F447804

General Info

Members Datasets Scaffolds Average Seq Length
456 218 912 88

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100918732|Ga0207675_1009187322
Length 99
Sequence MLAKRINPILNVSDIQQLVFGVLQGVASSTVFILALFIGFCVIVGFTKLKKTAGGGAMVIKSLDEQMTRKSMVYLHPSDPQGPIDQLRSPELLEAAARK

Samples

Sample ID Description Type Environment
1 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
139 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
142 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
143 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
146 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
158 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
159 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
160 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.82
Rhizosphere 94.52
Stem 0
Stem Tuber 0
Unclassified 27.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207675_100918732 3300026118 Unclassified 892
2 Ga0065704_10656678 3300005289 Bacteria 580
3 Ga0065712_10144514 3300005290 Bacteria 1420
4 Ga0065715_10898516 3300005293 Unclassified 575
5 Ga0065707_10046334 3300005295 Bacteria 796
6 Ga0065707_10499048 3300005295 Bacteria 759
7 Ga0070676_10877954 3300005328 Unclassified 667
8 Ga0070690_100342354 3300005330 Bacteria 1083
9 Ga0070670_100175456 3300005331 Unclassified 1860
10 Ga0070670_101856424 3300005331 Unclassified 555
11 Ga0068869_101005638 3300005334 Unclassified 726
12 Ga0068869_101037939 3300005334 Bacteria 715
13 Ga0070680_100199971 3300005336 Bacteria 1685
14 Ga0068868_100306110 3300005338 Bacteria 1351
15 Ga0068868_100306530 3300005338 Bacteria 1350
16 Ga0068868_100416772 3300005338 Bacteria 1162
17 Ga0068868_101428443 3300005338 Bacteria 646
18 Ga0070689_100127894 3300005340 Bacteria 2035
19 Ga0070675_100000256 3300005354 Bacteria 34835
20 Ga0070675_102093649 3300005354 Bacteria 522
21 Ga0070671_100372105 3300005355 Bacteria 1220
22 Ga0070674_100156249 3300005356 Unclassified 1726
23 Ga0070674_100182143 3300005356 Bacteria 1610
24 Ga0070673_100961468 3300005364 Bacteria 794
25 Ga0070673_101105014 3300005364 Unclassified 741
26 Ga0070673_101914716 3300005364 Unclassified 562
27 Ga0070709_10048567 3300005434 Unclassified 2649
28 Ga0070709_10099934 3300005434 Bacteria 1931
29 Ga0070709_10898738 3300005434 Bacteria 700
30 Ga0070714_100025703 3300005435 Bacteria 4862
31 Ga0070713_100072280 3300005436 Bacteria 2917
32 Ga0070713_101761794 3300005436 Unclassified 601
33 Ga0070701_10791061 3300005438 Unclassified 646
34 Ga0070711_100094350 3300005439 Unclassified 2163
35 Ga0070711_100316235 3300005439 Unclassified 1246
36 Ga0070705_101120104 3300005440 Bacteria 645
37 Ga0070700_101883734 3300005441 Unclassified 517
38 Ga0070694_100347990 3300005444 Bacteria 1147
39 Ga0070694_101702175 3300005444 Bacteria 536
40 Ga0070708_100532832 3300005445 Unclassified 1108
41 Ga0070678_100118812 3300005456 Bacteria 2081
42 Ga0070681_10063568 3300005458 Bacteria 3663
43 Ga0068867_100205771 3300005459 Bacteria 1577
44 Ga0068867_100432664 3300005459 Bacteria 1117
45 Ga0070685_10075745 3300005466 Bacteria 2005
46 Ga0070706_100786062 3300005467 Bacteria 881
47 Ga0070706_101552861 3300005467 Unclassified 604
48 Ga0070706_101729736 3300005467 Unclassified 569
49 Ga0070707_100120833 3300005468 Bacteria 2544
50 Ga0070698_100062739 3300005471 Bacteria 3749
51 Ga0070698_100308632 3300005471 Bacteria 1513
52 Ga0070698_101332552 3300005471 Bacteria 668
53 Ga0070698_101896413 3300005471 Unclassified 549
54 Ga0070699_100006876 3300005518 Bacteria 9896
55 Ga0070679_100041452 3300005530 Bacteria 4582
56 Ga0070684_100175555 3300005535 Bacteria 1947
57 Ga0070697_100660426 3300005536 Bacteria 921
58 Ga0070697_100661935 3300005536 Bacteria 920
59 Ga0070697_100825417 3300005536 Unclassified 821
60 Ga0070697_101884793 3300005536 Bacteria 535
61 Ga0070672_101183214 3300005543 Bacteria 681
62 Ga0070686_100541685 3300005544 Bacteria 909
63 Ga0070695_100419820 3300005545 Unclassified 1018
64 Ga0070665_100027996 3300005548 Bacteria 5677
65 Ga0070704_100225803 3300005549 Unclassified 1525
66 Ga0070704_100947788 3300005549 Unclassified 776
67 Ga0070664_100502855 3300005564 Archaea 1117
68 Ga0070664_100680648 3300005564 Bacteria 957
69 Ga0068857_100121588 3300005577 Bacteria 2351
70 Ga0068854_101541568 3300005578 Unclassified 604
71 Ga0068859_100151059 3300005617 Bacteria 2398
72 Ga0068859_101379940 3300005617 Bacteria 777
73 Ga0068859_101418006 3300005617 Bacteria 766
74 Ga0068859_101600230 3300005617 Bacteria 719
75 Ga0068864_100027774 3300005618 Bacteria 4782
76 Ga0068864_101336467 3300005618 Bacteria 718
77 Ga0068866_10061017 3300005718 Bacteria 1957
78 Ga0068866_10551899 3300005718 Bacteria 770
79 Ga0068866_10626426 3300005718 Unclassified 729
80 Ga0068861_100288443 3300005719 Bacteria 1416
81 Ga0068861_101026938 3300005719 Bacteria 788
82 Ga0068861_101764522 3300005719 Unclassified 613
83 Ga0068863_100343441 3300005841 Unclassified 1452
84 Ga0068858_100061398 3300005842 Bacteria 3474
85 Ga0068858_100423356 3300005842 Bacteria 1281
86 Ga0068858_101090592 3300005842 Unclassified 784
87 Ga0068858_101161633 3300005842 Bacteria 758
88 Ga0068858_101198514 3300005842 Bacteria 746
89 Ga0068860_100383506 3300005843 Archaea 1388
90 Ga0068860_100452630 3300005843 Bacteria 1276
91 Ga0068860_101808364 3300005843 Unclassified 633
92 Ga0068862_100253910 3300005844 Unclassified 1603
93 Ga0068862_100325019 3300005844 Bacteria 1421
94 Ga0068862_102531985 3300005844 Unclassified 525
95 Ga0081539_10005962 3300005985 Bacteria 12013
96 Ga0081539_10026285 3300005985 Unclassified 3719
97 Ga0081539_10128246 3300005985 Bacteria 1250
98 Ga0070717_10324248 3300006028 Unclassified 1373
99 Ga0070717_11534326 3300006028 Unclassified 604
100 Ga0070715_10271835 3300006163 Unclassified 895
101 Ga0070716_100904787 3300006173 Bacteria 691
102 Ga0070712_100149987 3300006175 Bacteria 1789
103 Ga0097621_100019461 3300006237 Bacteria 5210
104 Ga0097621_100043532 3300006237 Bacteria 3619
105 Ga0097621_100065569 3300006237 Bacteria 2989
106 Ga0097621_100123007 3300006237 Unclassified 2202
107 Ga0097621_100318457 3300006237 Unclassified 1377
108 Ga0097621_100375315 3300006237 Bacteria 1269
109 Ga0097621_101627039 3300006237 Unclassified 614
110 Ga0068871_100000257 3300006358 Bacteria 36771
111 Ga0068871_100009412 3300006358 Bacteria 7077
112 Ga0068871_100017034 3300006358 Bacteria 5488
113 Ga0068871_100055101 3300006358 Bacteria 3227
114 Ga0068871_100243612 3300006358 Bacteria 1564
115 Ga0068871_100456325 3300006358 Unclassified 1146
116 Ga0075428_100027444 3300006844 Bacteria 6299
117 Ga0075428_102092943 3300006844 Unclassified 585
118 Ga0075433_10011248 3300006852 Bacteria 7204
119 Ga0075433_10083642 3300006852 Unclassified 2817
120 Ga0075433_10334861 3300006852 Unclassified 1338
121 Ga0075433_10629563 3300006852 Bacteria 941
122 Ga0075433_11300543 3300006852 Bacteria 630
123 Ga0075433_11339166 3300006852 Bacteria 620
124 Ga0075434_100000505 3300006871 Bacteria 29553
125 Ga0075434_100076867 3300006871 Bacteria 3333
126 Ga0075434_100178520 3300006871 Unclassified 2143
127 Ga0075434_100182270 3300006871 Bacteria 2120
128 Ga0075434_100386095 3300006871 Bacteria 1421
129 Ga0075434_100465411 3300006871 Bacteria 1286
130 Ga0075434_101365340 3300006871 Unclassified 719
131 Ga0075434_101458673 3300006871 Unclassified 694
132 Ga0075434_102357194 3300006871 Bacteria 535
133 Ga0075434_102656925 3300006871 Bacteria 501
134 Ga0068865_100046946 3300006881 Bacteria 2965
135 Ga0068865_100057798 3300006881 Bacteria 2707
136 Ga0068865_101236973 3300006881 Bacteria 662
137 Ga0068865_102087768 3300006881 Bacteria 515
138 Ga0075436_100001003 3300006914 Bacteria 18959
139 Ga0075436_100043264 3300006914 Bacteria 3105
140 Ga0075436_100269345 3300006914 Bacteria 1216
141 Ga0075436_100321047 3300006914 Bacteria 1112
142 Ga0097620_100151062 3300006931 Bacteria 2398
143 Ga0097620_101380356 3300006931 Bacteria 777
144 Ga0097620_101418206 3300006931 Bacteria 766
145 Ga0097620_101600180 3300006931 Bacteria 719
146 Ga0075435_100000129 3300007076 Bacteria 43005
147 Ga0075435_100012127 3300007076 Bacteria 6373
148 Ga0075435_100108560 3300007076 Bacteria 2306
149 Ga0075435_100531038 3300007076 Bacteria 1018
150 Ga0075435_101636619 3300007076 Unclassified 565
151 Ga0105240_10593513 3300009093 Unclassified 1220
152 Ga0105240_11736122 3300009093 Unclassified 651
153 Ga0111539_10007274 3300009094 Bacteria 14174
154 Ga0111539_10426657 3300009094 Bacteria 1544
155 Ga0111539_10520984 3300009094 Bacteria 1385
156 Ga0105245_10008629 3300009098 Bacteria 8891
157 Ga0105245_10133165 3300009098 Bacteria 2333
158 Ga0105247_11092170 3300009101 Bacteria 629
159 Ga0114129_10010707 3300009147 Bacteria 13075
160 Ga0114129_10011496 3300009147 Bacteria 12605
161 Ga0114129_10077515 3300009147 Bacteria 4623
162 Ga0114129_10100822 3300009147 Bacteria 3995
163 Ga0114129_10131727 3300009147 Bacteria 3433
164 Ga0114129_10147239 3300009147 Bacteria 3225
165 Ga0114129_10442413 3300009147 Bacteria 1706
166 Ga0114129_10596243 3300009147 Bacteria 1432
167 Ga0114129_11051629 3300009147 Unclassified 1022
168 Ga0114129_11504067 3300009147 Bacteria 827
169 Ga0105243_10649804 3300009148 Bacteria 1022
170 Ga0105243_12630266 3300009148 Unclassified 543
171 Ga0105241_10497262 3300009174 Bacteria 1087
172 Ga0105241_11981772 3300009174 Bacteria 573
173 Ga0105242_10010963 3300009176 Bacteria 6964
174 Ga0105242_10231268 3300009176 Unclassified 1657
175 Ga0105242_10265879 3300009176 Unclassified 1551
176 Ga0105242_11115677 3300009176 Bacteria 804
177 Ga0105242_11501700 3300009176 Bacteria 704
178 Ga0105242_12418447 3300009176 Bacteria 573
179 Ga0105248_10086363 3300009177 Bacteria 3530
180 Ga0105248_10111119 3300009177 Bacteria 3091
181 Ga0105248_10128982 3300009177 Bacteria 2853
182 Ga0105248_10261360 3300009177 Bacteria 1949
183 Ga0105248_10278829 3300009177 Bacteria 1882
184 Ga0105248_13285012 3300009177 Unclassified 514
185 Ga0105238_10408755 3300009551 Unclassified 1351
186 Ga0105238_10603374 3300009551 Unclassified 1106
187 Ga0105238_12104893 3300009551 Unclassified 598
188 Ga0105249_11222493 3300009553 Bacteria 822
189 Ga0099796_10181601 3300010159 Unclassified 845
190 Ga0105239_11994358 3300010375 Bacteria 674
191 Ga0105246_10270805 3300011119 Bacteria 1357
192 Ga0105246_11832478 3300011119 Archaea 581
193 Ga0105246_12464130 3300011119 Unclassified 511
194 Ga0157374_10046981 3300013296 Bacteria 4000
195 Ga0157374_10852919 3300013296 Unclassified 928
196 Ga0157374_11084242 3300013296 Archaea 821
197 Ga0157374_11853200 3300013296 Bacteria 629
198 Ga0157378_10010006 3300013297 Bacteria 8271
199 Ga0157378_10957248 3300013297 Unclassified 889
200 Ga0163162_10190497 3300013306 Bacteria 2178
201 Ga0163162_13154558 3300013306 Unclassified 529
202 Ga0157375_10428689 3300013308 Bacteria 1488
203 Ga0157375_10799366 3300013308 Bacteria 1092
204 Ga0157375_11028027 3300013308 Unclassified 963
205 Ga0157375_12006939 3300013308 Bacteria 688
206 Ga0157375_13449140 3300013308 Unclassified 526
207 Ga0163163_10220577 3300014325 Unclassified 1945
208 Ga0163163_10257240 3300014325 Bacteria 1797
209 Ga0163163_11629914 3300014325 Archaea 706
210 Ga0157380_11574906 3300014326 Unclassified 712
211 Ga0157377_10057160 3300014745 Bacteria 2217
212 Ga0157377_10712096 3300014745 Unclassified 730
213 Ga0157379_10565982 3300014968 Bacteria 1058
214 Ga0157379_10743511 3300014968 Unclassified 923
215 Ga0157379_11197757 3300014968 Unclassified 730
216 Ga0157379_11221925 3300014968 Bacteria 723
217 Ga0157379_11576816 3300014968 Unclassified 641
218 Ga0157376_10009978 3300014969 Bacteria 6930
219 Ga0157376_10511328 3300014969 Unclassified 1182
220 Ga0157376_10579787 3300014969 Bacteria 1114
221 Ga0157376_10618146 3300014969 Bacteria 1080
222 Ga0157376_10949224 3300014969 Bacteria 880
223 Ga0157376_11855291 3300014969 Bacteria 639
224 Ga0163161_10770993 3300017792 Bacteria 806
225 Ga0224712_10109204 3300022467 Bacteria 1184
226 Ga0207697_10224629 3300025315 Bacteria 829
227 Ga0207642_10303728 3300025899 Bacteria 926
228 Ga0207642_10566644 3300025899 Bacteria 703
229 Ga0207710_10035858 3300025900 Bacteria 2184
230 Ga0207680_10265976 3300025903 Unclassified 1188
231 Ga0207680_10604280 3300025903 Bacteria 785
232 Ga0207685_10051803 3300025905 Unclassified 1587
233 Ga0207699_10016520 3300025906 Bacteria 3864
234 Ga0207699_10700686 3300025906 Bacteria 741
235 Ga0207684_10935962 3300025910 Bacteria 727
236 Ga0207684_11157416 3300025910 Unclassified 642
237 Ga0207684_11162908 3300025910 Unclassified 640
238 Ga0207707_10476300 3300025912 Bacteria 1067
239 Ga0207693_10295083 3300025915 Bacteria 1270
240 Ga0207663_10027459 3300025916 Unclassified 3318
241 Ga0207663_11068160 3300025916 Unclassified 649
242 Ga0207660_10331423 3300025917 Unclassified 1217
243 Ga0207660_10388317 3300025917 Bacteria 1123
244 Ga0207662_10205895 3300025918 Unclassified 1275
245 Ga0207652_10126696 3300025921 Bacteria 2275
246 Ga0207646_10348545 3300025922 Unclassified 1338
247 Ga0207681_11298851 3300025923 Bacteria 611
248 Ga0207694_10344069 3300025924 Unclassified 1233
249 Ga0207650_10228022 3300025925 Bacteria 1501
250 Ga0207659_10005636 3300025926 Bacteria 7615
251 Ga0207659_11018103 3300025926 Bacteria 713
252 Ga0207687_10008341 3300025927 Bacteria 6778
253 Ga0207687_10345978 3300025927 Bacteria 1210
254 Ga0207687_11581351 3300025927 Archaea 563
255 Ga0207700_10056727 3300025928 Bacteria 2950
256 Ga0207664_10129582 3300025929 Bacteria 2122
257 Ga0207644_11089909 3300025931 Bacteria 671
258 Ga0207686_10008045 3300025934 Bacteria 5689
259 Ga0207686_10208614 3300025934 Bacteria 1403
260 Ga0207709_10252846 3300025935 Bacteria 1288
261 Ga0207709_11153299 3300025935 Unclassified 637
262 Ga0207669_10071621 3300025937 Bacteria 2179
263 Ga0207669_10146421 3300025937 Bacteria 1648
264 Ga0207704_10008815 3300025938 Bacteria 4842
265 Ga0207665_10912913 3300025939 Bacteria 697
266 Ga0207691_10276692 3300025940 Bacteria 1445
267 Ga0207711_10017848 3300025941 Bacteria 5895
268 Ga0207711_10041355 3300025941 Bacteria 3925
269 Ga0207711_10051578 3300025941 Bacteria 3524
270 Ga0207711_10072724 3300025941 Bacteria 2987
271 Ga0207711_10695554 3300025941 Bacteria 948
272 Ga0207689_11798050 3300025942 Bacteria 506
273 Ga0207661_11069576 3300025944 Bacteria 743
274 Ga0207679_10250910 3300025945 Bacteria 1504
275 Ga0207651_10798930 3300025960 Unclassified 836
276 Ga0207677_10063745 3300026023 Bacteria 2563
277 Ga0207677_10259817 3300026023 Bacteria 1415
278 Ga0207677_10318411 3300026023 Bacteria 1292
279 Ga0207677_10650668 3300026023 Bacteria 930
280 Ga0207677_10934414 3300026023 Bacteria 783
281 Ga0207703_10055873 3300026035 Bacteria 3213
282 Ga0207703_10403910 3300026035 Bacteria 1268
283 Ga0207703_10786443 3300026035 Bacteria 908
284 Ga0207703_10915172 3300026035 Bacteria 840
285 Ga0207708_11309885 3300026075 Bacteria 635
286 Ga0207641_10261589 3300026088 Bacteria 1620
287 Ga0207641_10637792 3300026088 Bacteria 1046
288 Ga0207648_10214557 3300026089 Bacteria 1709
289 Ga0207648_10721118 3300026089 Bacteria 925
290 Ga0207676_10145781 3300026095 Bacteria 2033
291 Ga0207676_10155207 3300026095 Bacteria 1976
292 Ga0207676_10588655 3300026095 Unclassified 1067
293 Ga0207674_10092236 3300026116 Bacteria 3018
294 Ga0207675_100342010 3300026118 Bacteria 1465
295 Ga0207675_101513869 3300026118 Unclassified 692
296 Ga0207683_10048260 3300026121 Bacteria 3729
297 Ga0207683_10082135 3300026121 Bacteria 2862
298 Ga0207698_12033645 3300026142 Unclassified 589
299 Ga0268266_10280378 3300028379 Bacteria 1549
300 Ga0268266_11348644 3300028379 Unclassified 689
301 Ga0268265_10197549 3300028380 Unclassified 1742
302 Ga0268265_10641010 3300028380 Bacteria 1020
303 Ga0268265_11563078 3300028380 Bacteria 664
304 Ga0268264_10323793 3300028381 Bacteria 1458
305 Ga0268264_11465325 3300028381 Bacteria 693
306 Ga0268264_11514450 3300028381 Bacteria 681
307 Ga0268264_12067695 3300028381 Bacteria 578
308 Ga0307513_10676959 3300031456 Bacteria 738
309 Ga0373944_0215384 3300035089 Unclassified 699
310 Ga0373923_0070008 3300035111 Bacteria 1505
311 Ga0373936_0050772 3300035113 Unclassified 1678
312 Ga0373939_0055873 3300035114 Bacteria 1241
313 Ga0373945_0294298 3300035116 Bacteria 694
314 Ga0373953_0105004 3300035117 Unclassified 1191
315 Ga0373956_0106838 3300035119 Unclassified 1301
316 Ga0373957_0092300 3300035120 Unclassified 1205
317 Ga0373960_0107289 3300035121 Unclassified 912
318 Ga0373943_0025173 3300035170 Bacteria 2780
319 Ga0373943_0111553 3300035170 Unclassified 1443
320 Ga0373943_0245074 3300035170 Bacteria 1005
321 Ga0373946_0006371 3300035171 Bacteria 4277
322 Ga0373946_0334345 3300035171 Bacteria 755
323 Ga0373955_0004579 3300035172 Bacteria 6129
324 Ga0373955_0166400 3300035172 Bacteria 1304
325 Ga0373935_0590270 3300035692 Unclassified 812
326 Ga0373935_0617393 3300035692 Bacteria 794
327 Ga0373933_0149820 3300035724 Unclassified 1477
328 Ga0373933_0982422 3300035724 Unclassified 556
329 Ga0373947_0016995 3300035725 Bacteria 4181
330 Ga0373937_0143709 3300036401 Bacteria 2233
331 Ga0373937_0149810 3300036401 Bacteria 2185
332 Ga0373937_0296928 3300036401 Bacteria 1527
333 Ga0373937_0304755 3300036401 Bacteria 1506
334 Ga0373937_0773090 3300036401 Bacteria 908
335 Ga0373937_1552385 3300036401 Unclassified 609
336 Ga0373925_0041926 3300037068 Unclassified 3395
337 Ga0373925_0711302 3300037068 Bacteria 828
338 Ga0373925_0985783 3300037068 Bacteria 694
339 Ga0395905_0743342 3300037471 Unclassified 883
340 Ga0436365_0059577 3300039437 Bacteria 961
341 Ga0436363_0072251 3300039450 Bacteria 1227
342 Ga0451807_2133627 3300041486 Bacteria 584
343 Ga0450910_058378 3300042147 Bacteria 648
344 Ga0439464_0163843 3300042439 Unclassified 699
345 Ga0451576_1051632 3300045051 Bacteria 853
346 Ga0451576_2623793 3300045051 Unclassified 514
347 Ga0466967_0321950 3300045976 Bacteria 1491
348 Ga0495592_0009245 3300046454 Bacteria 7414
349 Ga0495580_0065538 3300046472 Bacteria 2544
350 Ga0495639_0264844 3300046475 Bacteria 852
351 Ga0495584_0413426 3300046491 Bacteria 686
352 Ga0495608_0003468 3300046511 Bacteria 11288
353 Ga0495628_0343963 3300046516 Bacteria 1097
354 Ga0495628_0714477 3300046516 Unclassified 707
355 Ga0495630_0016655 3300046517 Bacteria 5375
356 Ga0495652_0070942 3300046529 Bacteria 2910
357 Ga0495587_0052167 3300046536 Archaea 2414
358 Ga0495645_0053907 3300046543 Bacteria 2922
359 Ga0495645_0204186 3300046543 Bacteria 1338
360 Ga0495667_0047324 3300046559 Bacteria 2842
361 Ga0495667_0954564 3300046559 Unclassified 524
362 Ga0495656_0643462 3300046615 Bacteria 569
363 Ga0495634_0737866 3300046642 Bacteria 564
364 Ga0495635_1024126 3300046663 Unclassified 525
365 Ga0495657_0622034 3300046675 Unclassified 624
366 Ga0495623_0294499 3300046679 Bacteria 899
367 Ga0495647_0031065 3300046681 Unclassified 1985
368 Ga0495647_0169307 3300046681 Bacteria 945
369 Ga0495658_0150793 3300046683 Unclassified 1428
370 Ga0495658_0491334 3300046683 Bacteria 785
371 Ga0495669_0001215 3300046684 Bacteria 10716
372 Ga0495669_0008713 3300046684 Bacteria 4272
373 Ga0495613_0003695 3300046689 Bacteria 11476
374 Ga0495613_0638400 3300046689 Unclassified 705
375 Ga0495600_0055147 3300046809 Bacteria 2596
376 Ga0495604_0039596 3300047317 Bacteria 3704
377 Ga0495674_0009481 3300047319 Bacteria 9249
378 Ga0495674_0220669 3300047319 Archaea 1567
379 Ga0495672_0163791 3300047320 Bacteria 1140
380 Ga0495680_0115728 3300047322 Bacteria 1984
381 Ga0495675_0297713 3300047444 Bacteria 959
382 Ga0495684_0000601 3300047471 Bacteria 28931
383 Ga0495684_0241053 3300047471 Bacteria 1319
384 Ga0496100_0065825 3300048903 Unclassified 2403
385 Ga0496101_0037485 3300048904 Bacteria 3439
386 Ga0496102_1553767 3300048905 Bacteria 580
387 Ga0496104_0077623 3300048907 Bacteria 3164
388 Ga0496104_0131732 3300048907 Bacteria 2402
389 Ga0496106_1108534 3300048909 Unclassified 620
390 Ga0496107_0179506 3300048910 Bacteria 1572
391 Ga0496108_0711778 3300048911 Unclassified 870
392 Ga0496108_0817889 3300048911 Bacteria 803
393 Ga0496109_0360531 3300048912 Bacteria 1373
394 Ga0496109_0747327 3300048912 Bacteria 916
395 Ga0496109_1063155 3300048912 Bacteria 747
396 Ga0496110_0018662 3300048913 Bacteria 5819
397 Ga0496110_1309271 3300048913 Unclassified 634
398 Ga0496110_1360986 3300048913 Bacteria 619
399 Ga0496111_0263111 3300048914 Bacteria 1280
400 Ga0496112_0063101 3300048915 Bacteria 3654
401 Ga0496113_0171179 3300048916 Bacteria 1720
402 Ga0496114_0007297 3300048917 Bacteria 8730
403 Ga0496114_1174712 3300048917 Unclassified 653
404 Ga0496115_1362889 3300048918 Bacteria 525
405 Ga0501046_0459206 3300049580 Bacteria 915
406 Ga0501047_0570422 3300049581 Bacteria 955
407 Ga0501072_1235187 3300049588 Unclassified 580
408 Ga0501075_1455367 3300049591 Bacteria 519
409 Ga0501080_1741341 3300049742 Unclassified 525
410 nmdc:mga05p37_1235415_c1 3300050507 Unclassified 768
411 nmdc:mga05p37_139892_c1 3300050507 Bacteria 2966
412 nmdc:mga05p37_1909_c1 3300050507 Bacteria 24257
413 nmdc:mga05p37_304236_c1 3300050507 Bacteria 1893
414 nmdc:mga05p37_39501_c2 3300050507 Bacteria 4414
415 nmdc:mga05p37_399541_c1 3300050507 Bacteria 1605
416 nmdc:mga05p37_723148_c1 3300050507 Unclassified 1102
417 nmdc:mga05p37_8400_c1 3300050507 Bacteria 12208
418 nmdc:mga05p37_892307_c1 3300050507 Bacteria 960
419 nmdc:mga09592_386855_c1 3300050508 Bacteria 1209
420 nmdc:mga09592_567465_c1 3300050508 Unclassified 974
421 nmdc:mga09592_576836_c1 3300050508 Bacteria 965
422 nmdc:mga08y16_23054_c1 3300050511 Bacteria 6572
423 nmdc:mga08y16_437638_c1 3300050511 Bacteria 1335
424 nmdc:mga0n895_10821_c1 3300050512 Bacteria 8096
425 nmdc:mga0n895_109_c1 3300050512 Bacteria 48376
426 nmdc:mga0n895_1176729_c1 3300050512 Bacteria 741
427 nmdc:mga0n895_1374522_c1 3300050512 Bacteria 675
428 nmdc:mga0n895_1656469_c1 3300050512 Unclassified 603
429 nmdc:mga0n895_169769_c1 3300050512 Unclassified 2213
430 nmdc:mga0n895_2144009_c1 3300050512 Bacteria 515
431 nmdc:mga0n895_28503_c1 3300050512 Bacteria 5312
432 nmdc:mga0n895_299352_c1 3300050512 Bacteria 1630
433 nmdc:mga0n895_457609_c1 3300050512 Unclassified 1288
434 nmdc:mga0rr50_14747_c1 3300050513 Bacteria 5138
435 nmdc:mga0rr50_36_c1 3300050513 Bacteria 89726
436 nmdc:mga0rr50_453217_c1 3300050513 Bacteria 1088
437 nmdc:mga0rr50_507040_c1 3300050513 Bacteria 1026
438 nmdc:mga08x19_1049105_c1 3300050514 Bacteria 579
439 nmdc:mga08x19_214509_c1 3300050514 Bacteria 1322
440 nmdc:mga08x19_217979_c1 3300050514 Bacteria 1311
441 nmdc:mga08x19_223_c1 3300050514 Bacteria 43405
442 nmdc:mga0a205_182418_c1 3300050515 Bacteria 1993
443 nmdc:mga0a205_21641_c1 3300050515 Bacteria 6080
444 nmdc:mga0a205_30017_c1 3300050515 Bacteria 5204
445 nmdc:mga0a205_402639_c1 3300050515 Bacteria 1232
446 nmdc:mga0a205_936011_c1 3300050515 Bacteria 713
447 Ga0495601_0113465 3300053077 Bacteria 1756
448 Ga0495601_0178760 3300053077 Archaea 1387
449 Ga0495601_1002313 3300053077 Unclassified 525
450 Ga0495595_0019225 3300053084 Bacteria 2963
451 Ga0495595_0083110 3300053084 Bacteria 1528
452 Ga0495595_0621445 3300053084 Unclassified 553
453 Ga0495619_0000386 3300053085 Bacteria 30136
454 Ga0495619_0245684 3300053085 Unclassified 1240
455 Ga0495619_0384965 3300053085 Unclassified 969
456 Ga0495619_0629615 3300053085 Unclassified 733
457 Ga0207675_100918732
458 Ga0065704_10656678
459 Ga0065712_10144514
460 Ga0065715_10898516
461 Ga0065707_10046334
462 Ga0065707_10499048
463 Ga0070676_10877954
464 Ga0070690_100342354
465 Ga0070670_100175456
466 Ga0070670_101856424
467 Ga0068869_101005638
468 Ga0068869_101037939
469 Ga0070680_100199971
470 Ga0068868_100306110
471 Ga0068868_100306530
472 Ga0068868_100416772
473 Ga0068868_101428443
474 Ga0070689_100127894
475 Ga0070675_100000256
476 Ga0070675_102093649
477 Ga0070671_100372105
478 Ga0070674_100156249
479 Ga0070674_100182143
480 Ga0070673_100961468
481 Ga0070673_101105014
482 Ga0070673_101914716
483 Ga0070709_10048567
484 Ga0070709_10099934
485 Ga0070709_10898738
486 Ga0070714_100025703
487 Ga0070713_100072280
488 Ga0070713_101761794
489 Ga0070701_10791061
490 Ga0070711_100094350
491 Ga0070711_100316235
492 Ga0070705_101120104
493 Ga0070700_101883734
494 Ga0070694_100347990
495 Ga0070694_101702175
496 Ga0070708_100532832
497 Ga0070678_100118812
498 Ga0070681_10063568
499 Ga0068867_100205771
500 Ga0068867_100432664
501 Ga0070685_10075745
502 Ga0070706_100786062
503 Ga0070706_101552861
504 Ga0070706_101729736
505 Ga0070707_100120833
506 Ga0070698_100062739
507 Ga0070698_100308632
508 Ga0070698_101332552
509 Ga0070698_101896413
510 Ga0070699_100006876
511 Ga0070679_100041452
512 Ga0070684_100175555
513 Ga0070697_100660426
514 Ga0070697_100661935
515 Ga0070697_100825417
516 Ga0070697_101884793
517 Ga0070672_101183214
518 Ga0070686_100541685
519 Ga0070695_100419820
520 Ga0070665_100027996
521 Ga0070704_100225803
522 Ga0070704_100947788
523 Ga0070664_100502855
524 Ga0070664_100680648
525 Ga0068857_100121588
526 Ga0068854_101541568
527 Ga0068859_100151059
528 Ga0068859_101379940
529 Ga0068859_101418006
530 Ga0068859_101600230
531 Ga0068864_100027774
532 Ga0068864_101336467
533 Ga0068866_10061017
534 Ga0068866_10551899
535 Ga0068866_10626426
536 Ga0068861_100288443
537 Ga0068861_101026938
538 Ga0068861_101764522
539 Ga0068863_100343441
540 Ga0068858_100061398
541 Ga0068858_100423356
542 Ga0068858_101090592
543 Ga0068858_101161633
544 Ga0068858_101198514
545 Ga0068860_100383506
546 Ga0068860_100452630
547 Ga0068860_101808364
548 Ga0068862_100253910
549 Ga0068862_100325019
550 Ga0068862_102531985
551 Ga0081539_10005962
552 Ga0081539_10026285
553 Ga0081539_10128246
554 Ga0070717_10324248
555 Ga0070717_11534326
556 Ga0070715_10271835
557 Ga0070716_100904787
558 Ga0070712_100149987
559 Ga0097621_100019461
560 Ga0097621_100043532
561 Ga0097621_100065569
562 Ga0097621_100123007
563 Ga0097621_100318457
564 Ga0097621_100375315
565 Ga0097621_101627039
566 Ga0068871_100000257
567 Ga0068871_100009412
568 Ga0068871_100017034
569 Ga0068871_100055101
570 Ga0068871_100243612
571 Ga0068871_100456325
572 Ga0075428_100027444
573 Ga0075428_102092943
574 Ga0075433_10011248
575 Ga0075433_10083642
576 Ga0075433_10334861
577 Ga0075433_10629563
578 Ga0075433_11300543
579 Ga0075433_11339166
580 Ga0075434_100000505
581 Ga0075434_100076867
582 Ga0075434_100178520
583 Ga0075434_100182270
584 Ga0075434_100386095
585 Ga0075434_100465411
586 Ga0075434_101365340
587 Ga0075434_101458673
588 Ga0075434_102357194
589 Ga0075434_102656925
590 Ga0068865_100046946
591 Ga0068865_100057798
592 Ga0068865_101236973
593 Ga0068865_102087768
594 Ga0075436_100001003
595 Ga0075436_100043264
596 Ga0075436_100269345
597 Ga0075436_100321047
598 Ga0097620_100151062
599 Ga0097620_101380356
600 Ga0097620_101418206
601 Ga0097620_101600180
602 Ga0075435_100000129
603 Ga0075435_100012127
604 Ga0075435_100108560
605 Ga0075435_100531038
606 Ga0075435_101636619
607 Ga0105240_10593513
608 Ga0105240_11736122
609 Ga0111539_10007274
610 Ga0111539_10426657
611 Ga0111539_10520984
612 Ga0105245_10008629
613 Ga0105245_10133165
614 Ga0105247_11092170
615 Ga0114129_10010707
616 Ga0114129_10011496
617 Ga0114129_10077515
618 Ga0114129_10100822
619 Ga0114129_10131727
620 Ga0114129_10147239
621 Ga0114129_10442413
622 Ga0114129_10596243
623 Ga0114129_11051629
624 Ga0114129_11504067
625 Ga0105243_10649804
626 Ga0105243_12630266
627 Ga0105241_10497262
628 Ga0105241_11981772
629 Ga0105242_10010963
630 Ga0105242_10231268
631 Ga0105242_10265879
632 Ga0105242_11115677
633 Ga0105242_11501700
634 Ga0105242_12418447
635 Ga0105248_10086363
636 Ga0105248_10111119
637 Ga0105248_10128982
638 Ga0105248_10261360
639 Ga0105248_10278829
640 Ga0105248_13285012
641 Ga0105238_10408755
642 Ga0105238_10603374
643 Ga0105238_12104893
644 Ga0105249_11222493
645 Ga0099796_10181601
646 Ga0105239_11994358
647 Ga0105246_10270805
648 Ga0105246_11832478
649 Ga0105246_12464130
650 Ga0157374_10046981
651 Ga0157374_10852919
652 Ga0157374_11084242
653 Ga0157374_11853200
654 Ga0157378_10010006
655 Ga0157378_10957248
656 Ga0163162_10190497
657 Ga0163162_13154558
658 Ga0157375_10428689
659 Ga0157375_10799366
660 Ga0157375_11028027
661 Ga0157375_12006939
662 Ga0157375_13449140
663 Ga0163163_10220577
664 Ga0163163_10257240
665 Ga0163163_11629914
666 Ga0157380_11574906
667 Ga0157377_10057160
668 Ga0157377_10712096
669 Ga0157379_10565982
670 Ga0157379_10743511
671 Ga0157379_11197757
672 Ga0157379_11221925
673 Ga0157379_11576816
674 Ga0157376_10009978
675 Ga0157376_10511328
676 Ga0157376_10579787
677 Ga0157376_10618146
678 Ga0157376_10949224
679 Ga0157376_11855291
680 Ga0163161_10770993
681 Ga0224712_10109204
682 Ga0207697_10224629
683 Ga0207642_10303728
684 Ga0207642_10566644
685 Ga0207710_10035858
686 Ga0207680_10265976
687 Ga0207680_10604280
688 Ga0207685_10051803
689 Ga0207699_10016520
690 Ga0207699_10700686
691 Ga0207684_10935962
692 Ga0207684_11157416
693 Ga0207684_11162908
694 Ga0207707_10476300
695 Ga0207693_10295083
696 Ga0207663_10027459
697 Ga0207663_11068160
698 Ga0207660_10331423
699 Ga0207660_10388317
700 Ga0207662_10205895
701 Ga0207652_10126696
702 Ga0207646_10348545
703 Ga0207681_11298851
704 Ga0207694_10344069
705 Ga0207650_10228022
706 Ga0207659_10005636
707 Ga0207659_11018103
708 Ga0207687_10008341
709 Ga0207687_10345978
710 Ga0207687_11581351
711 Ga0207700_10056727
712 Ga0207664_10129582
713 Ga0207644_11089909
714 Ga0207686_10008045
715 Ga0207686_10208614
716 Ga0207709_10252846
717 Ga0207709_11153299
718 Ga0207669_10071621
719 Ga0207669_10146421
720 Ga0207704_10008815
721 Ga0207665_10912913
722 Ga0207691_10276692
723 Ga0207711_10017848
724 Ga0207711_10041355
725 Ga0207711_10051578
726 Ga0207711_10072724
727 Ga0207711_10695554
728 Ga0207689_11798050
729 Ga0207661_11069576
730 Ga0207679_10250910
731 Ga0207651_10798930
732 Ga0207677_10063745
733 Ga0207677_10259817
734 Ga0207677_10318411
735 Ga0207677_10650668
736 Ga0207677_10934414
737 Ga0207703_10055873
738 Ga0207703_10403910
739 Ga0207703_10786443
740 Ga0207703_10915172
741 Ga0207708_11309885
742 Ga0207641_10261589
743 Ga0207641_10637792
744 Ga0207648_10214557
745 Ga0207648_10721118
746 Ga0207676_10145781
747 Ga0207676_10155207
748 Ga0207676_10588655
749 Ga0207674_10092236
750 Ga0207675_100342010
751 Ga0207675_101513869
752 Ga0207683_10048260
753 Ga0207683_10082135
754 Ga0207698_12033645
755 Ga0268266_10280378
756 Ga0268266_11348644
757 Ga0268265_10197549
758 Ga0268265_10641010
759 Ga0268265_11563078
760 Ga0268264_10323793
761 Ga0268264_11465325
762 Ga0268264_11514450
763 Ga0268264_12067695
764 Ga0307513_10676959
765 Ga0373944_0215384
766 Ga0373923_0070008
767 Ga0373936_0050772
768 Ga0373939_0055873
769 Ga0373945_0294298
770 Ga0373953_0105004
771 Ga0373956_0106838
772 Ga0373957_0092300
773 Ga0373960_0107289
774 Ga0373943_0025173
775 Ga0373943_0111553
776 Ga0373943_0245074
777 Ga0373946_0006371
778 Ga0373946_0334345
779 Ga0373955_0004579
780 Ga0373955_0166400
781 Ga0373935_0590270
782 Ga0373935_0617393
783 Ga0373933_0149820
784 Ga0373933_0982422
785 Ga0373947_0016995
786 Ga0373937_0143709
787 Ga0373937_0149810
788 Ga0373937_0296928
789 Ga0373937_0304755
790 Ga0373937_0773090
791 Ga0373937_1552385
792 Ga0373925_0041926
793 Ga0373925_0711302
794 Ga0373925_0985783
795 Ga0395905_0743342
796 Ga0436365_0059577
797 Ga0436363_0072251
798 Ga0451807_2133627
799 Ga0450910_058378
800 Ga0439464_0163843
801 Ga0451576_1051632
802 Ga0451576_2623793
803 Ga0466967_0321950
804 Ga0495592_0009245
805 Ga0495580_0065538
806 Ga0495639_0264844
807 Ga0495584_0413426
808 Ga0495608_0003468
809 Ga0495628_0343963
810 Ga0495628_0714477
811 Ga0495630_0016655
812 Ga0495652_0070942
813 Ga0495587_0052167
814 Ga0495645_0053907
815 Ga0495645_0204186
816 Ga0495667_0047324
817 Ga0495667_0954564
818 Ga0495656_0643462
819 Ga0495634_0737866
820 Ga0495635_1024126
821 Ga0495657_0622034
822 Ga0495623_0294499
823 Ga0495647_0031065
824 Ga0495647_0169307
825 Ga0495658_0150793
826 Ga0495658_0491334
827 Ga0495669_0001215
828 Ga0495669_0008713
829 Ga0495613_0003695
830 Ga0495613_0638400
831 Ga0495600_0055147
832 Ga0495604_0039596
833 Ga0495674_0009481
834 Ga0495674_0220669
835 Ga0495672_0163791
836 Ga0495680_0115728
837 Ga0495675_0297713
838 Ga0495684_0000601
839 Ga0495684_0241053
840 Ga0496100_0065825
841 Ga0496101_0037485
842 Ga0496102_1553767
843 Ga0496104_0077623
844 Ga0496104_0131732
845 Ga0496106_1108534
846 Ga0496107_0179506
847 Ga0496108_0711778
848 Ga0496108_0817889
849 Ga0496109_0360531
850 Ga0496109_0747327
851 Ga0496109_1063155
852 Ga0496110_0018662
853 Ga0496110_1309271
854 Ga0496110_1360986
855 Ga0496111_0263111
856 Ga0496112_0063101
857 Ga0496113_0171179
858 Ga0496114_0007297
859 Ga0496114_1174712
860 Ga0496115_1362889
861 Ga0501046_0459206
862 Ga0501047_0570422
863 Ga0501072_1235187
864 Ga0501075_1455367
865 Ga0501080_1741341
866 nmdc:mga05p37_1235415_c1
867 nmdc:mga05p37_139892_c1
868 nmdc:mga05p37_1909_c1
869 nmdc:mga05p37_304236_c1
870 nmdc:mga05p37_39501_c2
871 nmdc:mga05p37_399541_c1
872 nmdc:mga05p37_723148_c1
873 nmdc:mga05p37_8400_c1
874 nmdc:mga05p37_892307_c1
875 nmdc:mga09592_386855_c1
876 nmdc:mga09592_567465_c1
877 nmdc:mga09592_576836_c1
878 nmdc:mga08y16_23054_c1
879 nmdc:mga08y16_437638_c1
880 nmdc:mga0n895_10821_c1
881 nmdc:mga0n895_109_c1
882 nmdc:mga0n895_1176729_c1
883 nmdc:mga0n895_1374522_c1
884 nmdc:mga0n895_1656469_c1
885 nmdc:mga0n895_169769_c1
886 nmdc:mga0n895_2144009_c1
887 nmdc:mga0n895_28503_c1
888 nmdc:mga0n895_299352_c1
889 nmdc:mga0n895_457609_c1
890 nmdc:mga0rr50_14747_c1
891 nmdc:mga0rr50_36_c1
892 nmdc:mga0rr50_453217_c1
893 nmdc:mga0rr50_507040_c1
894 nmdc:mga08x19_1049105_c1
895 nmdc:mga08x19_214509_c1
896 nmdc:mga08x19_217979_c1
897 nmdc:mga08x19_223_c1
898 nmdc:mga0a205_182418_c1
899 nmdc:mga0a205_21641_c1
900 nmdc:mga0a205_30017_c1
901 nmdc:mga0a205_402639_c1
902 nmdc:mga0a205_936011_c1
903 Ga0495601_0113465
904 Ga0495601_0178760
905 Ga0495601_1002313
906 Ga0495595_0019225
907 Ga0495595_0083110
908 Ga0495595_0621445
909 Ga0495619_0000386
910 Ga0495619_0245684
911 Ga0495619_0384965
912 Ga0495619_0629615

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map