F447847

General Info

Members Datasets Scaffolds Average Seq Length
456 305 912 152

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0009459|Ga0466959_0009459_3406_3897
Length 163
Sequence VAADAHGDAVMTPELHTEYAFTITARIAEVTTAGEIGHGVRRIIPIIGGDVRGEKVNGKVLPFGADFQIIRPNELIDLEAKYAFETDDGAVVYVENRGIRFGPVDLLQKLRRGEAVDPKLIYFRTVPKFETGSEKYRWLMQHIFVASAARHADRVVIDVHMVL

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
74 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
75 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
76 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
77 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
135 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
143 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
174 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
175 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
176 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
179 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
180 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
181 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
182 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
186 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
187 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
190 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
215 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
216 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
234 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
255 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
258 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
259 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
260 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
261 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
262 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
264 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
267 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
268 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
269 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
270 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
271 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
272 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
273 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
274 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
275 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
276 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
277 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
278 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
279 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
280 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
281 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
282 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
283 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
284 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
285 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
286 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
287 2906610324
288 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
289 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
290 2922425934
291 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
292 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
293 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
294 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
295 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
296 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
297 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
298 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
299 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
300 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
301 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
302 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
303 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
304 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
305 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.29
Metatranscriptomes 0
Isolates 7.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.14
Nodule 6.58
Rhizoplane 3.95
Rhizosphere 71.71
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0009459 3300045049 Bacteria 6934
2 JGI24736J21556_1032796 3300001904 Bacteria 802
3 JGI25165J46597_1013781 3300003214 Bacteria 1106
4 JGI25153J46596_10014167 3300003215 Bacteria 3331
5 Ga0070683_100021532 3300005329 Bacteria 5754
6 Ga0070683_100090892 3300005329 Bacteria 2866
7 Ga0070670_100494962 3300005331 Bacteria 1086
8 Ga0068869_100001994 3300005334 Bacteria 12265
9 Ga0070666_10407763 3300005335 Bacteria 978
10 Ga0070680_100102455 3300005336 Bacteria 2377
11 Ga0070680_100659231 3300005336 Bacteria 900
12 Ga0070680_100987793 3300005336 Bacteria 727
13 Ga0068868_100640403 3300005338 Bacteria 945
14 Ga0070660_100568802 3300005339 Bacteria 946
15 Ga0070691_10118871 3300005341 Bacteria 1329
16 Ga0070668_100086013 3300005347 Bacteria 2472
17 Ga0070668_100335252 3300005347 Bacteria 1276
18 Ga0070675_102076053 3300005354 Bacteria 524
19 Ga0070674_100312046 3300005356 Bacteria 1258
20 Ga0070667_100035580 3300005367 Bacteria 4172
21 Ga0070667_100283167 3300005367 Bacteria 1489
22 Ga0070709_10196311 3300005434 Bacteria 1427
23 Ga0070714_100045387 3300005435 Bacteria 3725
24 Ga0070713_100045777 3300005436 Bacteria 3587
25 Ga0070713_100086571 3300005436 Bacteria 2686
26 Ga0070713_100590160 3300005436 Bacteria 1055
27 Ga0070713_101174490 3300005436 Bacteria 743
28 Ga0070710_10070490 3300005437 Bacteria 2013
29 Ga0070701_10079365 3300005438 Bacteria 1773
30 Ga0070711_100040962 3300005439 Bacteria 3126
31 Ga0070711_100171601 3300005439 Bacteria 1653
32 Ga0070711_100317464 3300005439 Bacteria 1244
33 Ga0070663_100097902 3300005455 Bacteria 2184
34 Ga0070663_100113203 3300005455 Bacteria 2041
35 Ga0070681_10006411 3300005458 Bacteria 11447
36 Ga0070681_10094845 3300005458 Bacteria 2932
37 Ga0070681_10118751 3300005458 Bacteria 2581
38 Ga0070681_10131987 3300005458 Bacteria 2430
39 Ga0070681_10679740 3300005458 Bacteria 945
40 Ga0070679_100013787 3300005530 Bacteria 7745
41 Ga0070679_100061059 3300005530 Bacteria 3757
42 Ga0070684_100105050 3300005535 Bacteria 2527
43 Ga0070684_100113719 3300005535 Bacteria 2429
44 Ga0070684_100468896 3300005535 Bacteria 1164
45 Ga0070693_100419872 3300005547 Bacteria 932
46 Ga0070693_101092347 3300005547 Bacteria 608
47 Ga0070665_101047213 3300005548 Bacteria 828
48 Ga0068855_100031922 3300005563 Bacteria 6287
49 Ga0068855_100438059 3300005563 Bacteria 1428
50 Ga0068855_101339370 3300005563 Bacteria 740
51 Ga0068857_100123680 3300005577 Bacteria 2331
52 Ga0068854_100922690 3300005578 Bacteria 769
53 Ga0068856_100382137 3300005614 Bacteria 1427
54 Ga0068852_100413238 3300005616 Bacteria 1330
55 Ga0068859_100017039 3300005617 Bacteria 7294
56 Ga0068863_100332307 3300005841 Bacteria 1477
57 Ga0068860_100029352 3300005843 Bacteria 5288
58 Ga0081540_1077283 3300005983 Bacteria 1513
59 Ga0081540_1106955 3300005983 Bacteria 1192
60 Ga0081539_10038933 3300005985 Bacteria 2812
61 Ga0070717_10322888 3300006028 Bacteria 1376
62 Ga0070717_10341734 3300006028 Bacteria 1337
63 Ga0070717_10362507 3300006028 Bacteria 1297
64 Ga0075365_10017395 3300006038 Bacteria 4398
65 Ga0075365_10030586 3300006038 Bacteria 3450
66 Ga0075363_100045660 3300006048 Bacteria 2323
67 Ga0075364_10201622 3300006051 Bacteria 1348
68 Ga0070712_100031659 3300006175 Bacteria 3565
69 Ga0070712_100269662 3300006175 Bacteria 1367
70 Ga0075367_10006789 3300006178 Bacteria 5814
71 Ga0075369_10006142 3300006186 Bacteria 4530
72 Ga0075366_10007343 3300006195 Bacteria 6079
73 Ga0097621_100292040 3300006237 Bacteria 1437
74 Ga0097621_101431114 3300006237 Bacteria 655
75 Ga0075370_10052052 3300006353 Bacteria 2322
76 Ga0097620_100017039 3300006931 Bacteria 7294
77 Ga0099794_10295223 3300007265 Bacteria 839
78 Ga0105250_10185397 3300009092 Bacteria 874
79 Ga0105240_10181246 3300009093 Bacteria 2485
80 Ga0105240_11080344 3300009093 Bacteria 855
81 Ga0105240_11203565 3300009093 Bacteria 802
82 Ga0105245_11102764 3300009098 Bacteria 840
83 Ga0105247_10028283 3300009101 Bacteria 3391
84 Ga0105243_10204641 3300009148 Bacteria 1733
85 Ga0105243_10208125 3300009148 Bacteria 1720
86 Ga0105243_12100024 3300009148 Bacteria 601
87 Ga0105241_10210204 3300009174 Bacteria 1630
88 Ga0105248_10314185 3300009177 Bacteria 1765
89 Ga0105248_12396727 3300009177 Bacteria 601
90 Ga0105237_10037178 3300009545 Bacteria 4923
91 Ga0105237_10055811 3300009545 Bacteria 3956
92 Ga0105237_10087362 3300009545 Bacteria 3107
93 Ga0105237_11150443 3300009545 Bacteria 783
94 Ga0105237_11431829 3300009545 Bacteria 697
95 Ga0105238_10092679 3300009551 Bacteria 3009
96 Ga0105238_10259971 3300009551 Bacteria 1715
97 Ga0105238_10279550 3300009551 Bacteria 1650
98 Ga0105249_10221416 3300009553 Bacteria 1862
99 Ga0105249_10386054 3300009553 Bacteria 1427
100 Ga0105249_10519603 3300009553 Bacteria 1238
101 Ga0105239_10044376 3300010375 Bacteria 4874
102 Ga0105239_10062474 3300010375 Bacteria 4088
103 Ga0105246_10089557 3300011119 Bacteria 2214
104 Ga0105246_10119787 3300011119 Bacteria 1948
105 Ga0105246_10285463 3300011119 Bacteria 1326
106 Ga0105246_10434537 3300011119 Bacteria 1099
107 Ga0157370_10140393 3300013104 Bacteria 2251
108 Ga0157369_10107060 3300013105 Bacteria 2975
109 Ga0157369_10112694 3300013105 Bacteria 2889
110 Ga0157369_10402407 3300013105 Bacteria 1420
111 Ga0157374_10235909 3300013296 Bacteria 1798
112 Ga0157378_10184324 3300013297 Bacteria 1965
113 Ga0157378_10397889 3300013297 Bacteria 1356
114 Ga0163162_10390835 3300013306 Bacteria 1524
115 Ga0163162_11141064 3300013306 Bacteria 884
116 Ga0157372_10206646 3300013307 Bacteria 2275
117 Ga0157372_10382852 3300013307 Bacteria 1639
118 Ga0157375_10852695 3300013308 Bacteria 1057
119 Ga0163163_10308516 3300014325 Bacteria 1635
120 Ga0182008_10207792 3300014497 Bacteria 998
121 Ga0163161_10834102 3300017792 Bacteria 777
122 Ga0214544_1000011 3300021320 Bacteria 262952
123 Ga0214542_1000009 3300021321 Bacteria 262861
124 Ga0214542_1040062 3300021321 Bacteria 1218
125 Ga0214545_1000007 3300021324 Bacteria 262984
126 Ga0214545_1041180 3300021324 Bacteria 1218
127 Ga0214543_1000020 3300021327 Bacteria 262861
128 Ga0213873_10061376 3300021358 Bacteria 1018
129 Ga0213876_10011587 3300021384 Bacteria 4705
130 Ga0213876_10054771 3300021384 Bacteria 2105
131 Ga0213876_10440204 3300021384 Bacteria 693
132 Ga0213875_10022610 3300021388 Bacteria 3007
133 Ga0209563_101110 3300025230 Bacteria 7671
134 Ga0209677_104044 3300025253 Bacteria 4412
135 Ga0209233_1010697 3300025261 Bacteria 2735
136 Ga0209758_1007765 3300025297 Bacteria 7183
137 Ga0209257_1025144 3300025304 Bacteria 2041
138 Ga0207697_10025985 3300025315 Bacteria 2394
139 Ga0207697_10323130 3300025315 Bacteria 685
140 Ga0207692_10017378 3300025898 Bacteria 3207
141 Ga0207642_10213735 3300025899 Bacteria 1073
142 Ga0207688_10117922 3300025901 Bacteria 1547
143 Ga0207647_10012006 3300025904 Bacteria 6046
144 Ga0207699_10136617 3300025906 Bacteria 1606
145 Ga0207684_10271459 3300025910 Bacteria 1463
146 Ga0207654_10180666 3300025911 Bacteria 1376
147 Ga0207707_10000143 3300025912 Bacteria 74226
148 Ga0207707_10022062 3300025912 Bacteria 5565
149 Ga0207707_10032714 3300025912 Bacteria 4552
150 Ga0207707_10252612 3300025912 Bacteria 1531
151 Ga0207707_11332052 3300025912 Bacteria 575
152 Ga0207695_10061524 3300025913 Bacteria 3880
153 Ga0207695_10862477 3300025913 Bacteria 785
154 Ga0207671_10020738 3300025914 Bacteria 4998
155 Ga0207671_10101351 3300025914 Bacteria 2181
156 Ga0207671_10274893 3300025914 Bacteria 1328
157 Ga0207671_10367477 3300025914 Bacteria 1142
158 Ga0207671_10656132 3300025914 Bacteria 835
159 Ga0207671_10905477 3300025914 Bacteria 697
160 Ga0207693_10076443 3300025915 Bacteria 2622
161 Ga0207663_10134551 3300025916 Bacteria 1713
162 Ga0207663_11358244 3300025916 Bacteria 572
163 Ga0207660_10048205 3300025917 Bacteria 3014
164 Ga0207660_10505213 3300025917 Bacteria 981
165 Ga0207657_10497733 3300025919 Bacteria 955
166 Ga0207652_10029772 3300025921 Bacteria 4568
167 Ga0207694_10344170 3300025924 Bacteria 1233
168 Ga0207694_11219270 3300025924 Bacteria 637
169 Ga0207650_10755923 3300025925 Bacteria 823
170 Ga0207659_10996910 3300025926 Bacteria 721
171 Ga0207687_10453352 3300025927 Bacteria 1064
172 Ga0207700_10030598 3300025928 Bacteria 3814
173 Ga0207700_10049051 3300025928 Bacteria 3138
174 Ga0207700_10168885 3300025928 Bacteria 1823
175 Ga0207706_10289120 3300025933 Bacteria 1429
176 Ga0207709_10097753 3300025935 Bacteria 1934
177 Ga0207669_10193923 3300025937 Bacteria 1468
178 Ga0207711_10468468 3300025941 Bacteria 1173
179 Ga0207689_10002116 3300025942 Bacteria 18671
180 Ga0207661_10015368 3300025944 Bacteria 5631
181 Ga0207661_10189438 3300025944 Bacteria 1802
182 Ga0207679_11495875 3300025945 Bacteria 619
183 Ga0207667_10035357 3300025949 Bacteria 5358
184 Ga0207712_10596171 3300025961 Bacteria 955
185 Ga0207712_11938116 3300025961 Bacteria 527
186 Ga0207668_10182211 3300025972 Bacteria 1658
187 Ga0207640_10190131 3300025981 Bacteria 1547
188 Ga0207640_10300749 3300025981 Bacteria 1269
189 Ga0207658_10049819 3300025986 Bacteria 3079
190 Ga0207677_10423914 3300026023 Bacteria 1134
191 Ga0207639_10081153 3300026041 Bacteria 2568
192 Ga0207678_10047687 3300026067 Bacteria 3704
193 Ga0207678_10109202 3300026067 Bacteria 2360
194 Ga0207702_10472183 3300026078 Bacteria 1220
195 Ga0207702_11453611 3300026078 Bacteria 679
196 Ga0207641_10458136 3300026088 Bacteria 1233
197 Ga0207676_10628537 3300026095 Bacteria 1034
198 Ga0207674_10078339 3300026116 Bacteria 3310
199 Ga0207698_10337896 3300026142 Bacteria 1417
200 Ga0209813_10002300 3300027866 Bacteria 4372
201 Ga0268266_11125116 3300028379 Bacteria 760
202 Ga0268265_10235330 3300028380 Bacteria 1613
203 Ga0268265_10704967 3300028380 Bacteria 975
204 Ga0268264_10039698 3300028381 Bacteria 3889
205 Ga0307408_101020702 3300031548 Bacteria 763
206 Ga0307508_10096480 3300031616 Bacteria 2548
207 Ga0307412_11297328 3300031911 Bacteria 655
208 Ga0307416_103299659 3300032002 Bacteria 540
209 Ga0373926_0229315 3300035083 Bacteria 718
210 Ga0373923_0127716 3300035111 Bacteria 1140
211 Ga0373945_0110179 3300035116 Bacteria 1086
212 Ga0373954_0028874 3300035118 Bacteria 2552
213 Ga0373954_0037561 3300035118 Bacteria 2251
214 Ga0373956_0159120 3300035119 Bacteria 1064
215 Ga0373956_0281004 3300035119 Bacteria 792
216 Ga0373943_0008191 3300035170 Bacteria 4691
217 Ga0373946_0003124 3300035171 Bacteria 5867
218 Ga0373955_0011981 3300035172 Bacteria 4155
219 Ga0373955_0356587 3300035172 Bacteria 886
220 Ga0316574_0140161 3300035398 Bacteria 1558
221 Ga0373924_0003814 3300035410 Bacteria 5215
222 Ga0373931_0531373 3300035691 Bacteria 762
223 Ga0373935_0009726 3300035692 Bacteria 5757
224 Ga0373935_0099121 3300035692 Bacteria 1918
225 Ga0373927_0000137 3300035695 Bacteria 56546
226 Ga0373927_0244219 3300035695 Bacteria 1180
227 Ga0373927_0303542 3300035695 Bacteria 1051
228 Ga0373947_0000902 3300035725 Bacteria 17985
229 Ga0373947_0028351 3300035725 Bacteria 3282
230 Ga0373937_0171770 3300036401 Bacteria 2034
231 Ga0373937_0306686 3300036401 Bacteria 1501
232 Ga0316582_0214416 3300036647 Bacteria 1316
233 Ga0373925_0071767 3300037068 Bacteria 2619
234 Ga0373925_0104170 3300037068 Bacteria 2184
235 Ga0395900_0197885 3300037418 Bacteria 2035
236 Ga0395900_0313164 3300037418 Bacteria 1552
237 Ga0395898_0014127 3300037466 Bacteria 8208
238 Ga0395898_0064270 3300037466 Bacteria 3559
239 Ga0395898_0174446 3300037466 Bacteria 2055
240 Ga0395905_0913850 3300037471 Bacteria 781
241 Ga0436364_0322622 3300037853 Bacteria 1446
242 Ga0436364_0742412 3300037853 Bacteria 1000
243 Ga0436364_0768873 3300037853 Bacteria 685
244 Ga0436364_1000533 3300037853 Bacteria 1181
245 Ga0395901_0164894 3300038443 Bacteria 2327
246 Ga0395901_0298865 3300038443 Bacteria 1669
247 Ga0395901_0537256 3300038443 Bacteria 1186
248 Ga0400483_003897 3300039062 Bacteria 2194
249 Ga0400483_046637 3300039062 Unclassified 1466
250 Ga0400483_098760 3300039062 Bacteria 2056
251 Ga0400483_122180 3300039062 Bacteria 3777
252 Ga0400483_137961 3300039062 Bacteria 1324
253 Ga0400483_192392 3300039062 Bacteria 8050
254 Ga0400483_285070 3300039062 Bacteria 2678
255 Ga0436365_0144919 3300039437 Bacteria 840
256 Ga0436365_0493666 3300039437 Bacteria 881
257 Ga0436365_0592130 3300039437 Bacteria 8188
258 Ga0436365_1035561 3300039437 Bacteria 2336
259 Ga0436360_0043624 3300039438 Bacteria 994
260 Ga0436363_0189511 3300039450 Bacteria 573
261 Ga0436363_0373754 3300039450 Bacteria 729
262 Ga0436362_0664428 3300039453 Bacteria 5651
263 Ga0466972_0000100 3300044658 Bacteria 76018
264 Ga0466963_0216764 3300044694 Bacteria 1340
265 Ga0466963_0834769 3300044694 Bacteria 650
266 Ga0466959_0090777 3300045049 Bacteria 2194
267 Ga0466958_0160695 3300045836 Bacteria 1419
268 Ga0466967_0381575 3300045976 Bacteria 1368
269 Ga0466967_0742489 3300045976 Bacteria 973
270 Ga0495592_0029318 3300046454 Bacteria 4168
271 Ga0495592_0052638 3300046454 Bacteria 3022
272 Ga0495603_0004836 3300046455 Bacteria 8053
273 Ga0495629_0000029 3300046459 Bacteria 127000
274 Ga0495641_0003605 3300046461 Bacteria 11465
275 Ga0495651_0679781 3300046462 Bacteria 643
276 Ga0495653_0446385 3300046463 Bacteria 814
277 Ga0495580_0002567 3300046472 Bacteria 15791
278 Ga0495580_0389689 3300046472 Bacteria 940
279 Ga0495580_0811442 3300046472 Bacteria 606
280 Ga0495582_0000024 3300046473 Bacteria 82444
281 Ga0495582_0319265 3300046473 Bacteria 894
282 Ga0495639_0000006 3300046475 Bacteria 100361
283 Ga0495662_0000348 3300046476 Bacteria 20253
284 Ga0495664_0016204 3300046477 Bacteria 4245
285 Ga0495664_0055532 3300046477 Bacteria 2356
286 Ga0495584_0588685 3300046491 Bacteria 567
287 Ga0495594_0000170 3300046499 Bacteria 31295
288 Ga0495596_0129108 3300046500 Bacteria 981
289 Ga0495606_0018835 3300046507 Bacteria 5163
290 Ga0495606_0042071 3300046507 Bacteria 3059
291 Ga0495610_0192300 3300046512 Bacteria 841
292 Ga0495618_0035917 3300046514 Bacteria 3110
293 Ga0495618_0218345 3300046514 Bacteria 1203
294 Ga0495620_0246039 3300046515 Bacteria 682
295 Ga0495628_0232865 3300046516 Bacteria 1380
296 Ga0495630_0022330 3300046517 Bacteria 4674
297 Ga0495632_0090405 3300046519 Bacteria 1452
298 Ga0495643_0012456 3300046522 Bacteria 5131
299 Ga0495648_0019042 3300046524 Bacteria 4841
300 Ga0495665_0000178 3300046531 Bacteria 32333
301 Ga0495665_0053691 3300046531 Bacteria 2130
302 Ga0495640_0004410 3300046533 Bacteria 11233
303 Ga0495640_0329269 3300046533 Bacteria 945
304 Ga0495597_0026243 3300046542 Bacteria 2677
305 Ga0495645_0004746 3300046543 Bacteria 9290
306 Ga0495622_0002996 3300046557 Bacteria 8018
307 Ga0495667_0040876 3300046559 Bacteria 3077
308 Ga0495656_0291625 3300046615 Bacteria 834
309 Ga0495668_0194922 3300046616 Bacteria 1109
310 Ga0495634_0000354 3300046642 Bacteria 44714
311 Ga0495634_0057346 3300046642 Bacteria 2600
312 Ga0495625_0115546 3300046660 Bacteria 1831
313 Ga0495635_0056088 3300046663 Bacteria 2713
314 Ga0495635_0135984 3300046663 Bacteria 1675
315 Ga0495599_0096712 3300046678 Bacteria 1841
316 Ga0495599_0615682 3300046678 Bacteria 631
317 Ga0495647_0000068 3300046681 Bacteria 25521
318 Ga0495658_0000428 3300046683 Bacteria 23516
319 Ga0495613_0001078 3300046689 Bacteria 20808
320 Ga0495624_0012004 3300046690 Bacteria 5937
321 Ga0495624_0047038 3300046690 Bacteria 2742
322 Ga0495649_0028025 3300046694 Bacteria 3123
323 Ga0495600_0170504 3300046809 Bacteria 1405
324 Ga0495600_0250287 3300046809 Bacteria 1127
325 Ga0495581_0000004 3300047315 Bacteria 84424
326 Ga0495581_0175640 3300047315 Bacteria 1252
327 Ga0495674_0000415 3300047319 Bacteria 38235
328 Ga0495672_0014400 3300047320 Bacteria 5417
329 Ga0495676_0082542 3300047321 Bacteria 2432
330 Ga0495680_0500369 3300047322 Bacteria 825
331 Ga0495687_012203 3300047443 Bacteria 4558
332 Ga0495684_0071064 3300047471 Bacteria 2645
333 Ga0495684_0595042 3300047471 Bacteria 747
334 Ga0495686_0248581 3300047472 Bacteria 1000
335 Ga0495593_0000198 3300047673 Bacteria 31587
336 Ga0495614_0007486 3300048089 Bacteria 4861
337 Ga0495626_0079316 3300048091 Bacteria 1461
338 Ga0496100_0166512 3300048903 Bacteria 1584
339 Ga0496100_1185014 3300048903 Bacteria 602
340 Ga0496101_0027879 3300048904 Bacteria 3939
341 Ga0496101_0228418 3300048904 Bacteria 1446
342 Ga0496102_0030028 3300048905 Bacteria 4864
343 Ga0496102_0107832 3300048905 Bacteria 2594
344 Ga0496102_0567002 3300048905 Bacteria 1058
345 Ga0496103_0012776 3300048906 Bacteria 4980
346 Ga0496104_0281402 3300048907 Bacteria 1576
347 Ga0496106_0559389 3300048909 Bacteria 917
348 Ga0496106_1077961 3300048909 Bacteria 630
349 Ga0496107_0349633 3300048910 Bacteria 1100
350 Ga0496108_0041440 3300048911 Bacteria 3844
351 Ga0496110_0116242 3300048913 Bacteria 2408
352 Ga0496111_0168629 3300048914 Bacteria 1626
353 Ga0496112_0272515 3300048915 Bacteria 1640
354 Ga0496112_0390371 3300048915 Bacteria 1332
355 Ga0496113_0069522 3300048916 Bacteria 2674
356 Ga0496116_0036633 3300048919 Bacteria 3430
357 Ga0496118_0048486 3300048921 Bacteria 3280
358 Ga0496119_0019266 3300048922 Bacteria 5036
359 Ga0496119_0110171 3300048922 Bacteria 1530
360 Ga0496121_0003594 3300048924 Bacteria 21886
361 Ga0496121_0017299 3300048924 Bacteria 7374
362 Ga0496121_0040869 3300048924 Bacteria 4062
363 Ga0496121_0398448 3300048924 Bacteria 902
364 Ga0496122_0041243 3300048925 Bacteria 3653
365 Ga0496124_0036789 3300048927 Bacteria 4264
366 Ga0496124_0158185 3300048927 Bacteria 1769
367 Ga0496125_0046550 3300048928 Bacteria 3638
368 Ga0496125_0074310 3300048928 Bacteria 2636
369 Ga0496126_0013596 3300048929 Bacteria 8265
370 Ga0496126_0035169 3300048929 Bacteria 4697
371 Ga0496126_0135082 3300048929 Bacteria 2128
372 Ga0496126_0186685 3300048929 Bacteria 1758
373 Ga0496126_0416363 3300048929 Bacteria 1087
374 Ga0501033_0072284 3300049570 Bacteria 2533
375 Ga0501034_0357708 3300049571 Bacteria 1387
376 Ga0501036_0684107 3300049572 Bacteria 848
377 Ga0501036_0951514 3300049572 Bacteria 704
378 Ga0501036_0971598 3300049572 Bacteria 696
379 Ga0501037_0924730 3300049573 Bacteria 571
380 Ga0501038_0312891 3300049574 Bacteria 1230
381 Ga0501039_0363038 3300049575 Bacteria 1138
382 Ga0501039_1223078 3300049575 Bacteria 581
383 Ga0501042_0234277 3300049578 Bacteria 1325
384 Ga0501043_0492920 3300049579 Bacteria 916
385 Ga0501043_0845392 3300049579 Bacteria 659
386 Ga0501046_0992948 3300049580 Bacteria 583
387 Ga0501047_0032110 3300049581 Bacteria 5067
388 Ga0501047_0034136 3300049581 Bacteria 4912
389 Ga0501047_0302623 3300049581 Bacteria 1441
390 Ga0501070_0042011 3300049586 Bacteria 3807
391 Ga0501070_0072776 3300049586 Bacteria 2845
392 Ga0501070_0200963 3300049586 Bacteria 1637
393 Ga0501073_0097404 3300049589 Bacteria 2043
394 Ga0501074_0043432 3300049590 Bacteria 3253
395 Ga0501080_0008505 3300049742 Bacteria 9306
396 Ga0501083_0944108 3300049744 Bacteria 561
397 Ga0501035_0042364 3300049822 Bacteria 4106
398 Ga0501035_0802294 3300049822 Bacteria 752
399 Ga0501044_0038934 3300049823 Bacteria 4964
400 Ga0501044_0266969 3300049823 Bacteria 1648
401 Ga0501044_0366509 3300049823 Bacteria 1358
402 nmdc:mga03683_55571_c1 3300050489 Bacteria 1663
403 nmdc:mga03n38_147227_c1 3300050490 Bacteria 1182
404 nmdc:mga00v17_106967_c1 3300050491 Bacteria 1771
405 nmdc:mga0yw44_18178_c1 3300050492 Bacteria 3845
406 nmdc:mga0k408_5885_c1 3300050493 Bacteria 1821
407 nmdc:mga06z11_22909_c1 3300050494 Bacteria 2925
408 nmdc:mga07m45_217407_c1 3300050496 Bacteria 1112
409 nmdc:mga08x19_760984_c1 3300050514 Bacteria 688
410 nmdc:mga0sz30_178861_c1 3300050516 Bacteria 941
411 nmdc:mga0sz30_35349_c1 3300050516 Bacteria 2085
412 Ga0495601_0141046 3300053077 Bacteria 1572
413 Ga0495601_0241168 3300053077 Bacteria 1180
414 Ga0495601_0397461 3300053077 Bacteria 894
415 Ga0495612_0012967 3300053078 Bacteria 3358
416 Ga0495619_0264866 3300053085 Bacteria 1191
417 Ga0500578_0294455 3300053086 Bacteria 964
418 Ga0500556_0000181 3300053104 Bacteria 51666
419 Ga0500645_144735 3300053730 Bacteria 656
420 2509151555 2508501128 Bacteria 8613869
421 2513715415 2513237104 Bacteria 10034502
422 2513891636 2513237141 Bacteria 8496279
423 2517105692 2517093001 Bacteria 9002274
424 2517888185 2517572143 Bacteria 9484767
425 2524435435 2524023205 Bacteria 8918781
426 2617374703 2617270741 Bacteria 8201522
427 2728753842 2728368998 Bacteria 8720350
428 2745081401 2744054633 Bacteria 8678936
429 2824653875 2824653114 Bacteria 8493680
430 2824686511 2824679649 Bacteria 8248951
431 2824740194 2824732956 Bacteria 7810675
432 2824751301 2824746037 Bacteria 7911610
433 2885418263 2885409591 Bacteria 9235467
434 2888387739 2888378607 Bacteria 9652610
435 2888389959 2888388044 Bacteria 7304136
436 2903754036 2903748898 Bacteria 9972761
437 2904695759 2904690495 Bacteria 9412302
438 2906614458
439 2908764275 2908756301 Bacteria 8864324
440 2908777186 2908775508 Bacteria 8092255
441 2922426292
442 2929622235 2929615660 Bacteria 9193770
443 2929630118 2929624759 Bacteria 9339455
444 2933584151 2933577622 Bacteria 9116884
445 2935632677 2935630451 Bacteria 8169952
446 2941508659 2941507105 Bacteria 8166816
447 2941516489 2941515067 Bacteria 8166720
448 2941524495 2941523033 Bacteria 8169134
449 3005489731 3005483717 Bacteria 7877331
450 8006932291 8006926726 Bacteria 6749210
451 8016593996 8016583857 Bacteria 10421953
452 8019561682 8019555841 Bacteria 9642137
453 8019624728 8019619141 Bacteria 9218857
454 8055743516 8055742211 Bacteria 9226248
455 8056683445 8056681323 Bacteria 8472857
456 8056690822 8056689827 Bacteria 6712655
457 Ga0466959_0009459
458 JGI24736J21556_1032796
459 JGI25165J46597_1013781
460 JGI25153J46596_10014167
461 Ga0070683_100021532
462 Ga0070683_100090892
463 Ga0070670_100494962
464 Ga0068869_100001994
465 Ga0070666_10407763
466 Ga0070680_100102455
467 Ga0070680_100659231
468 Ga0070680_100987793
469 Ga0068868_100640403
470 Ga0070660_100568802
471 Ga0070691_10118871
472 Ga0070668_100086013
473 Ga0070668_100335252
474 Ga0070675_102076053
475 Ga0070674_100312046
476 Ga0070667_100035580
477 Ga0070667_100283167
478 Ga0070709_10196311
479 Ga0070714_100045387
480 Ga0070713_100045777
481 Ga0070713_100086571
482 Ga0070713_100590160
483 Ga0070713_101174490
484 Ga0070710_10070490
485 Ga0070701_10079365
486 Ga0070711_100040962
487 Ga0070711_100171601
488 Ga0070711_100317464
489 Ga0070663_100097902
490 Ga0070663_100113203
491 Ga0070681_10006411
492 Ga0070681_10094845
493 Ga0070681_10118751
494 Ga0070681_10131987
495 Ga0070681_10679740
496 Ga0070679_100013787
497 Ga0070679_100061059
498 Ga0070684_100105050
499 Ga0070684_100113719
500 Ga0070684_100468896
501 Ga0070693_100419872
502 Ga0070693_101092347
503 Ga0070665_101047213
504 Ga0068855_100031922
505 Ga0068855_100438059
506 Ga0068855_101339370
507 Ga0068857_100123680
508 Ga0068854_100922690
509 Ga0068856_100382137
510 Ga0068852_100413238
511 Ga0068859_100017039
512 Ga0068863_100332307
513 Ga0068860_100029352
514 Ga0081540_1077283
515 Ga0081540_1106955
516 Ga0081539_10038933
517 Ga0070717_10322888
518 Ga0070717_10341734
519 Ga0070717_10362507
520 Ga0075365_10017395
521 Ga0075365_10030586
522 Ga0075363_100045660
523 Ga0075364_10201622
524 Ga0070712_100031659
525 Ga0070712_100269662
526 Ga0075367_10006789
527 Ga0075369_10006142
528 Ga0075366_10007343
529 Ga0097621_100292040
530 Ga0097621_101431114
531 Ga0075370_10052052
532 Ga0097620_100017039
533 Ga0099794_10295223
534 Ga0105250_10185397
535 Ga0105240_10181246
536 Ga0105240_11080344
537 Ga0105240_11203565
538 Ga0105245_11102764
539 Ga0105247_10028283
540 Ga0105243_10204641
541 Ga0105243_10208125
542 Ga0105243_12100024
543 Ga0105241_10210204
544 Ga0105248_10314185
545 Ga0105248_12396727
546 Ga0105237_10037178
547 Ga0105237_10055811
548 Ga0105237_10087362
549 Ga0105237_11150443
550 Ga0105237_11431829
551 Ga0105238_10092679
552 Ga0105238_10259971
553 Ga0105238_10279550
554 Ga0105249_10221416
555 Ga0105249_10386054
556 Ga0105249_10519603
557 Ga0105239_10044376
558 Ga0105239_10062474
559 Ga0105246_10089557
560 Ga0105246_10119787
561 Ga0105246_10285463
562 Ga0105246_10434537
563 Ga0157370_10140393
564 Ga0157369_10107060
565 Ga0157369_10112694
566 Ga0157369_10402407
567 Ga0157374_10235909
568 Ga0157378_10184324
569 Ga0157378_10397889
570 Ga0163162_10390835
571 Ga0163162_11141064
572 Ga0157372_10206646
573 Ga0157372_10382852
574 Ga0157375_10852695
575 Ga0163163_10308516
576 Ga0182008_10207792
577 Ga0163161_10834102
578 Ga0214544_1000011
579 Ga0214542_1000009
580 Ga0214542_1040062
581 Ga0214545_1000007
582 Ga0214545_1041180
583 Ga0214543_1000020
584 Ga0213873_10061376
585 Ga0213876_10011587
586 Ga0213876_10054771
587 Ga0213876_10440204
588 Ga0213875_10022610
589 Ga0209563_101110
590 Ga0209677_104044
591 Ga0209233_1010697
592 Ga0209758_1007765
593 Ga0209257_1025144
594 Ga0207697_10025985
595 Ga0207697_10323130
596 Ga0207692_10017378
597 Ga0207642_10213735
598 Ga0207688_10117922
599 Ga0207647_10012006
600 Ga0207699_10136617
601 Ga0207684_10271459
602 Ga0207654_10180666
603 Ga0207707_10000143
604 Ga0207707_10022062
605 Ga0207707_10032714
606 Ga0207707_10252612
607 Ga0207707_11332052
608 Ga0207695_10061524
609 Ga0207695_10862477
610 Ga0207671_10020738
611 Ga0207671_10101351
612 Ga0207671_10274893
613 Ga0207671_10367477
614 Ga0207671_10656132
615 Ga0207671_10905477
616 Ga0207693_10076443
617 Ga0207663_10134551
618 Ga0207663_11358244
619 Ga0207660_10048205
620 Ga0207660_10505213
621 Ga0207657_10497733
622 Ga0207652_10029772
623 Ga0207694_10344170
624 Ga0207694_11219270
625 Ga0207650_10755923
626 Ga0207659_10996910
627 Ga0207687_10453352
628 Ga0207700_10030598
629 Ga0207700_10049051
630 Ga0207700_10168885
631 Ga0207706_10289120
632 Ga0207709_10097753
633 Ga0207669_10193923
634 Ga0207711_10468468
635 Ga0207689_10002116
636 Ga0207661_10015368
637 Ga0207661_10189438
638 Ga0207679_11495875
639 Ga0207667_10035357
640 Ga0207712_10596171
641 Ga0207712_11938116
642 Ga0207668_10182211
643 Ga0207640_10190131
644 Ga0207640_10300749
645 Ga0207658_10049819
646 Ga0207677_10423914
647 Ga0207639_10081153
648 Ga0207678_10047687
649 Ga0207678_10109202
650 Ga0207702_10472183
651 Ga0207702_11453611
652 Ga0207641_10458136
653 Ga0207676_10628537
654 Ga0207674_10078339
655 Ga0207698_10337896
656 Ga0209813_10002300
657 Ga0268266_11125116
658 Ga0268265_10235330
659 Ga0268265_10704967
660 Ga0268264_10039698
661 Ga0307408_101020702
662 Ga0307508_10096480
663 Ga0307412_11297328
664 Ga0307416_103299659
665 Ga0373926_0229315
666 Ga0373923_0127716
667 Ga0373945_0110179
668 Ga0373954_0028874
669 Ga0373954_0037561
670 Ga0373956_0159120
671 Ga0373956_0281004
672 Ga0373943_0008191
673 Ga0373946_0003124
674 Ga0373955_0011981
675 Ga0373955_0356587
676 Ga0316574_0140161
677 Ga0373924_0003814
678 Ga0373931_0531373
679 Ga0373935_0009726
680 Ga0373935_0099121
681 Ga0373927_0000137
682 Ga0373927_0244219
683 Ga0373927_0303542
684 Ga0373947_0000902
685 Ga0373947_0028351
686 Ga0373937_0171770
687 Ga0373937_0306686
688 Ga0316582_0214416
689 Ga0373925_0071767
690 Ga0373925_0104170
691 Ga0395900_0197885
692 Ga0395900_0313164
693 Ga0395898_0014127
694 Ga0395898_0064270
695 Ga0395898_0174446
696 Ga0395905_0913850
697 Ga0436364_0322622
698 Ga0436364_0742412
699 Ga0436364_0768873
700 Ga0436364_1000533
701 Ga0395901_0164894
702 Ga0395901_0298865
703 Ga0395901_0537256
704 Ga0400483_003897
705 Ga0400483_046637
706 Ga0400483_098760
707 Ga0400483_122180
708 Ga0400483_137961
709 Ga0400483_192392
710 Ga0400483_285070
711 Ga0436365_0144919
712 Ga0436365_0493666
713 Ga0436365_0592130
714 Ga0436365_1035561
715 Ga0436360_0043624
716 Ga0436363_0189511
717 Ga0436363_0373754
718 Ga0436362_0664428
719 Ga0466972_0000100
720 Ga0466963_0216764
721 Ga0466963_0834769
722 Ga0466959_0090777
723 Ga0466958_0160695
724 Ga0466967_0381575
725 Ga0466967_0742489
726 Ga0495592_0029318
727 Ga0495592_0052638
728 Ga0495603_0004836
729 Ga0495629_0000029
730 Ga0495641_0003605
731 Ga0495651_0679781
732 Ga0495653_0446385
733 Ga0495580_0002567
734 Ga0495580_0389689
735 Ga0495580_0811442
736 Ga0495582_0000024
737 Ga0495582_0319265
738 Ga0495639_0000006
739 Ga0495662_0000348
740 Ga0495664_0016204
741 Ga0495664_0055532
742 Ga0495584_0588685
743 Ga0495594_0000170
744 Ga0495596_0129108
745 Ga0495606_0018835
746 Ga0495606_0042071
747 Ga0495610_0192300
748 Ga0495618_0035917
749 Ga0495618_0218345
750 Ga0495620_0246039
751 Ga0495628_0232865
752 Ga0495630_0022330
753 Ga0495632_0090405
754 Ga0495643_0012456
755 Ga0495648_0019042
756 Ga0495665_0000178
757 Ga0495665_0053691
758 Ga0495640_0004410
759 Ga0495640_0329269
760 Ga0495597_0026243
761 Ga0495645_0004746
762 Ga0495622_0002996
763 Ga0495667_0040876
764 Ga0495656_0291625
765 Ga0495668_0194922
766 Ga0495634_0000354
767 Ga0495634_0057346
768 Ga0495625_0115546
769 Ga0495635_0056088
770 Ga0495635_0135984
771 Ga0495599_0096712
772 Ga0495599_0615682
773 Ga0495647_0000068
774 Ga0495658_0000428
775 Ga0495613_0001078
776 Ga0495624_0012004
777 Ga0495624_0047038
778 Ga0495649_0028025
779 Ga0495600_0170504
780 Ga0495600_0250287
781 Ga0495581_0000004
782 Ga0495581_0175640
783 Ga0495674_0000415
784 Ga0495672_0014400
785 Ga0495676_0082542
786 Ga0495680_0500369
787 Ga0495687_012203
788 Ga0495684_0071064
789 Ga0495684_0595042
790 Ga0495686_0248581
791 Ga0495593_0000198
792 Ga0495614_0007486
793 Ga0495626_0079316
794 Ga0496100_0166512
795 Ga0496100_1185014
796 Ga0496101_0027879
797 Ga0496101_0228418
798 Ga0496102_0030028
799 Ga0496102_0107832
800 Ga0496102_0567002
801 Ga0496103_0012776
802 Ga0496104_0281402
803 Ga0496106_0559389
804 Ga0496106_1077961
805 Ga0496107_0349633
806 Ga0496108_0041440
807 Ga0496110_0116242
808 Ga0496111_0168629
809 Ga0496112_0272515
810 Ga0496112_0390371
811 Ga0496113_0069522
812 Ga0496116_0036633
813 Ga0496118_0048486
814 Ga0496119_0019266
815 Ga0496119_0110171
816 Ga0496121_0003594
817 Ga0496121_0017299
818 Ga0496121_0040869
819 Ga0496121_0398448
820 Ga0496122_0041243
821 Ga0496124_0036789
822 Ga0496124_0158185
823 Ga0496125_0046550
824 Ga0496125_0074310
825 Ga0496126_0013596
826 Ga0496126_0035169
827 Ga0496126_0135082
828 Ga0496126_0186685
829 Ga0496126_0416363
830 Ga0501033_0072284
831 Ga0501034_0357708
832 Ga0501036_0684107
833 Ga0501036_0951514
834 Ga0501036_0971598
835 Ga0501037_0924730
836 Ga0501038_0312891
837 Ga0501039_0363038
838 Ga0501039_1223078
839 Ga0501042_0234277
840 Ga0501043_0492920
841 Ga0501043_0845392
842 Ga0501046_0992948
843 Ga0501047_0032110
844 Ga0501047_0034136
845 Ga0501047_0302623
846 Ga0501070_0042011
847 Ga0501070_0072776
848 Ga0501070_0200963
849 Ga0501073_0097404
850 Ga0501074_0043432
851 Ga0501080_0008505
852 Ga0501083_0944108
853 Ga0501035_0042364
854 Ga0501035_0802294
855 Ga0501044_0038934
856 Ga0501044_0266969
857 Ga0501044_0366509
858 nmdc:mga03683_55571_c1
859 nmdc:mga03n38_147227_c1
860 nmdc:mga00v17_106967_c1
861 nmdc:mga0yw44_18178_c1
862 nmdc:mga0k408_5885_c1
863 nmdc:mga06z11_22909_c1
864 nmdc:mga07m45_217407_c1
865 nmdc:mga08x19_760984_c1
866 nmdc:mga0sz30_178861_c1
867 nmdc:mga0sz30_35349_c1
868 Ga0495601_0141046
869 Ga0495601_0241168
870 Ga0495601_0397461
871 Ga0495612_0012967
872 Ga0495619_0264866
873 Ga0500578_0294455
874 Ga0500556_0000181
875 Ga0500645_144735
876 2509151555
877 2513715415
878 2513891636
879 2517105692
880 2517888185
881 2524435435
882 2617374703
883 2728753842
884 2745081401
885 2824653875
886 2824686511
887 2824740194
888 2824751301
889 2885418263
890 2888387739
891 2888389959
892 2903754036
893 2904695759
894 2906614458
895 2908764275
896 2908777186
897 2922426292
898 2929622235
899 2929630118
900 2933584151
901 2935632677
902 2941508659
903 2941516489
904 2941524495
905 3005489731
906 8006932291
907 8016593996
908 8019561682
909 8019624728
910 8055743516
911 8056683445
912 8056690822

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11578

DUF3237

Protein of unknown function (DUF3237)

15

162

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c5o-assembly1.cif.gz_D crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris 0.9579 3 153
3c5o-assembly1.cif.gz_A crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris 0.9566 3 153
3c5o-assembly1.cif.gz_C crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris 0.9531 3 153
3c5o-assembly1.cif.gz_A crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris 0.9504 3 153
3c5o-assembly1.cif.gz_D crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris 0.9458 3 153
ID Description Score Start End Superfamily
3c5oC00 Mainly Beta;Beta Barrel;Porin; 0.9526 3 153 2.40.160.20
3c5oC00 Mainly Beta;Beta Barrel;Porin; 0.9463 3 153 2.40.160.20
3g7gG00 Mainly Beta;Beta Barrel;Porin; 0.9282 7 153 2.40.160.20
3g7gG00 Mainly Beta;Beta Barrel;Porin; 0.916 7 153 2.40.160.20
4puxA00 Mainly Beta;Beta Barrel;Porin; 0.8585 4 153 2.40.160.20
ID Description Score Start End GO Terms
AF-A0A534X2K0-F1-model_v4 DUF3237 domain-containing protein 0.9747 17 90
AF-A0A354V2T9-F1-model_v4 UPF0311 protein DDZ81_08495 0.9701 4 153
AF-A0A844SRG1-F1-model_v4 UPF0311 protein GPL21_07760 0.9614 4 153
AF-A0A498G5J8-F1-model_v4 DUF3237 domain-containing protein 0.9613 5 153
AF-A0A6M1LR28-F1-model_v4 UPF0311 protein G3576_22875 0.9606 9 151

Map