009148 Bacteria 2197
141 Ga0105248_10003593 3300009177 Bacteria 17186
142 Ga0105248_10015208 3300009177 Bacteria 8480
143 Ga0105248_10029128 3300009177 Bacteria 6157
144 Ga0105248_10033914 3300009177 Bacteria 5704
145 Ga0105248_10055542 3300009177 Bacteria 4442
146 Ga0105248_10080139 3300009177 Bacteria 3669
147 Ga0105237_10148370 3300009545 Bacteria 2341
148 Ga0105238_10005495 3300009551 Bacteria 12520
149 Ga0105238_10219861 3300009551 Bacteria 1876
150 Ga0157373_10001821 3300013100 Bacteria 16231
151 Ga0157373_10004692 3300013100 Bacteria 10272
152 Ga0157373_10107193 3300013100 Bacteria 1964
153 Ga0157373_10310138 3300013100 Bacteria 1121
154 Ga0157371_10197414 3300013102 Bacteria 1442
155 Ga0157370_10031267 3300013104 Bacteria 5209
156 Ga0157370_10118335 3300013104 Bacteria 2475
157 Ga0157369_10032666 3300013105 Bacteria 5721
158 Ga0157369_10100045 3300013105 Bacteria 3091
159 Ga0157369_10243671 3300013105 Bacteria 1877
160 Ga0157369_10273228 3300013105 Bacteria 1761
161 Ga0157369_10310869 3300013105 Bacteria 1639
162 Ga0157369_10311657 3300013105 Bacteria 1636
163 Ga0157374_10002080 3300013296 Bacteria 16850
164 Ga0157378_10321053 3300013297 Bacteria 1504
165 Ga0163162_10444687 3300013306 Bacteria 1428
166 Ga0157372_10007723 3300013307 Bacteria 11432
167 Ga0157372_10096344 3300013307 Bacteria 3372
168 Ga0157372_10118594 3300013307 Bacteria 3036
169 Ga0157375_10004032 3300013308 Bacteria 12740
170 Ga0157375_10034222 3300013308 Bacteria 4838
171 Ga0157375_10220604 3300013308 Bacteria 2054
172 Ga0157375_10345288 3300013308 Bacteria 1654
173 Ga0163163_10008358 3300014325 Bacteria 9193
174 Ga0163163_10363331 3300014325 Bacteria 1504
175 Ga0157379_10236061 3300014968 Bacteria 1658
176 Ga0213876_10014519 3300021384 Bacteria 4173
177 Ga0207656_10011962 3300025321 Bacteria 3291
178 Ga0207680_10063869 3300025903 Bacteria 2255
179 Ga0207647_10000619 3300025904 Bacteria 27673
180 Ga0207647_10001347 3300025904 Bacteria 18861
181 Ga0207647_10016980 3300025904 Bacteria 4955
182 Ga0207647_10020336 3300025904 Bacteria 4452
183 Ga0207647_10101040 3300025904 Bacteria 1711
184 Ga0207645_10105320 3300025907 Bacteria 1822
185 Ga0207705_10001814 3300025909 Bacteria 16828
186 Ga0207705_10015879 3300025909 Bacteria 5407
187 Ga0207705_10024342 3300025909 Bacteria 4322
188 Ga0207705_10060370 3300025909 Bacteria 2739
189 Ga0207705_10146097 3300025909 Bacteria 1769
190 Ga0207684_10057228 3300025910 Bacteria 3308
191 Ga0207707_10149873 3300025912 Bacteria 2039
192 Ga0207695_10008629 3300025913 Bacteria 12729
193 Ga0207660_10005394 3300025917 Bacteria 8299
194 Ga0207660_10071258 3300025917 Bacteria 2528
195 Ga0207660_10078649 3300025917 Bacteria 2417
196 Ga0207660_10316090 3300025917 Bacteria 1246
197 Ga0207662_10026295 3300025918 Bacteria 3356
198 Ga0207657_10003669 3300025919 Bacteria 16338
199 Ga0207657_10006343 3300025919 Bacteria 12284
200 Ga0207657_10008323 3300025919 Bacteria 10555
201 Ga0207657_10018102 3300025919 Bacteria 6740
202 Ga0207657_10183397 3300025919 Bacteria 1691
203 Ga0207657_10199324 3300025919 Bacteria 1611
204 Ga0207649_10010302 3300025920 Bacteria 5132
205 Ga0207649_10055494 3300025920 Bacteria 2470
206 Ga0207649_10174144 3300025920 Bacteria 1501
207 Ga0207649_10224325 3300025920 Bacteria 1340
208 Ga0207649_10314771 3300025920 Bacteria 1148
209 Ga0207649_10333228 3300025920 Bacteria 1118
210 Ga0207652_10102528 3300025921 Bacteria 2529
211 Ga0207681_10261513 3300025923 Bacteria 1355
212 Ga0207694_10005058 3300025924 Bacteria 10201
213 Ga0207650_10000583 3300025925 Bacteria 29313
214 Ga0207650_10057645 3300025925 Bacteria 2889
215 Ga0207659_10001196 3300025926 Bacteria 15472
216 Ga0207687_10200744 3300025927 Bacteria 1558
217 Ga0207700_10079534 3300025928 Bacteria 2553
218 Ga0207700_10476069 3300025928 Bacteria 1103
219 Ga0207664_10054652 3300025929 Bacteria 3165
220 Ga0207664_10127645 3300025929 Bacteria 2137
221 Ga0207664_10305394 3300025929 Bacteria 1401
222 Ga0207644_10002620 3300025931 Bacteria 11583
223 Ga0207644_10005034 3300025931 Bacteria 8629
224 Ga0207644_10054166 3300025931 Bacteria 2888
225 Ga0207644_10091479 3300025931 Bacteria 2268
226 Ga0207690_10001581 3300025932 Bacteria 14241
227 Ga0207690_10013687 3300025932 Bacteria 4881
228 Ga0207690_10198803 3300025932 Bacteria 1521
229 Ga0207690_10309920 3300025932 Bacteria 1238
230 Ga0207706_10007840 3300025933 Bacteria 9854
231 Ga0207706_10017444 3300025933 Bacteria 6468
232 Ga0207706_10030592 3300025933 Bacteria 4801
233 Ga0207706_10033907 3300025933 Bacteria 4544
234 Ga0207706_10048653 3300025933 Bacteria 3749
235 Ga0207706_10081208 3300025933 Bacteria 2849
236 Ga0207706_10101597 3300025933 Bacteria 2530
237 Ga0207706_10107043 3300025933 Bacteria 2460
238 Ga0207706_10113793 3300025933 Bacteria 2380
239 Ga0207706_10117130 3300025933 Bacteria 2343
240 Ga0207706_10176283 3300025933 Bacteria 1878
241 Ga0207669_10068311 3300025937 Bacteria 2219
242 Ga0207691_10003881 3300025940 Bacteria 14511
243 Ga0207691_10033788 3300025940 Bacteria 4761
244 Ga0207691_10158345 3300025940 Bacteria 1988
245 Ga0207691_10298612 3300025940 Bacteria 1384
246 Ga0207711_10020280 3300025941 Bacteria 5540
247 Ga0207711_10026773 3300025941 Bacteria 4840
248 Ga0207711_10034719 3300025941 Bacteria 4271
249 Ga0207711_10075468 3300025941 Bacteria 2934
250 Ga0207661_10019848 3300025944 Bacteria 5015
251 Ga0207661_10094422 3300025944 Bacteria 2498
252 Ga0207661_10119156 3300025944 Bacteria 2245
253 Ga0207661_10265147 3300025944 Bacteria 1531
254 Ga0207679_10015006 3300025945 Bacteria 5106
255 Ga0207679_10108783 3300025945 Bacteria 2183
256 Ga0207679_10287064 3300025945 Bacteria 1413
257 Ga0207667_10006500 3300025949 Bacteria 14140
258 Ga0207667_10017358 3300025949 Bacteria 8102
259 Ga0207667_10039017 3300025949 Bacteria 5064
260 Ga0207651_10001902 3300025960 Bacteria 9798
261 Ga0207651_10065327 3300025960 Bacteria 2551
262 Ga0207651_10069792 3300025960 Bacteria 2483
263 Ga0207640_10051303 3300025981 Bacteria 2681
264 Ga0207640_10089416 3300025981 Bacteria 2129
265 Ga0207658_10185182 3300025986 Bacteria 1726
266 Ga0207658_10372227 3300025986 Bacteria 1249
267 Ga0207677_10000918 3300026023 Bacteria 16459
268 Ga0207703_10230588 3300026035 Bacteria 1660
269 Ga0207639_10041497 3300026041 Bacteria 3443
270 Ga0207639_10043773 3300026041 Bacteria 3363
271 Ga0207639_10086561 3300026041 Bacteria 2495
272 Ga0207678_10008367 3300026067 Bacteria 9124
273 Ga0207678_10118421 3300026067 Bacteria 2260
274 Ga0207678_10149874 3300026067 Bacteria 1991
275 Ga0207678_10267223 3300026067 Bacteria 1466
276 Ga0207702_10024116 3300026078 Bacteria 5047
277 Ga0207702_10031608 3300026078 Bacteria 4412
278 Ga0207702_10279145 3300026078 Bacteria 1578
279 Ga0207641_10082956 3300026088 Bacteria 2786
280 Ga0207641_10258032 3300026088 Bacteria 1631
281 Ga0207648_10082056 3300026089 Bacteria 2811
282 Ga0207648_10091221 3300026089 Bacteria 2664
283 Ga0207676_10034949 3300026095 Bacteria 3809
284 Ga0207676_10041881 3300026095 Bacteria 3519
285 Ga0207676_10205267 3300026095 Bacteria 1744
286 Ga0207674_10015977 3300026116 Bacteria 8223
287 Ga0207674_10024091 3300026116 Bacteria 6509
288 Ga0207674_10177091 3300026116 Bacteria 2085
289 Ga0207683_10003300 3300026121 Bacteria 14064
290 Ga0207683_10043822 3300026121 Bacteria 3910
291 Ga0207698_10002029 3300026142 Bacteria 11940
292 Ga0207698_10035534 3300026142 Bacteria 3647
293 Ga0268266_10061736 3300028379 Bacteria 3232
294 Ga0268266_10455643 3300028379 Bacteria 1216
295 Ga0307408_100014986 3300031548 Bacteria 5158
296 Ga0307408_100030405 3300031548 Bacteria 3750
297 Ga0307405_10009292 3300031731 Bacteria 5032
298 Ga0307405_10292354 3300031731 Bacteria 1232
299 Ga0307413_10016889 3300031824 Bacteria 3787
300 Ga0307413_10039222 3300031824 Bacteria 2752
301 Ga0307413_10041305 3300031824 Bacteria 2699
302 Ga0307413_10051485 3300031824 Bacteria 2481
303 Ga0307413_10075039 3300031824 Bacteria 2144
304 Ga0307410_10014240 3300031852 Bacteria 4672
305 Ga0307410_10034401 3300031852 Bacteria 3281
306 Ga0307410_10060308 3300031852 Bacteria 2592
307 Ga0307410_10210943 3300031852 Bacteria 1488
308 Ga0307407_10004515 3300031903 Bacteria 5921
309 Ga0307407_10004807 3300031903 Bacteria 5786
310 Ga0307412_10072733 3300031911 Bacteria 2350
311 Ga0307412_10111334 3300031911 Bacteria 1955
312 Ga0307409_100012135 3300031995 Bacteria 5474
313 Ga0307409_100022741 3300031995 Bacteria 4326
314 Ga0307409_100168079 3300031995 Bacteria 1927
315 Ga0307409_100606353 3300031995 Bacteria 1082
316 Ga0307416_100006127 3300032002 Bacteria 7491
317 Ga0307416_100056925 3300032002 Bacteria 3159
318 Ga0307416_100090740 3300032002 Bacteria 2621
319 Ga0307416_100095103 3300032002 Bacteria 2571
320 Ga0307414_10003641 3300032004 Bacteria 8255
321 Ga0307414_10008404 3300032004 Bacteria 5853
322 Ga0307414_10011676 3300032004 Bacteria 5162
323 Ga0307414_10035747 3300032004 Bacteria 3309
324 Ga0307414_10191067 3300032004 Bacteria 1657
325 Ga0307411_10010123 3300032005 Bacteria 5006
326 Ga0307411_10094671 3300032005 Bacteria 2094
327 Ga0307411_10096274 3300032005 Bacteria 2080
328 Ga0307411_10115082 3300032005 Bacteria 1933
329 Ga0307415_100002508 3300032126 Bacteria 9161
330 Ga0307415_100008711 3300032126 Bacteria 5643
331 Ga0307415_100009048 3300032126 Bacteria 5558
332 Ga0307415_100048938 3300032126 Bacteria 2854
333 Ga0307415_100098745 3300032126 Bacteria 2135
334 Ga0307415_100289910 3300032126 Bacteria 1350
335 Ga0373943_0006277 3300035170 Bacteria 5338
336 Ga0373946_0017448 3300035171 Bacteria 2747
337 Ga0373955_0003366 3300035172 Bacteria 7026
338 Ga0373933_0003124 3300035724 Bacteria 9231
339 Ga0373947_0204691 3300035725 Bacteria 1292
340 Ga0373937_0000641 3300036401 Bacteria 30684
341 Ga0395899_0002932 3300037312 Bacteria 13692
342 Ga0395899_0026860 3300037312 Bacteria 4342
343 Ga0395899_0035072 3300037312 Bacteria 3767
344 Ga0395899_0079131 3300037312 Bacteria 2394
345 Ga0395900_0001934 3300037418 Bacteria 23474
346 Ga0395900_0005529 3300037418 Bacteria 13234
347 Ga0395900_0009971 3300037418 Bacteria 9724
348 Ga0395900_0015181 3300037418 Bacteria 7855
349 Ga0395900_0025222 3300037418 Bacteria 6086
350 Ga0395900_0029788 3300037418 Bacteria 5602
351 Ga0395900_0034036 3300037418 Bacteria 5245
352 Ga0395900_0040568 3300037418 Bacteria 4797
353 Ga0395900_0058658 3300037418 Bacteria 3962
354 Ga0395900_0114439 3300037418 Bacteria 2768
355 Ga0395900_0119052 3300037418 Bacteria 2710
356 Ga0395900_0145305 3300037418 Bacteria 2425
357 Ga0395900_0306477 3300037418 Bacteria 1572
358 Ga0395898_0010154 3300037466 Bacteria 9854
359 Ga0395898_0027120 3300037466 Bacteria 5755
360 Ga0395898_0046070 3300037466 Bacteria 4283
361 Ga0395898_0103628 3300037466 Bacteria 2729
362 Ga0395898_0158299 3300037466 Bacteria 2166
363 Ga0395898_0195716 3300037466 Bacteria 1931
364 Ga0395905_0000092 3300037471 Bacteria 149300
365 Ga0395905_0000335 3300037471 Bacteria 67466
366 Ga0395905_0005333 3300037471 Bacteria 13138
367 Ga0395905_0006258 3300037471 Bacteria 12011
368 Ga0395905_0006387 3300037471 Bacteria 11879
369 Ga0395905_0011235 3300037471 Bacteria 8656
370 Ga0395905_0020672 3300037471 Bacteria 6232
371 Ga0395905_0022735 3300037471 Bacteria 5929
372 Ga0395905_0023416 3300037471 Bacteria 5836
373 Ga0395905_0031197 3300037471 Bacteria 5018
374 Ga0395905_0036477 3300037471 Bacteria 4618
375 Ga0395905_0070674 3300037471 Bacteria 3272
376 Ga0395905_0130831 3300037471 Bacteria 2360
377 Ga0395905_0135774 3300037471 Bacteria 2314
378 Ga0395905_0141581 3300037471 Bacteria 2262
379 Ga0395905_0151858 3300037471 Bacteria 2179
380 Ga0395905_0286643 3300037471 Bacteria 1534
381 Ga0395905_0326090 3300037471 Bacteria 1425
382 Ga0395905_0427668 3300037471 Bacteria 1221
383 Ga0395901_0000268 3300038443 Bacteria 64837
384 Ga0395901_0006463 3300038443 Bacteria 11870
385 Ga0395901_0022295 3300038443 Bacteria 6489
386 Ga0395901_0024937 3300038443 Bacteria 6139
387 Ga0395901_0041762 3300038443 Bacteria 4754
388 Ga0395901_0087036 3300038443 Bacteria 3267
389 Ga0395901_0132346 3300038443 Bacteria 2620
390 Ga0395901_0599281 3300038443 Bacteria 1111
391 Ga0436365_0258191 3300039437 Bacteria 5188
392 Ga0439448_0004371 3300042005 Bacteria 3991
393 Ga0439455_0033060 3300042012 Bacteria 1296
394 Ga0450905_001868 3300042142 Bacteria 2698
395 Ga0450889_000963 3300042144 Bacteria 3053
396 Ga0439458_0000879 3300042157 Bacteria 7761
397 Ga0466969_0028736 3300044656 Bacteria 2842
398 Ga0466965_0113856 3300044683 Bacteria 1392
399 Ga0466966_0006364 3300044684 Bacteria 7808
400 Ga0466963_0013414 3300044694 Bacteria 5032
401 Ga0466963_0026677 3300044694 Bacteria 3695
402 Ga0466963_0068778 3300044694 Bacteria 2379
403 Ga0466968_0049326 3300044735 Bacteria 1793
404 Ga0466970_0026096 3300044765 Bacteria 3062
405 Ga0466957_0020130 3300044842 Bacteria 3927
406 Ga0466959_0083217 3300045049 Bacteria 2305
407 Ga0466958_0079886 3300045836 Bacteria 2012
408 Ga0466967_0011367 3300045976 Bacteria 6738
409 Ga0466967_0044267 3300045976 Bacteria 3860
410 Ga0466967_0057899 3300045976 Bacteria 3423
411 Ga0466967_0082136 3300045976 Bacteria 2911
412 Ga0466967_0088601 3300045976 Bacteria 2809
413 Ga0466967_0099649 3300045976 Bacteria 2654
414 Ga0466967_0101058 3300045976 Bacteria 2635
415 Ga0495663_0008353 3300046525 Bacteria 2867
416 Ga0495598_0000321 3300046537 Bacteria 8586
417 Ga0495633_0027126 3300046558 Bacteria 2802
418 Ga0495668_0010102 3300046616 Bacteria 5742
419 Ga0495623_0039546 3300046679 Bacteria 3014
420 Ga0495669_0001789 3300046684 Bacteria 8773
421 Ga0495669_0004121 3300046684 Bacteria 5980
422 Ga0495669_0005893 3300046684 Bacteria 5108
423 Ga0495669_0020893 3300046684 Bacteria 2836
424 Ga0495669_0030146 3300046684 Bacteria 2381
425 Ga0495670_0030861 3300046691 Bacteria 2662
426 Ga0495677_0033490 3300047445 Bacteria 1873
427 Ga0496100_0032640 3300048903 Bacteria 3249
428 Ga0496101_0211790 3300048904 Bacteria 1501
429 Ga0496102_0177546 3300048905 Bacteria 2006
430 Ga0496104_0270424 3300048907 Bacteria 1612
431 Ga0496106_0189659 3300048909 Bacteria 1634
432 Ga0496107_0009911 3300048910 Bacteria 6612
433 Ga0496107_0048496 3300048910 Bacteria 3060
434 Ga0496107_0052450 3300048910 Bacteria 2942
435 Ga0496107_0058961 3300048910 Bacteria 2777
436 Ga0496108_0060829 3300048911 Bacteria 3178
437 Ga0496108_0143267 3300048911 Bacteria 2059
438 Ga0496108_0272255 3300048911 Bacteria 1474
439 Ga0496109_0059456 3300048912 Bacteria 3491
440 Ga0496109_0075377 3300048912 Bacteria 3102
441 Ga0496109_0136274 3300048912 Bacteria 2294
442 Ga0496109_0405231 3300048912 Bacteria 1288
443 Ga0496110_0001568 3300048913 Bacteria 16665
444 Ga0496111_0008369 3300048914 Bacteria 6840
445 Ga0496111_0027580 3300048914 Bacteria 4019
446 Ga0496112_0018841 3300048915 Bacteria 6503
447 Ga0496112_0030541 3300048915 Bacteria 5215
448 Ga0496113_0073155 3300048916 Bacteria 2610
449 Ga0496114_0000019 3300048917 Bacteria 244365
450 Ga0496114_0058337 3300048917 Bacteria 3223
451 Ga0496115_0000471 3300048918 Bacteria 32135
452 Ga0496115_0017809 3300048918 Bacteria 5440
453 Ga0501074_0022451 3300049590 Bacteria 4584
454 Ga0501268_015827 3300049765 Bacteria 1244
455 nmdc:mga08y16_200487_c1 3300050511 Bacteria 2068
456 Ga0500658_0000072 3300053134 Bacteria 46284
457 Ga0466962_0083405 3300061719 Bacteria 1529
458 Ga0068857_100285459
459 JGI24741J21665_1001631
460 JGI24741J21665_1013537
461 JGI24740J21852_10002961
462 JGI24740J21852_10004266
463 JGI24743J22301_10026893
464 JGI24735J21928_10023797
465 Ga0070658_10005551
466 Ga0070658_10017732
467 Ga0070658_10053689
468 Ga0070658_10054934
469 Ga0070658_10064636
470 Ga0070658_10256704
471 Ga0070676_10099455
472 Ga0070683_100005329
473 Ga0070683_100005954
474 Ga0070683_100319226
475 Ga0070683_100321603
476 Ga0070683_100376005
477 Ga0070683_100432602
478 Ga0070690_100008918
479 Ga0070670_100001001
480 Ga0070670_100012550
481 Ga0070670_100046189
482 Ga0070670_100072199
483 Ga0070680_100018341
484 Ga0070680_100107512
485 Ga0070680_100116246
486 Ga0068868_100146982
487 Ga0070660_100006172
488 Ga0070660_100011159
489 Ga0070660_100038807
490 Ga0070660_100142742
491 Ga0070660_100178345
492 Ga0070660_100244824
493 Ga0070660_100365353
494 Ga0070691_10000244
495 Ga0070661_100002207
496 Ga0070661_100041470
497 Ga0070661_100240262
498 Ga0070661_100271521
499 Ga0070692_10038842
500 Ga0070692_10051705
501 Ga0070669_100009572
502 Ga0070669_100027278
503 Ga0070675_100001926
504 Ga0070675_100005465
505 Ga0070671_100001542
506 Ga0070671_100005726
507 Ga0070671_100010433
508 Ga0070671_100096619
509 Ga0070671_100242370
510 Ga0070674_100160970
511 Ga0070673_100000993
512 Ga0070673_100001556
513 Ga0070673_100064786
514 Ga0070659_100004407
515 Ga0070659_100060144
516 Ga0070659_100060200
517 Ga0070659_100139429
518 Ga0070659_100195991
519 Ga0070659_100197347
520 Ga0070667_100006579
521 Ga0070667_100048225
522 Ga0070709_10016373
523 Ga0070714_100028814
524 Ga0070714_100097161
525 Ga0070713_100007373
526 Ga0070663_100053737
527 Ga0070663_100080816
528 Ga0070663_100100491
529 Ga0070663_100243113
530 Ga0070678_100008713
531 Ga0070678_100036450
532 Ga0070662_100007929
533 Ga0070662_100010620
534 Ga0070662_100020139
535 Ga0070662_100021145
536 Ga0070662_100026907
537 Ga0070662_100032174
538 Ga0070681_10129846
539 Ga0068867_100051705
540 Ga0068867_100149581
541 Ga0070685_10061136
542 Ga0070706_100074492
543 Ga0070684_100016889
544 Ga0070684_100262947
545 Ga0068853_100024647
546 Ga0068853_100045363
547 Ga0068853_100078154
548 Ga0068853_100195231
549 Ga0068853_100422952
550 Ga0068853_100517429
551 Ga0070672_100001499
552 Ga0070672_100022352
553 Ga0070672_100071231
554 Ga0070672_100436949
555 Ga0070665_100024564
556 Ga0070665_100036913
557 Ga0068855_100013518
558 Ga0068855_100173179
559 Ga0068855_100238395
560 Ga0068855_100458399
561 Ga0070664_100001393
562 Ga0070664_100015963
563 Ga0070664_100017601
564 Ga0070664_100053874
565 Ga0068857_100028285
566 Ga0068854_100003393
567 Ga0068854_100058791
568 Ga0068854_100154772
569 Ga0068854_100320343
570 Ga0068856_100005840
571 Ga0068856_100020909
572 Ga0068856_100050113
573 Ga0068856_100072558
574 Ga0068856_100109138
575 Ga0068856_100449856
576 Ga0068852_100025108
577 Ga0068852_100028475
578 Ga0068852_100032855
579 Ga0068852_100203013
580 Ga0068852_100227553
581 Ga0068864_100045541
582 Ga0068864_100051212
583 Ga0068851_10004800
584 Ga0068851_10024247
585 Ga0068851_10105599
586 Ga0068863_100058529
587 Ga0068858_100254354
588 Ga0081539_10018188
589 Ga0081539_10043397
590 Ga0070716_100018850
591 Ga0068871_100207924
592 Ga0068871_100359754
593 Ga0105240_10052886
594 Ga0105240_10068003
595 Ga0105245_10119409
596 Ga0105245_10308719
597 Ga0105243_10122233
598 Ga0105248_10003593
599 Ga0105248_10015208
600 Ga0105248_10029128
601 Ga0105248_10033914
602 Ga0105248_10055542
603 Ga0105248_10080139
604 Ga0105237_10148370
605 Ga0105238_10005495
606 Ga0105238_10219861
607 Ga0157373_10001821
608 Ga0157373_10004692
609 Ga0157373_10107193
610 Ga0157373_10310138
611 Ga0157371_10197414
612 Ga0157370_10031267
613 Ga0157370_10118335
614 Ga0157369_10032666
615 Ga0157369_10100045
616 Ga0157369_10243671
617 Ga0157369_10273228
618 Ga0157369_10310869
619 Ga0157369_10311657
620 Ga0157374_10002080
621 Ga0157378_10321053
622 Ga0163162_10444687
623 Ga0157372_10007723
624 Ga0157372_10096344
625 Ga0157372_10118594
626 Ga0157375_10004032
627 Ga0157375_10034222
628 Ga0157375_10220604
629 Ga0157375_10345288
630 Ga0163163_10008358
631 Ga0163163_10363331
632 Ga0157379_10236061
633 Ga0213876_10014519
634 Ga0207656_10011962
635 Ga0207680_10063869
636 Ga0207647_10000619
637 Ga0207647_10001347
638 Ga0207647_10016980
639 Ga0207647_10020336
640 Ga0207647_10101040
641 Ga0207645_10105320
642 Ga0207705_10001814
643 Ga0207705_10015879
644 Ga0207705_10024342
645 Ga0207705_10060370
646 Ga0207705_10146097
647 Ga0207684_10057228
648 Ga0207707_10149873
649 Ga0207695_10008629
650 Ga0207660_10005394
651 Ga0207660_10071258
652 Ga0207660_10078649
653 Ga0207660_10316090
654 Ga0207662_10026295
655 Ga0207657_10003669
656 Ga0207657_10006343
657 Ga0207657_10008323
658 Ga0207657_10018102
659 Ga0207657_10183397
660 Ga0207657_10199324
661 Ga0207649_10010302
662 Ga0207649_10055494
663 Ga0207649_10174144
664 Ga0207649_10224325
665 Ga0207649_10314771
666 Ga0207649_10333228
667 Ga0207652_10102528
668 Ga0207681_10261513
669 Ga0207694_10005058
670 Ga0207650_10000583
671 Ga0207650_10057645
672 Ga0207659_10001196
673 Ga0207687_10200744
674 Ga0207700_10079534
675 Ga0207700_10476069
676 Ga0207664_10054652
677 Ga0207664_10127645
678 Ga0207664_10305394
679 Ga0207644_10002620
680 Ga0207644_10005034
681 Ga0207644_10054166
682 Ga0207644_10091479
683 Ga0207690_10001581
684 Ga0207690_10013687
685 Ga0207690_10198803
686 Ga0207690_10309920
687 Ga0207706_10007840
688 Ga0207706_10017444
689 Ga0207706_10030592
690 Ga0207706_10033907
691 Ga0207706_10048653
692 Ga0207706_10081208
693 Ga0207706_10101597
694 Ga0207706_10107043
695 Ga0207706_10113793
696 Ga0207706_10117130
697 Ga0207706_10176283
698 Ga0207669_10068311
699 Ga0207691_10003881
700 Ga0207691_10033788
701 Ga0207691_10158345
702 Ga0207691_10298612
703 Ga0207711_10020280
704 Ga0207711_10026773
705 Ga0207711_10034719
706 Ga0207711_10075468
707 Ga0207661_10019848
708 Ga0207661_10094422
709 Ga0207661_10119156
710 Ga0207661_10265147
711 Ga0207679_10015006
712 Ga0207679_10108783
713 Ga0207679_10287064
714 Ga0207667_10006500
715 Ga0207667_10017358
716 Ga0207667_10039017
717 Ga0207651_10001902
718 Ga0207651_10065327
719 Ga0207651_10069792
720 Ga0207640_10051303
721 Ga0207640_10089416
722 Ga0207658_10185182
723 Ga0207658_10372227
724 Ga0207677_10000918
725 Ga0207703_10230588
726 Ga0207639_10041497
727 Ga0207639_10043773
728 Ga0207639_10086561
729 Ga0207678_10008367
730 Ga0207678_10118421
731 Ga0207678_10149874
732 Ga0207678_10267223
733 Ga0207702_10024116
734 Ga0207702_10031608
735 Ga0207702_10279145
736 Ga0207641_10082956
737 Ga0207641_10258032
738 Ga0207648_10082056
739 Ga0207648_10091221
740 Ga0207676_10034949
741 Ga0207676_10041881
742 Ga0207676_10205267
743 Ga0207674_10015977
744 Ga0207674_10024091
745 Ga0207674_10177091
746 Ga0207683_10003300
747 Ga0207683_10043822
748 Ga0207698_10002029
749 Ga0207698_10035534
750 Ga0268266_10061736
751 Ga0268266_10455643
752 Ga0307408_100014986
753 Ga0307408_100030405
754 Ga0307405_10009292
755 Ga0307405_10292354
756 Ga0307413_10016889
757 Ga0307413_10039222
758 Ga0307413_10041305
759 Ga0307413_10051485
760 Ga0307413_10075039
761 Ga0307410_10014240
762 Ga0307410_10034401
763 Ga0307410_10060308
764 Ga0307410_10210943
765 Ga0307407_10004515
766 Ga0307407_10004807
767 Ga0307412_10072733
768 Ga0307412_10111334
769 Ga0307409_100012135
770 Ga0307409_100022741
771 Ga0307409_100168079
772 Ga0307409_100606353
773 Ga0307416_100006127
774 Ga0307416_100056925
775 Ga0307416_100090740
776 Ga0307416_100095103
777 Ga0307414_10003641
778 Ga0307414_10008404
779 Ga0307414_10011676
780 Ga0307414_10035747
781 Ga0307414_10191067
782 Ga0307411_10010123
783 Ga0307411_10094671
784 Ga0307411_10096274
785 Ga0307411_10115082
786 Ga0307415_100002508
787 Ga0307415_100008711
788 Ga0307415_100009048
789 Ga0307415_100048938
790 Ga0307415_100098745
791 Ga0307415_100289910
792 Ga0373943_0006277
793 Ga0373946_0017448
794 Ga0373955_0003366
795 Ga0373933_0003124
796 Ga0373947_0204691
797 Ga0373937_0000641
798 Ga0395899_0002932
799 Ga0395899_0026860
800 Ga0395899_0035072
801 Ga0395899_0079131
802 Ga0395900_0001934
803 Ga0395900_0005529
804 Ga0395900_0009971
805 Ga0395900_0015181
806 Ga0395900_0025222
807 Ga0395900_0029788
808 Ga0395900_0034036
809 Ga0395900_0040568
810 Ga0395900_0058658
811 Ga0395900_0114439
812 Ga0395900_0119052
813 Ga0395900_0145305
814 Ga0395900_0306477
815 Ga0395898_0010154
816 Ga0395898_0027120
817 Ga0395898_0046070
818 Ga0395898_0103628
819 Ga0395898_0158299
820 Ga0395898_0195716
821 Ga0395905_0000092
822 Ga0395905_0000335
823 Ga0395905_0005333
824 Ga0395905_0006258
825 Ga0395905_0006387
826 Ga0395905_0011235
827 Ga0395905_0020672
828 Ga0395905_0022735
829 Ga0395905_0023416
830 Ga0395905_0031197
831 Ga0395905_0036477
832 Ga0395905_0070674
833 Ga0395905_0130831
834 Ga0395905_0135774
835 Ga0395905_0141581
836 Ga0395905_0151858
837 Ga0395905_0286643
838 Ga0395905_0326090
839 Ga0395905_0427668
840 Ga0395901_0000268
841 Ga0395901_0006463
842 Ga0395901_0022295
843 Ga0395901_0024937
844 Ga0395901_0041762
845 Ga0395901_0087036
846 Ga0395901_0132346
847 Ga0395901_0599281
848 Ga0436365_0258191
849 Ga0439448_0004371
850 Ga0439455_0033060
851 Ga0450905_001868
852 Ga0450889_000963
853 Ga0439458_0000879
854 Ga0466969_0028736
855 Ga0466965_0113856
856 Ga0466966_0006364
857 Ga0466963_0013414
858 Ga0466963_0026677
859 Ga0466963_0068778
860 Ga0466968_0049326
861 Ga0466970_0026096
862 Ga0466957_0020130
863 Ga0466959_0083217
864 Ga0466958_0079886
865 Ga0466967_0011367
866 Ga0466967_0044267
867 Ga0466967_0057899
868 Ga0466967_0082136
869 Ga0466967_0088601
870 Ga0466967_0099649
871 Ga0466967_0101058
872 Ga0495663_0008353
873 Ga0495598_0000321
874 Ga0495633_0027126
875 Ga0495668_0010102
876 Ga0495623_0039546
877 Ga0495669_0001789
878 Ga0495669_0004121
879 Ga0495669_0005893
880 Ga0495669_0020893
881 Ga0495669_0030146
882 Ga0495670_0030861
883 Ga0495677_0033490
884 Ga0496100_0032640
885 Ga0496101_0211790
886 Ga0496102_0177546
887 Ga0496104_0270424
888 Ga0496106_0189659
889 Ga0496107_0009911
890 Ga0496107_0048496
891 Ga0496107_0052450
892 Ga0496107_0058961
893 Ga0496108_0060829
894 Ga0496108_0143267
895 Ga0496108_0272255
896 Ga0496109_0059456
897 Ga0496109_0075377
898 Ga0496109_0136274
899 Ga0496109_0405231
900 Ga0496110_0001568
901 Ga0496111_0008369
902 Ga0496111_0027580
903 Ga0496112_0018841
904 Ga0496112_0030541
905 Ga0496113_0073155
906 Ga0496114_0000019
907 Ga0496114_0058337
908 Ga0496115_0000471
909 Ga0496115_0017809
910 Ga0501074_0022451
911 Ga0501268_015827
912 nmdc:mga08y16_200487_c1
913 Ga0500658_0000072
914 Ga0466962_0083405

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

13

269

0.93

PF04321

RmlD_sub_bind

RmlD substrate binding domain

11

243

0.92

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

14

332

0.85

PF08659

KR

KR domain

11

149

0.84

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

13

251

0.76

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

14

246

0.72

PF07993

NAD_binding_4

Male sterility protein

15

196

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u4q-assembly1.cif.gz_A 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad. 0.8666 1 330
4lk3-assembly1.cif.gz_D crystal structure of human udp-xylose synthase r236a substitution 0.8633 2 329
5u4q-assembly1.cif.gz_A 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad. 0.8618 1 330
4lk3-assembly1.cif.gz_C crystal structure of human udp-xylose synthase r236a substitution 0.8584 2 329
4m55-assembly1.cif.gz_B crystal structure of human udp-xylose synthase r236h substitution 0.8576 3 329
ID Description Score Start End Superfamily
af_B7ZXP4_113_239_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8647 3 132 3.40.50.720
2c20D02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.8472 261 326 3.90.25.10
5u4qA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.846 1 330 3.40.50.720
af_K7VFN4_114_450_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8442 1 328 3.40.50.720
5u4qA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8434 1 330 3.40.50.720
ID Description Score Start End GO Terms
AF-B9TG48-F1-model_v4 UDP-glucuronate 5-epimerase, putative (EC 5.1.3.12) 0.9316 192 330 GO:0016853
AF-A0A523M0X6-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9277 1 127
AF-A0A523M0X6-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9208 1 127
AF-A0A3N5FVA0-F1-model_v4 UDP-glucose 4-epimerase (Galactowaldenase) (UDP-galactose 4-epimerase) 0.9023 1 129 GO:0033499
AF-A0A448ZSU3-F1-model_v4 NAD(P)-binding domain-containing protein 0.9021 192 327

Map