F447737
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 456 | 270 | 456 | 308 |
Family's Representative Sequence
| Representative Sequence | 3300005981|Ga0081538_10030623|Ga0081538_100306231 |
| Length | 315 |
| Sequence | MTTAQASEQPPAKEGGLSTRAKVLIALGIYLGVAVLLYAIFGDDGRNEEFQPQDEFKLDPWIEIKIGGIDLSFNKAVLYLLIGCALTVGTMLLIARRMQQRPNRTQTIMEGAYDLTYTNIAKGNMDEAAAARWFPFVATLFFFIWFSNMIGYIPLPVNDHEKVDIAGIEFPSFALYAATANLSIPLVLTLTVFVLYQAYGIRRHGFVKYLKGWLPAGVSGGAAVPIFIIEVISQFVRIISLSVRLFANILAGHLLILFMGGGLAVLLGITALGWITLPIAVAFFIFEVGLIATLQAFIFATLTSIYFGEASAGGH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 7 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 59 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 139 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 140 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 141 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 142 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 143 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 144 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 146 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 147 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 148 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 149 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 150 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 151 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 152 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 153 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 154 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 155 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 207 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 208 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 209 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 210 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 211 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 212 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 215 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 216 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 217 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 218 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 219 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 220 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 221 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 222 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 223 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 224 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 254 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 255 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 256 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 267 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 268 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.78 |
| Metatranscriptomes | 0.22 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.29 |
| Nodule | 0 |
| Rhizoplane | 10.31 |
| Rhizosphere | 85.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000315 | 3300001977 | Bacteria | 6963 |
| 2 | JGI24737J22298_10041849 | 3300001990 | Bacteria | 1405 |
| 3 | JGI24735J21928_10022663 | 3300002067 | Bacteria | 1909 |
| 4 | JGI24748J21848_1000586 | 3300002074 | Bacteria | 3913 |
| 5 | JGI24034J26672_10017446 | 3300002239 | Unclassified | 1111 |
| 6 | JGI24742J22300_10001127 | 3300002244 | Bacteria | 4144 |
| 7 | JGI24742J22300_10014452 | 3300002244 | Bacteria | 1326 |
| 8 | JGI25407J50210_10012036 | 3300003373 | Bacteria | 2216 |
| 9 | Ga0070658_10171056 | 3300005327 | Bacteria | 1825 |
| 10 | Ga0070683_100007965 | 3300005329 | Bacteria | 8989 |
| 11 | Ga0070677_10000057 | 3300005333 | Bacteria | 34822 |
| 12 | Ga0070666_10019445 | 3300005335 | Bacteria | 4384 |
| 13 | Ga0070682_100001629 | 3300005337 | Bacteria | 12482 |
| 14 | Ga0068868_100000151 | 3300005338 | Bacteria | 44963 |
| 15 | Ga0068868_100028702 | 3300005338 | Bacteria | 4257 |
| 16 | Ga0070660_100001214 | 3300005339 | Bacteria | 17496 |
| 17 | Ga0070689_100035143 | 3300005340 | Bacteria | 3828 |
| 18 | Ga0070691_10000133 | 3300005341 | Bacteria | 23011 |
| 19 | Ga0070691_10012036 | 3300005341 | Bacteria | 3962 |
| 20 | Ga0070687_100053723 | 3300005343 | Bacteria | 2096 |
| 21 | Ga0070661_100000742 | 3300005344 | Bacteria | 23671 |
| 22 | Ga0070692_10058144 | 3300005345 | Bacteria | 2030 |
| 23 | Ga0070668_100036849 | 3300005347 | Bacteria | 3733 |
| 24 | Ga0070675_100000053 | 3300005354 | Bacteria | 70601 |
| 25 | Ga0070675_100052994 | 3300005354 | Bacteria | 3336 |
| 26 | Ga0070674_100000008 | 3300005356 | Bacteria | 143844 |
| 27 | Ga0070674_100000082 | 3300005356 | Bacteria | 44418 |
| 28 | Ga0070673_100009564 | 3300005364 | Bacteria | 6513 |
| 29 | Ga0070673_100182619 | 3300005364 | Bacteria | 1796 |
| 30 | Ga0070688_100000012 | 3300005365 | Bacteria | 79406 |
| 31 | Ga0070688_100000492 | 3300005365 | Bacteria | 20007 |
| 32 | Ga0070688_100042986 | 3300005365 | Bacteria | 2782 |
| 33 | Ga0070659_100002102 | 3300005366 | Bacteria | 14198 |
| 34 | Ga0070667_100025502 | 3300005367 | Bacteria | 4915 |
| 35 | Ga0070667_100120149 | 3300005367 | Bacteria | 2285 |
| 36 | Ga0070667_100134235 | 3300005367 | Bacteria | 2163 |
| 37 | Ga0070714_100468067 | 3300005435 | Bacteria | 1199 |
| 38 | Ga0070701_10010964 | 3300005438 | Bacteria | 4030 |
| 39 | Ga0070711_100009855 | 3300005439 | Bacteria | 5892 |
| 40 | Ga0070711_100080257 | 3300005439 | Bacteria | 2322 |
| 41 | Ga0070705_100262334 | 3300005440 | Bacteria | 1219 |
| 42 | Ga0070694_100053345 | 3300005444 | Bacteria | 2736 |
| 43 | Ga0070678_100005092 | 3300005456 | Bacteria | 7542 |
| 44 | Ga0070662_100000016 | 3300005457 | Bacteria | 105820 |
| 45 | Ga0070662_100021714 | 3300005457 | Bacteria | 4387 |
| 46 | Ga0070681_10016762 | 3300005458 | Bacteria | 7315 |
| 47 | Ga0070681_10353789 | 3300005458 | Unclassified | 1379 |
| 48 | Ga0070685_10000018 | 3300005466 | Bacteria | 110132 |
| 49 | Ga0070685_10000460 | 3300005466 | Bacteria | 23676 |
| 50 | Ga0070685_10019608 | 3300005466 | Bacteria | 3652 |
| 51 | Ga0070685_10048203 | 3300005466 | Bacteria | 2453 |
| 52 | Ga0070679_100001299 | 3300005530 | Bacteria | 22062 |
| 53 | Ga0070679_100067083 | 3300005530 | Bacteria | 3578 |
| 54 | Ga0070684_100068082 | 3300005535 | Bacteria | 3129 |
| 55 | Ga0068853_100019642 | 3300005539 | Bacteria | 5608 |
| 56 | Ga0068853_100242391 | 3300005539 | Bacteria | 1653 |
| 57 | Ga0070672_100000091 | 3300005543 | Bacteria | 44187 |
| 58 | Ga0070686_100064111 | 3300005544 | Bacteria | 2383 |
| 59 | Ga0070693_100003254 | 3300005547 | Bacteria | 7539 |
| 60 | Ga0070665_100000244 | 3300005548 | Bacteria | 90284 |
| 61 | Ga0070665_100706326 | 3300005548 | Bacteria | 1021 |
| 62 | Ga0068855_100413806 | 3300005563 | Bacteria | 1476 |
| 63 | Ga0070664_100016760 | 3300005564 | Bacteria | 6012 |
| 64 | Ga0068854_100000031 | 3300005578 | Bacteria | 107298 |
| 65 | Ga0068854_100009544 | 3300005578 | Bacteria | 6262 |
| 66 | Ga0068856_100024596 | 3300005614 | Bacteria | 5862 |
| 67 | Ga0068856_100241439 | 3300005614 | Bacteria | 1822 |
| 68 | Ga0068856_100246618 | 3300005614 | Bacteria | 1801 |
| 69 | Ga0070702_100076656 | 3300005615 | Bacteria | 1990 |
| 70 | Ga0068852_100012745 | 3300005616 | Bacteria | 6401 |
| 71 | Ga0068852_100075715 | 3300005616 | Bacteria | 2969 |
| 72 | Ga0068866_10000001 | 3300005718 | Bacteria | 519680 |
| 73 | Ga0068866_10000170 | 3300005718 | Bacteria | 30223 |
| 74 | Ga0068851_10000333 | 3300005834 | Bacteria | 21364 |
| 75 | Ga0068858_100000109 | 3300005842 | Bacteria | 86772 |
| 76 | Ga0068858_100000450 | 3300005842 | Bacteria | 43091 |
| 77 | Ga0068860_100003359 | 3300005843 | Bacteria | 16475 |
| 78 | Ga0068860_100046586 | 3300005843 | Bacteria | 4134 |
| 79 | Ga0068862_100008805 | 3300005844 | Bacteria | 8357 |
| 80 | Ga0068862_100455316 | 3300005844 | Bacteria | 1207 |
| 81 | Ga0081455_10015359 | 3300005937 | Bacteria | 7444 |
| 82 | Ga0081455_10024588 | 3300005937 | Bacteria | 5575 |
| 83 | Ga0081455_10048254 | 3300005937 | Bacteria | 3681 |
| 84 | Ga0081455_10059037 | 3300005937 | Bacteria | 3241 |
| 85 | Ga0081455_10089283 | 3300005937 | Bacteria | 2501 |
| 86 | Ga0081455_10282767 | 3300005937 | Bacteria | 1198 |
| 87 | Ga0081538_10000030 | 3300005981 | Bacteria | 124321 |
| 88 | Ga0081538_10000426 | 3300005981 | Bacteria | 47299 |
| 89 | Ga0081538_10017283 | 3300005981 | Bacteria | 5482 |
| 90 | Ga0081538_10030623 | 3300005981 | Bacteria | 3648 |
| 91 | Ga0081538_10062841 | 3300005981 | Bacteria | 2114 |
| 92 | Ga0081540_1027734 | 3300005983 | Bacteria | 3200 |
| 93 | Ga0081539_10003705 | 3300005985 | Bacteria | 18213 |
| 94 | Ga0075365_10013530 | 3300006038 | Bacteria | 4885 |
| 95 | Ga0075365_10040866 | 3300006038 | Bacteria | 3026 |
| 96 | Ga0075365_10063196 | 3300006038 | Unclassified | 2478 |
| 97 | Ga0075363_100070428 | 3300006048 | Bacteria | 1899 |
| 98 | Ga0075363_100071464 | 3300006048 | Bacteria | 1886 |
| 99 | Ga0075364_10056377 | 3300006051 | Bacteria | 2573 |
| 100 | Ga0075364_10129084 | 3300006051 | Unclassified | 1696 |
| 101 | Ga0070715_10000001 | 3300006163 | Bacteria | 693690 |
| 102 | Ga0070712_100004464 | 3300006175 | Bacteria | 8638 |
| 103 | Ga0075367_10041075 | 3300006178 | Bacteria | 2703 |
| 104 | Ga0075369_10015275 | 3300006186 | Bacteria | 3080 |
| 105 | Ga0075430_100040535 | 3300006846 | Bacteria | 3942 |
| 106 | Ga0075431_100008782 | 3300006847 | Bacteria | 10125 |
| 107 | Ga0075431_100049054 | 3300006847 | Bacteria | 4355 |
| 108 | Ga0075433_10000478 | 3300006852 | Bacteria | 26067 |
| 109 | Ga0075433_10027471 | 3300006852 | Bacteria | 4827 |
| 110 | Ga0068865_100000402 | 3300006881 | Bacteria | 24075 |
| 111 | Ga0068865_100009454 | 3300006881 | Bacteria | 6047 |
| 112 | Ga0075436_100060401 | 3300006914 | Bacteria | 2618 |
| 113 | Ga0105240_10138101 | 3300009093 | Bacteria | 2917 |
| 114 | Ga0105240_10154974 | 3300009093 | Bacteria | 2726 |
| 115 | Ga0111539_10624819 | 3300009094 | Bacteria | 1254 |
| 116 | Ga0111539_10748723 | 3300009094 | Bacteria | 1137 |
| 117 | Ga0105245_10000180 | 3300009098 | Bacteria | 59695 |
| 118 | Ga0105245_10000619 | 3300009098 | Bacteria | 32213 |
| 119 | Ga0105247_10000322 | 3300009101 | Bacteria | 42918 |
| 120 | Ga0114129_10092683 | 3300009147 | Bacteria | 4185 |
| 121 | Ga0105242_10000132 | 3300009176 | Bacteria | 54347 |
| 122 | Ga0105242_10063020 | 3300009176 | Bacteria | 3053 |
| 123 | Ga0105242_10154271 | 3300009176 | Bacteria | 2005 |
| 124 | Ga0105242_10370040 | 3300009176 | Bacteria | 1329 |
| 125 | Ga0105248_10000118 | 3300009177 | Bacteria | 90018 |
| 126 | Ga0105238_10061765 | 3300009551 | Bacteria | 3749 |
| 127 | Ga0105249_10000068 | 3300009553 | Bacteria | 148594 |
| 128 | Ga0105249_10029618 | 3300009553 | Bacteria | 4945 |
| 129 | Ga0105249_10051368 | 3300009553 | Bacteria | 3761 |
| 130 | Ga0105249_10318012 | 3300009553 | Bacteria | 1567 |
| 131 | Ga0105249_10453424 | 3300009553 | Bacteria | 1321 |
| 132 | Ga0105246_10207740 | 3300011119 | Bacteria | 1526 |
| 133 | Ga0157371_10086413 | 3300013102 | Bacteria | 2221 |
| 134 | Ga0157370_10007239 | 3300013104 | Bacteria | 12106 |
| 135 | Ga0157369_10000142 | 3300013105 | Bacteria | 101760 |
| 136 | Ga0157378_10018651 | 3300013297 | Bacteria | 6100 |
| 137 | Ga0157378_10029504 | 3300013297 | Bacteria | 4843 |
| 138 | Ga0163162_10583033 | 3300013306 | Bacteria | 1245 |
| 139 | Ga0157372_10003159 | 3300013307 | Bacteria | 17764 |
| 140 | Ga0157372_10081714 | 3300013307 | Bacteria | 3658 |
| 141 | Ga0157375_10000367 | 3300013308 | Bacteria | 41173 |
| 142 | Ga0157380_10000059 | 3300014326 | Bacteria | 62280 |
| 143 | Ga0157380_10002780 | 3300014326 | Bacteria | 11890 |
| 144 | Ga0157380_10145284 | 3300014326 | Bacteria | 2043 |
| 145 | Ga0157377_10021783 | 3300014745 | Bacteria | 3376 |
| 146 | Ga0157379_10011621 | 3300014968 | Bacteria | 7688 |
| 147 | Ga0157379_10023859 | 3300014968 | Bacteria | 5429 |
| 148 | Ga0207656_10000696 | 3300025321 | Bacteria | 10993 |
| 149 | Ga0207656_10021606 | 3300025321 | Bacteria | 2573 |
| 150 | Ga0207682_10000129 | 3300025893 | Bacteria | 33994 |
| 151 | Ga0207642_10000006 | 3300025899 | Bacteria | 230268 |
| 152 | Ga0207642_10000007 | 3300025899 | Bacteria | 226017 |
| 153 | Ga0207642_10000222 | 3300025899 | Bacteria | 16787 |
| 154 | Ga0207642_10087345 | 3300025899 | Bacteria | 1531 |
| 155 | Ga0207710_10000158 | 3300025900 | Bacteria | 72527 |
| 156 | Ga0207688_10004232 | 3300025901 | Bacteria | 7822 |
| 157 | Ga0207680_10089821 | 3300025903 | Bacteria | 1951 |
| 158 | Ga0207685_10000011 | 3300025905 | Bacteria | 213430 |
| 159 | Ga0207705_10084687 | 3300025909 | Bacteria | 2315 |
| 160 | Ga0207707_10033967 | 3300025912 | Bacteria | 4464 |
| 161 | Ga0207695_10080470 | 3300025913 | Bacteria | 3299 |
| 162 | Ga0207693_10054160 | 3300025915 | Bacteria | 3147 |
| 163 | Ga0207663_10006691 | 3300025916 | Bacteria | 5926 |
| 164 | Ga0207662_10043224 | 3300025918 | Bacteria | 2657 |
| 165 | Ga0207657_10032142 | 3300025919 | Bacteria | 4745 |
| 166 | Ga0207649_10000076 | 3300025920 | Bacteria | 83824 |
| 167 | Ga0207652_10002610 | 3300025921 | Bacteria | 15138 |
| 168 | Ga0207652_10004210 | 3300025921 | Bacteria | 11747 |
| 169 | Ga0207694_10389477 | 3300025924 | Bacteria | 1158 |
| 170 | Ga0207659_10000010 | 3300025926 | Bacteria | 286639 |
| 171 | Ga0207659_10012687 | 3300025926 | Bacteria | 5375 |
| 172 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 173 | Ga0207687_10000018 | 3300025927 | Bacteria | 236159 |
| 174 | Ga0207687_10000269 | 3300025927 | Bacteria | 35470 |
| 175 | Ga0207687_10098663 | 3300025927 | Bacteria | 2145 |
| 176 | Ga0207700_10000025 | 3300025928 | Bacteria | 147429 |
| 177 | Ga0207664_10414929 | 3300025929 | Bacteria | 1199 |
| 178 | Ga0207690_10006437 | 3300025932 | Bacteria | 6960 |
| 179 | Ga0207690_10024040 | 3300025932 | Bacteria | 3811 |
| 180 | Ga0207706_10000068 | 3300025933 | Bacteria | 105795 |
| 181 | Ga0207706_10001582 | 3300025933 | Bacteria | 22593 |
| 182 | Ga0207686_10000033 | 3300025934 | Bacteria | 143602 |
| 183 | Ga0207686_10000428 | 3300025934 | Bacteria | 28669 |
| 184 | Ga0207686_10139076 | 3300025934 | Bacteria | 1676 |
| 185 | Ga0207669_10000004 | 3300025937 | Bacteria | 196828 |
| 186 | Ga0207669_10000012 | 3300025937 | Bacteria | 138242 |
| 187 | Ga0207704_10000190 | 3300025938 | Bacteria | 32246 |
| 188 | Ga0207704_10004819 | 3300025938 | Bacteria | 6191 |
| 189 | Ga0207691_10000190 | 3300025940 | Bacteria | 58438 |
| 190 | Ga0207691_10425256 | 3300025940 | Bacteria | 1132 |
| 191 | Ga0207711_10000020 | 3300025941 | Bacteria | 363325 |
| 192 | Ga0207661_10002022 | 3300025944 | Bacteria | 13980 |
| 193 | Ga0207661_10002688 | 3300025944 | Bacteria | 12229 |
| 194 | Ga0207661_10003810 | 3300025944 | Bacteria | 10514 |
| 195 | Ga0207661_10087203 | 3300025944 | Bacteria | 2591 |
| 196 | Ga0207679_10162892 | 3300025945 | Bacteria | 1828 |
| 197 | Ga0207651_10001019 | 3300025960 | Bacteria | 12393 |
| 198 | Ga0207712_10000007 | 3300025961 | Bacteria | 539589 |
| 199 | Ga0207712_10004400 | 3300025961 | Bacteria | 8905 |
| 200 | Ga0207712_10020131 | 3300025961 | Bacteria | 4367 |
| 201 | Ga0207668_10017860 | 3300025972 | Bacteria | 4453 |
| 202 | Ga0207640_10000015 | 3300025981 | Bacteria | 215411 |
| 203 | Ga0207640_10014004 | 3300025981 | Bacteria | 4607 |
| 204 | Ga0207658_10055167 | 3300025986 | Bacteria | 2943 |
| 205 | Ga0207658_10073793 | 3300025986 | Bacteria | 2590 |
| 206 | Ga0207677_10000421 | 3300026023 | Bacteria | 28837 |
| 207 | Ga0207677_10000919 | 3300026023 | Bacteria | 16454 |
| 208 | Ga0207703_10000040 | 3300026035 | Bacteria | 168191 |
| 209 | Ga0207703_10000322 | 3300026035 | Bacteria | 52048 |
| 210 | Ga0207703_10122263 | 3300026035 | Bacteria | 2236 |
| 211 | Ga0207639_10018955 | 3300026041 | Bacteria | 4898 |
| 212 | Ga0207678_10000834 | 3300026067 | Bacteria | 28248 |
| 213 | Ga0207678_10001751 | 3300026067 | Bacteria | 19873 |
| 214 | Ga0207702_10000016 | 3300026078 | Bacteria | 226633 |
| 215 | Ga0207702_10234047 | 3300026078 | Bacteria | 1718 |
| 216 | Ga0207641_10005415 | 3300026088 | Bacteria | 10899 |
| 217 | Ga0207648_10101570 | 3300026089 | Bacteria | 2520 |
| 218 | Ga0207676_10000016 | 3300026095 | Bacteria | 311561 |
| 219 | Ga0207683_10011233 | 3300026121 | Bacteria | 7633 |
| 220 | Ga0207683_10127807 | 3300026121 | Bacteria | 2285 |
| 221 | Ga0207698_10000012 | 3300026142 | Bacteria | 260061 |
| 222 | Ga0268266_10000020 | 3300028379 | Bacteria | 527065 |
| 223 | Ga0268266_10000085 | 3300028379 | Bacteria | 201288 |
| 224 | Ga0268266_10044964 | 3300028379 | Bacteria | 3775 |
| 225 | Ga0268265_10009333 | 3300028380 | Bacteria | 6630 |
| 226 | Ga0268265_10227130 | 3300028380 | Bacteria | 1638 |
| 227 | Ga0268264_10006922 | 3300028381 | Bacteria | 9516 |
| 228 | Ga0265338_10000486 | 3300028800 | Bacteria | 70900 |
| 229 | Ga0265331_10049004 | 3300031250 | Bacteria | 2030 |
| 230 | Ga0316578_10134705 | 3300031728 | Bacteria | 1487 |
| 231 | Ga0307416_100384511 | 3300032002 | Bacteria | 1435 |
| 232 | Ga0307415_100010918 | 3300032126 | Bacteria | 5168 |
| 233 | Ga0316574_0007213 | 3300035398 | Bacteria | 6077 |
| 234 | Ga0316574_0112067 | 3300035398 | Bacteria | 1749 |
| 235 | Ga0373937_0145908 | 3300036401 | Bacteria | 2215 |
| 236 | Ga0316584_0050287 | 3300036712 | Bacteria | 3116 |
| 237 | Ga0395899_0253765 | 3300037312 | Bacteria | 1206 |
| 238 | Ga0395900_0372104 | 3300037418 | Unclassified | 1398 |
| 239 | Ga0395898_0145672 | 3300037466 | Bacteria | 2267 |
| 240 | Ga0395901_0276627 | 3300038443 | Unclassified | 1745 |
| 241 | Ga0395901_0320159 | 3300038443 | Bacteria | 1605 |
| 242 | Ga0451853_1421606 | 3300041512 | Bacteria | 3730 |
| 243 | Ga0466963_0000023 | 3300044694 | Bacteria | 52546 |
| 244 | Ga0466963_0012059 | 3300044694 | Bacteria | 5281 |
| 245 | Ga0466963_0026375 | 3300044694 | Bacteria | 3716 |
| 246 | Ga0466957_0029211 | 3300044842 | Bacteria | 3286 |
| 247 | Ga0466958_0025323 | 3300045836 | Bacteria | 3498 |
| 248 | Ga0466967_0000027 | 3300045976 | Bacteria | 64265 |
| 249 | Ga0466967_0010631 | 3300045976 | Bacteria | 6916 |
| 250 | Ga0495592_0000036 | 3300046454 | Bacteria | 125461 |
| 251 | Ga0495603_0000097 | 3300046455 | Bacteria | 40321 |
| 252 | Ga0495629_0000189 | 3300046459 | Bacteria | 55743 |
| 253 | Ga0495629_0031189 | 3300046459 | Bacteria | 3775 |
| 254 | Ga0495641_0000003 | 3300046461 | Bacteria | 242879 |
| 255 | Ga0495641_0014845 | 3300046461 | Bacteria | 4196 |
| 256 | Ga0495651_0068491 | 3300046462 | Bacteria | 2705 |
| 257 | Ga0495653_0013986 | 3300046463 | Bacteria | 6544 |
| 258 | Ga0495653_0029748 | 3300046463 | Bacteria | 4356 |
| 259 | Ga0495582_0000029 | 3300046473 | Bacteria | 77919 |
| 260 | Ga0495639_0074963 | 3300046475 | Bacteria | 1568 |
| 261 | Ga0495662_0000030 | 3300046476 | Bacteria | 48917 |
| 262 | Ga0495662_0014754 | 3300046476 | Bacteria | 3799 |
| 263 | Ga0495584_0116184 | 3300046491 | Bacteria | 1355 |
| 264 | Ga0495594_0000003 | 3300046499 | Bacteria | 199267 |
| 265 | Ga0495606_0000221 | 3300046507 | Bacteria | 101157 |
| 266 | Ga0495608_0000031 | 3300046511 | Bacteria | 145255 |
| 267 | Ga0495608_0000204 | 3300046511 | Bacteria | 42513 |
| 268 | Ga0495608_0004209 | 3300046511 | Bacteria | 10311 |
| 269 | Ga0495620_0001199 | 3300046515 | Bacteria | 15860 |
| 270 | Ga0495628_0000924 | 3300046516 | Bacteria | 26910 |
| 271 | Ga0495628_0055723 | 3300046516 | Bacteria | 3113 |
| 272 | Ga0495630_0000018 | 3300046517 | Bacteria | 186064 |
| 273 | Ga0495630_0003066 | 3300046517 | Bacteria | 11586 |
| 274 | Ga0495630_0003393 | 3300046517 | Bacteria | 11094 |
| 275 | Ga0495630_0034263 | 3300046517 | Bacteria | 3791 |
| 276 | Ga0495630_0086016 | 3300046517 | Bacteria | 2374 |
| 277 | Ga0495644_0000535 | 3300046523 | Bacteria | 16123 |
| 278 | Ga0495652_0004947 | 3300046529 | Bacteria | 12631 |
| 279 | Ga0495586_0017818 | 3300046535 | Bacteria | 3779 |
| 280 | Ga0495587_0006846 | 3300046536 | Bacteria | 7420 |
| 281 | Ga0495587_0108909 | 3300046536 | Bacteria | 1592 |
| 282 | Ga0495621_0011941 | 3300046539 | Bacteria | 2700 |
| 283 | Ga0495622_0000014 | 3300046557 | Bacteria | 182142 |
| 284 | Ga0495667_0000032 | 3300046559 | Bacteria | 143493 |
| 285 | Ga0495656_0000617 | 3300046615 | Bacteria | 11371 |
| 286 | Ga0495634_0000401 | 3300046642 | Bacteria | 42619 |
| 287 | Ga0495634_0021454 | 3300046642 | Bacteria | 4565 |
| 288 | Ga0495625_0101241 | 3300046660 | Bacteria | 1979 |
| 289 | Ga0495635_0000016 | 3300046663 | Bacteria | 214088 |
| 290 | Ga0495588_0000663 | 3300046674 | Bacteria | 15934 |
| 291 | Ga0495657_0000024 | 3300046675 | Bacteria | 145255 |
| 292 | Ga0495657_0016686 | 3300046675 | Bacteria | 5344 |
| 293 | Ga0495657_0018124 | 3300046675 | Bacteria | 5101 |
| 294 | Ga0495623_0071163 | 3300046679 | Bacteria | 2165 |
| 295 | Ga0495647_0000025 | 3300046681 | Bacteria | 65184 |
| 296 | Ga0495647_0000576 | 3300046681 | Bacteria | 10839 |
| 297 | Ga0495658_0000026 | 3300046683 | Bacteria | 77681 |
| 298 | Ga0495669_0000260 | 3300046684 | Bacteria | 30549 |
| 299 | Ga0495613_0000073 | 3300046689 | Bacteria | 98688 |
| 300 | Ga0495613_0000152 | 3300046689 | Bacteria | 68384 |
| 301 | Ga0495613_0049733 | 3300046689 | Bacteria | 3093 |
| 302 | Ga0495624_0000009 | 3300046690 | Bacteria | 145026 |
| 303 | Ga0495624_0000661 | 3300046690 | Bacteria | 26956 |
| 304 | Ga0495671_0122790 | 3300046692 | Bacteria | 1267 |
| 305 | Ga0495649_0003829 | 3300046694 | Bacteria | 9961 |
| 306 | Ga0495600_0017803 | 3300046809 | Bacteria | 4522 |
| 307 | Ga0495604_0000019 | 3300047317 | Bacteria | 175064 |
| 308 | Ga0495604_0002440 | 3300047317 | Bacteria | 14879 |
| 309 | Ga0495674_0000731 | 3300047319 | Bacteria | 31001 |
| 310 | Ga0495672_0050579 | 3300047320 | Bacteria | 2452 |
| 311 | Ga0495676_0000676 | 3300047321 | Bacteria | 28342 |
| 312 | Ga0495676_0008238 | 3300047321 | Bacteria | 9561 |
| 313 | Ga0495680_0000061 | 3300047322 | Bacteria | 90676 |
| 314 | Ga0495680_0001562 | 3300047322 | Bacteria | 24515 |
| 315 | Ga0495680_0004057 | 3300047322 | Bacteria | 14116 |
| 316 | Ga0495675_0000428 | 3300047444 | Bacteria | 28143 |
| 317 | Ga0495675_0040106 | 3300047444 | Bacteria | 2983 |
| 318 | Ga0495679_011449 | 3300047446 | Bacteria | 3423 |
| 319 | Ga0495685_010313 | 3300047447 | Bacteria | 3131 |
| 320 | Ga0495684_0203687 | 3300047471 | Bacteria | 1458 |
| 321 | Ga0495593_0059796 | 3300047673 | Bacteria | 1996 |
| 322 | Ga0495602_0000021 | 3300048088 | Bacteria | 168585 |
| 323 | Ga0495602_0035128 | 3300048088 | Bacteria | 4678 |
| 324 | Ga0496100_0000002 | 3300048903 | Bacteria | 489057 |
| 325 | Ga0496100_0000018 | 3300048903 | Bacteria | 162451 |
| 326 | Ga0496101_0000001 | 3300048904 | Bacteria | 489057 |
| 327 | Ga0496101_0000221 | 3300048904 | Bacteria | 42499 |
| 328 | Ga0496102_0000146 | 3300048905 | Bacteria | 96361 |
| 329 | Ga0496102_0050254 | 3300048905 | Bacteria | 3796 |
| 330 | Ga0496102_0152078 | 3300048905 | Bacteria | 2175 |
| 331 | Ga0496103_0000043 | 3300048906 | Bacteria | 167983 |
| 332 | Ga0496104_0000004 | 3300048907 | Bacteria | 641830 |
| 333 | Ga0496104_0000009 | 3300048907 | Bacteria | 488055 |
| 334 | Ga0496104_0220363 | 3300048907 | Bacteria | 1809 |
| 335 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 336 | Ga0496105_0000027 | 3300048908 | Bacteria | 148197 |
| 337 | Ga0496105_0008527 | 3300048908 | Bacteria | 7963 |
| 338 | Ga0496106_0000018 | 3300048909 | Bacteria | 175028 |
| 339 | Ga0496106_0000149 | 3300048909 | Bacteria | 51656 |
| 340 | Ga0496106_0000955 | 3300048909 | Bacteria | 21074 |
| 341 | Ga0496106_0008559 | 3300048909 | Bacteria | 7570 |
| 342 | Ga0496107_0000006 | 3300048910 | Bacteria | 258746 |
| 343 | Ga0496107_0000013 | 3300048910 | Bacteria | 178284 |
| 344 | Ga0496107_0241268 | 3300048910 | Bacteria | 1345 |
| 345 | Ga0496107_0384814 | 3300048910 | Unclassified | 1043 |
| 346 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 347 | Ga0496108_0000107 | 3300048911 | Bacteria | 86395 |
| 348 | Ga0496108_0000132 | 3300048911 | Bacteria | 73888 |
| 349 | Ga0496108_0013136 | 3300048911 | Bacteria | 6750 |
| 350 | Ga0496108_0082419 | 3300048911 | Bacteria | 2728 |
| 351 | Ga0496108_0239084 | 3300048911 | Bacteria | 1580 |
| 352 | Ga0496108_0400007 | 3300048911 | Bacteria | 1199 |
| 353 | Ga0496109_0000003 | 3300048912 | Bacteria | 420862 |
| 354 | Ga0496109_0000007 | 3300048912 | Bacteria | 247554 |
| 355 | Ga0496109_0000028 | 3300048912 | Bacteria | 168138 |
| 356 | Ga0496109_0000190 | 3300048912 | Bacteria | 61169 |
| 357 | Ga0496109_0078248 | 3300048912 | Bacteria | 3044 |
| 358 | Ga0496109_0083812 | 3300048912 | Bacteria | 2940 |
| 359 | Ga0496109_0174088 | 3300048912 | Bacteria | 2020 |
| 360 | Ga0496110_0046579 | 3300048913 | Bacteria | 3794 |
| 361 | Ga0496110_0143098 | 3300048913 | Bacteria | 2162 |
| 362 | Ga0496110_0186286 | 3300048913 | Bacteria | 1885 |
| 363 | Ga0496111_0042554 | 3300048914 | Bacteria | 3262 |
| 364 | Ga0496112_0000003 | 3300048915 | Bacteria | 660147 |
| 365 | Ga0496113_0032616 | 3300048916 | Bacteria | 3786 |
| 366 | Ga0496113_0043897 | 3300048916 | Bacteria | 3310 |
| 367 | Ga0496113_0063296 | 3300048916 | Bacteria | 2795 |
| 368 | Ga0496114_0000014 | 3300048917 | Bacteria | 297902 |
| 369 | Ga0496114_0494325 | 3300048917 | Bacteria | 1082 |
| 370 | Ga0496115_0000989 | 3300048918 | Bacteria | 20585 |
| 371 | Ga0496119_0023523 | 3300048922 | Bacteria | 4364 |
| 372 | Ga0496119_0051528 | 3300048922 | Bacteria | 2529 |
| 373 | Ga0496120_0015155 | 3300048923 | Bacteria | 5099 |
| 374 | Ga0496121_0060850 | 3300048924 | Bacteria | 3103 |
| 375 | Ga0496124_0068611 | 3300048927 | Bacteria | 2946 |
| 376 | Ga0501032_0000899 | 3300049569 | Bacteria | 24104 |
| 377 | Ga0501033_0001140 | 3300049570 | Bacteria | 24003 |
| 378 | Ga0501034_0022851 | 3300049571 | Bacteria | 6371 |
| 379 | Ga0501034_0396937 | 3300049571 | Bacteria | 1302 |
| 380 | Ga0501036_0001260 | 3300049572 | Bacteria | 19408 |
| 381 | Ga0501037_0000774 | 3300049573 | Bacteria | 24049 |
| 382 | Ga0501038_0001146 | 3300049574 | Bacteria | 24003 |
| 383 | Ga0501040_0020292 | 3300049576 | Bacteria | 4428 |
| 384 | Ga0501041_0177632 | 3300049577 | Unclassified | 1333 |
| 385 | Ga0501042_0031003 | 3300049578 | Bacteria | 3782 |
| 386 | Ga0501042_0058480 | 3300049578 | Bacteria | 2752 |
| 387 | Ga0501042_0145697 | 3300049578 | Bacteria | 1707 |
| 388 | Ga0501043_0001082 | 3300049579 | Bacteria | 23968 |
| 389 | Ga0501043_0082624 | 3300049579 | Bacteria | 2525 |
| 390 | Ga0501046_0000447 | 3300049580 | Bacteria | 41432 |
| 391 | Ga0501047_0001335 | 3300049581 | Bacteria | 24206 |
| 392 | Ga0501047_0074650 | 3300049581 | Bacteria | 3264 |
| 393 | Ga0501047_0151114 | 3300049581 | Unclassified | 2198 |
| 394 | Ga0501048_0000734 | 3300049582 | Bacteria | 24021 |
| 395 | Ga0501068_0051688 | 3300049584 | Bacteria | 2486 |
| 396 | Ga0501068_0075635 | 3300049584 | Bacteria | 2060 |
| 397 | Ga0501069_0083173 | 3300049585 | Bacteria | 1804 |
| 398 | Ga0501070_0001137 | 3300049586 | Bacteria | 23887 |
| 399 | Ga0501070_0006027 | 3300049586 | Bacteria | 10324 |
| 400 | Ga0501070_0049980 | 3300049586 | Bacteria | 3471 |
| 401 | Ga0501071_0008734 | 3300049587 | Bacteria | 6706 |
| 402 | Ga0501072_0012297 | 3300049588 | Bacteria | 6541 |
| 403 | Ga0501072_0064461 | 3300049588 | Bacteria | 2889 |
| 404 | Ga0501072_0462330 | 3300049588 | Bacteria | 1005 |
| 405 | Ga0501073_0014644 | 3300049589 | Bacteria | 5698 |
| 406 | Ga0501073_0016359 | 3300049589 | Bacteria | 5376 |
| 407 | Ga0501074_0033768 | 3300049590 | Bacteria | 3708 |
| 408 | Ga0501074_0046514 | 3300049590 | Bacteria | 3137 |
| 409 | Ga0501074_0120453 | 3300049590 | Bacteria | 1877 |
| 410 | Ga0501076_0124186 | 3300049592 | Bacteria | 2091 |
| 411 | Ga0501077_0023713 | 3300049593 | Bacteria | 3890 |
| 412 | Ga0501077_0102467 | 3300049593 | Bacteria | 1814 |
| 413 | Ga0501079_0037573 | 3300049741 | Bacteria | 3732 |
| 414 | Ga0501080_0032766 | 3300049742 | Bacteria | 4847 |
| 415 | Ga0501080_0034163 | 3300049742 | Bacteria | 4746 |
| 416 | Ga0501080_0165696 | 3300049742 | Bacteria | 2039 |
| 417 | Ga0501081_0164065 | 3300049743 | Bacteria | 1602 |
| 418 | Ga0501081_0317629 | 3300049743 | Bacteria | 1144 |
| 419 | Ga0501083_0015145 | 3300049744 | Bacteria | 5399 |
| 420 | Ga0501083_0029438 | 3300049744 | Bacteria | 3776 |
| 421 | Ga0501035_0004594 | 3300049822 | Bacteria | 13088 |
| 422 | Ga0501035_0083570 | 3300049822 | Bacteria | 2817 |
| 423 | Ga0501044_0025332 | 3300049823 | Bacteria | 6286 |
| 424 | Ga0501044_0085187 | 3300049823 | Bacteria | 3193 |
| 425 | Ga0501044_0156510 | 3300049823 | Unclassified | 2258 |
| 426 | Ga0501045_0043030 | 3300049824 | Bacteria | 3288 |
| 427 | nmdc:mga03n38_85223_c1 | 3300050490 | Bacteria | 1493 |
| 428 | nmdc:mga00v17_105302_c1 | 3300050491 | Bacteria | 1785 |
| 429 | nmdc:mga00v17_45209_c1 | 3300050491 | Bacteria | 2659 |
| 430 | nmdc:mga0yw44_143773_c1 | 3300050492 | Bacteria | 1551 |
| 431 | nmdc:mga0qj67_35695_c1 | 3300050509 | Bacteria | 3888 |
| 432 | nmdc:mga0qj67_63189_c1 | 3300050509 | Unclassified | 2944 |
| 433 | nmdc:mga06r32_6365_c1 | 3300050510 | Bacteria | 10611 |
| 434 | nmdc:mga0n895_26632_c1 | 3300050512 | Bacteria | 5480 |
| 435 | nmdc:mga08x19_59015_c1 | 3300050514 | Bacteria | 2483 |
| 436 | nmdc:mga0a205_11_c1 | 3300050515 | Bacteria | 121735 |
| 437 | nmdc:mga0a205_437_c2 | 3300050515 | Bacteria | 25944 |
| 438 | nmdc:mga0a205_88844_c1 | 3300050515 | Bacteria | 2987 |
| 439 | Ga0495601_0000039 | 3300053077 | Bacteria | 79594 |
| 440 | Ga0495601_0003264 | 3300053077 | Bacteria | 9268 |
| 441 | Ga0495601_0132891 | 3300053077 | Bacteria | 1621 |
| 442 | Ga0495612_0019716 | 3300053078 | Bacteria | 2701 |
| 443 | Ga0495612_0046039 | 3300053078 | Bacteria | 1786 |
| 444 | Ga0495612_0053953 | 3300053078 | Bacteria | 1655 |
| 445 | Ga0495655_0000001 | 3300053083 | Bacteria | 419518 |
| 446 | Ga0495655_0035206 | 3300053083 | Bacteria | 1244 |
| 447 | Ga0495595_0000014 | 3300053084 | Bacteria | 145255 |
| 448 | Ga0495619_0000021 | 3300053085 | Bacteria | 187095 |
| 449 | Ga0495619_0000147 | 3300053085 | Bacteria | 51947 |
| 450 | Ga0495619_0034908 | 3300053085 | Bacteria | 3269 |
| 451 | Ga0500614_000026 | 3300053123 | Bacteria | 35584 |
| 452 | Ga0500628_000017 | 3300053129 | Bacteria | 90481 |
| 453 | Ga0501084_0161958 | 3300054114 | Bacteria | 1887 |
| 454 | Ga0587111_0006462 | 3300060346 | Bacteria | 1860 |
| 455 | Ga0530510_0006221 | 3300061734 | Bacteria | 8301 |
| 456 | Ga0530510_0021805 | 3300061734 | Bacteria | 4559 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048088 | Ga0495602_0000021 | Ga0495602_0000021_95464_96444 | 283 |
| 2 | 3300005466 | Ga0070685_10048203 | Ga0070685_100482032 | 285 |
| 3 | 3300005543 | Ga0070672_100000091 | Ga0070672_1000000912 | 285 |
| 4 | 3300046459 | Ga0495629_0000189 | Ga0495629_0000189_10144_11118 | 285 |
| 5 | 3300005578 | Ga0068854_100000031 | Ga0068854_10000003168 | 286 |
| 6 | 3300005614 | Ga0068856_100246618 | Ga0068856_1002466182 | 286 |
| 7 | 3300009177 | Ga0105248_10000118 | Ga0105248_1000011853 | 286 |
| 8 | 3300025941 | Ga0207711_10000020 | Ga0207711_10000020124 | 286 |
| 9 | 3300025981 | Ga0207640_10000015 | Ga0207640_10000015148 | 286 |
| 10 | 3300026078 | Ga0207702_10234047 | Ga0207702_102340472 | 286 |
| 11 | 3300026142 | Ga0207698_10000012 | Ga0207698_10000012124 | 286 |
| 12 | 3300044842 | Ga0466957_0029211 | Ga0466957_0029211_1530_2492 | 286 |
| 13 | 3300047673 | Ga0495593_0059796 | Ga0495593_0059796_194_1153 | 286 |
| 14 | 3300053083 | Ga0495655_0000001 | Ga0495655_0000001_69238_70224 | 286 |
| 15 | 3300053129 | Ga0500628_000017 | Ga0500628_000017_27043_28029 | 286 |
| 16 | 3300013307 | Ga0157372_10003159 | Ga0157372_1000315916 | 287 |
| 17 | 3300005834 | Ga0068851_10000333 | Ga0068851_100003334 | 288 |
| 18 | 3300025321 | Ga0207656_10000696 | Ga0207656_100006967 | 288 |
| 19 | 3300005327 | Ga0070658_10171056 | Ga0070658_101710562 | 289 |
| 20 | 3300025909 | Ga0207705_10084687 | Ga0207705_100846872 | 289 |
| 21 | 3300046507 | Ga0495606_0000221 | Ga0495606_0000221_58356_59330 | 289 |
| 22 | 3300046681 | Ga0495647_0000576 | Ga0495647_0000576_444_1418 | 289 |
| 23 | 3300047320 | Ga0495672_0050579 | Ga0495672_0050579_786_1760 | 289 |
| 24 | 3300005439 | Ga0070711_100080257 | Ga0070711_1000802573 | 290 |
| 25 | 3300005563 | Ga0068855_100413806 | Ga0068855_1004138061 | 290 |
| 26 | 3300048914 | Ga0496111_0042554 | Ga0496111_0042554_1043_2017 | 290 |
| 27 | 3300048905 | Ga0496102_0000146 | Ga0496102_0000146_22880_23830 | 291 |
| 28 | 3300048906 | Ga0496103_0000043 | Ga0496103_0000043_1876_2826 | 291 |
| 29 | 3300005341 | Ga0070691_10000133 | Ga0070691_1000013322 | 292 |
| 30 | 3300009176 | Ga0105242_10000132 | Ga0105242_1000013250 | 296 |
| 31 | 3300025934 | Ga0207686_10000033 | Ga0207686_10000033143 | 296 |
| 32 | 3300037312 | Ga0395899_0253765 | Ga0395899_0253765_72_1013 | 297 |
| 33 | 3300005981 | Ga0081538_10030623 | Ga0081538_100306231 | 301 |
| 34 | 3300001990 | JGI24737J22298_10041849 | JGI24737J22298_100418492 | 302 |
| 35 | 3300002067 | JGI24735J21928_10022663 | JGI24735J21928_100226632 | 302 |
| 36 | 3300002074 | JGI24748J21848_1000586 | JGI24748J21848_10005862 | 302 |
| 37 | 3300002239 | JGI24034J26672_10017446 | JGI24034J26672_100174462 | 302 |
| 38 | 3300002244 | JGI24742J22300_10001127 | JGI24742J22300_100011276 | 302 |
| 39 | 3300002244 | JGI24742J22300_10014452 | JGI24742J22300_100144521 | 302 |
| 40 | 3300003373 | JGI25407J50210_10012036 | JGI25407J50210_100120363 | 302 |
| 41 | 3300005329 | Ga0070683_100007965 | Ga0070683_1000079658 | 302 |
| 42 | 3300005333 | Ga0070677_10000057 | Ga0070677_1000005727 | 302 |
| 43 | 3300005335 | Ga0070666_10019445 | Ga0070666_100194453 | 302 |
| 44 | 3300005337 | Ga0070682_100001629 | Ga0070682_1000016292 | 302 |
| 45 | 3300005338 | Ga0068868_100000151 | Ga0068868_10000015126 | 302 |
| 46 | 3300005338 | Ga0068868_100028702 | Ga0068868_1000287023 | 302 |
| 47 | 3300005339 | Ga0070660_100001214 | Ga0070660_10000121410 | 302 |
| 48 | 3300005340 | Ga0070689_100035143 | Ga0070689_1000351435 | 302 |
| 49 | 3300005341 | Ga0070691_10012036 | Ga0070691_100120363 | 302 |
| 50 | 3300005343 | Ga0070687_100053723 | Ga0070687_1000537232 | 302 |
| 51 | 3300005344 | Ga0070661_100000742 | Ga0070661_1000007427 | 302 |
| 52 | 3300005345 | Ga0070692_10058144 | Ga0070692_100581444 | 302 |
| 53 | 3300005347 | Ga0070668_100036849 | Ga0070668_1000368492 | 302 |
| 54 | 3300005354 | Ga0070675_100000053 | Ga0070675_10000005346 | 302 |
| 55 | 3300005354 | Ga0070675_100052994 | Ga0070675_1000529944 | 302 |
| 56 | 3300005356 | Ga0070674_100000008 | Ga0070674_100000008124 | 302 |
| 57 | 3300005356 | Ga0070674_100000082 | Ga0070674_10000008222 | 302 |
| 58 | 3300005364 | Ga0070673_100009564 | Ga0070673_1000095645 | 302 |
| 59 | 3300005364 | Ga0070673_100182619 | Ga0070673_1001826192 | 302 |
| 60 | 3300005365 | Ga0070688_100000012 | Ga0070688_10000001282 | 302 |
| 61 | 3300005365 | Ga0070688_100000492 | Ga0070688_1000004924 | 302 |
| 62 | 3300005365 | Ga0070688_100042986 | Ga0070688_1000429861 | 302 |
| 63 | 3300005366 | Ga0070659_100002102 | Ga0070659_10000210213 | 302 |
| 64 | 3300005367 | Ga0070667_100120149 | Ga0070667_1001201493 | 302 |
| 65 | 3300005367 | Ga0070667_100134235 | Ga0070667_1001342352 | 302 |
| 66 | 3300005435 | Ga0070714_100468067 | Ga0070714_1004680672 | 302 |
| 67 | 3300005438 | Ga0070701_10010964 | Ga0070701_100109643 | 302 |
| 68 | 3300005439 | Ga0070711_100009855 | Ga0070711_1000098556 | 302 |
| 69 | 3300005440 | Ga0070705_100262334 | Ga0070705_1002623342 | 302 |
| 70 | 3300005444 | Ga0070694_100053345 | Ga0070694_1000533453 | 302 |
| 71 | 3300005456 | Ga0070678_100005092 | Ga0070678_1000050925 | 302 |
| 72 | 3300005457 | Ga0070662_100000016 | Ga0070662_10000001643 | 302 |
| 73 | 3300005457 | Ga0070662_100021714 | Ga0070662_1000217144 | 302 |
| 74 | 3300005458 | Ga0070681_10016762 | Ga0070681_100167623 | 302 |
| 75 | 3300005458 | Ga0070681_10353789 | Ga0070681_103537892 | 302 |
| 76 | 3300005466 | Ga0070685_10000018 | Ga0070685_100000184 | 302 |
| 77 | 3300005466 | Ga0070685_10000460 | Ga0070685_100004604 | 302 |
| 78 | 3300005466 | Ga0070685_10019608 | Ga0070685_100196084 | 302 |
| 79 | 3300005530 | Ga0070679_100001299 | Ga0070679_1000012995 | 302 |
| 80 | 3300005530 | Ga0070679_100067083 | Ga0070679_1000670835 | 302 |
| 81 | 3300005535 | Ga0070684_100068082 | Ga0070684_1000680824 | 302 |
| 82 | 3300005539 | Ga0068853_100019642 | Ga0068853_1000196425 | 302 |
| 83 | 3300005539 | Ga0068853_100242391 | Ga0068853_1002423911 | 302 |
| 84 | 3300005547 | Ga0070693_100003254 | Ga0070693_1000032547 | 302 |
| 85 | 3300005548 | Ga0070665_100000244 | Ga0070665_10000024468 | 302 |
| 86 | 3300005548 | Ga0070665_100706326 | Ga0070665_1007063261 | 302 |
| 87 | 3300005564 | Ga0070664_100016760 | Ga0070664_1000167606 | 302 |
| 88 | 3300005578 | Ga0068854_100009544 | Ga0068854_1000095445 | 302 |
| 89 | 3300005614 | Ga0068856_100024596 | Ga0068856_1000245964 | 302 |
| 90 | 3300005614 | Ga0068856_100241439 | Ga0068856_1002414392 | 302 |
| 91 | 3300005615 | Ga0070702_100076656 | Ga0070702_1000766562 | 302 |
| 92 | 3300005616 | Ga0068852_100012745 | Ga0068852_1000127455 | 302 |
| 93 | 3300005616 | Ga0068852_100075715 | Ga0068852_1000757153 | 302 |
| 94 | 3300005718 | Ga0068866_10000001 | Ga0068866_10000001206 | 302 |
| 95 | 3300005718 | Ga0068866_10000170 | Ga0068866_1000017026 | 302 |
| 96 | 3300005842 | Ga0068858_100000109 | Ga0068858_1000001096 | 302 |
| 97 | 3300005842 | Ga0068858_100000450 | Ga0068858_10000045048 | 302 |
| 98 | 3300005843 | Ga0068860_100003359 | Ga0068860_10000335910 | 302 |
| 99 | 3300005844 | Ga0068862_100455316 | Ga0068862_1004553161 | 302 |
| 100 | 3300005937 | Ga0081455_10015359 | Ga0081455_100153592 | 302 |
| 101 | 3300005937 | Ga0081455_10048254 | Ga0081455_100482543 | 302 |
| 102 | 3300005937 | Ga0081455_10089283 | Ga0081455_100892834 | 302 |
| 103 | 3300005937 | Ga0081455_10282767 | Ga0081455_102827672 | 302 |
| 104 | 3300005981 | Ga0081538_10000030 | Ga0081538_10000030108 | 302 |
| 105 | 3300005981 | Ga0081538_10000426 | Ga0081538_1000042619 | 302 |
| 106 | 3300005981 | Ga0081538_10017283 | Ga0081538_100172833 | 302 |
| 107 | 3300005981 | Ga0081538_10062841 | Ga0081538_100628412 | 302 |
| 108 | 3300006038 | Ga0075365_10013530 | Ga0075365_100135305 | 302 |
| 109 | 3300006051 | Ga0075364_10056377 | Ga0075364_100563772 | 302 |
| 110 | 3300006051 | Ga0075364_10129084 | Ga0075364_101290843 | 302 |
| 111 | 3300006163 | Ga0070715_10000001 | Ga0070715_10000001179 | 302 |
| 112 | 3300006175 | Ga0070712_100004464 | Ga0070712_1000044642 | 302 |
| 113 | 3300006847 | Ga0075431_100008782 | Ga0075431_1000087829 | 302 |
| 114 | 3300006852 | Ga0075433_10000478 | Ga0075433_1000047814 | 302 |
| 115 | 3300006852 | Ga0075433_10027471 | Ga0075433_100274714 | 302 |
| 116 | 3300006881 | Ga0068865_100000402 | Ga0068865_1000004025 | 302 |
| 117 | 3300006881 | Ga0068865_100009454 | Ga0068865_1000094545 | 302 |
| 118 | 3300006914 | Ga0075436_100060401 | Ga0075436_1000604014 | 302 |
| 119 | 3300009093 | Ga0105240_10154974 | Ga0105240_101549743 | 302 |
| 120 | 3300009094 | Ga0111539_10624819 | Ga0111539_106248192 | 302 |
| 121 | 3300009094 | Ga0111539_10748723 | Ga0111539_107487232 | 302 |
| 122 | 3300009098 | Ga0105245_10000180 | Ga0105245_100001802 | 302 |
| 123 | 3300009098 | Ga0105245_10000619 | Ga0105245_100006197 | 302 |
| 124 | 3300009147 | Ga0114129_10092683 | Ga0114129_100926834 | 302 |
| 125 | 3300009176 | Ga0105242_10063020 | Ga0105242_100630203 | 302 |
| 126 | 3300009176 | Ga0105242_10154271 | Ga0105242_101542712 | 302 |
| 127 | 3300009176 | Ga0105242_10370040 | Ga0105242_103700402 | 302 |
| 128 | 3300009551 | Ga0105238_10061765 | Ga0105238_100617655 | 302 |
| 129 | 3300009553 | Ga0105249_10000068 | Ga0105249_1000006837 | 302 |
| 130 | 3300009553 | Ga0105249_10029618 | Ga0105249_100296185 | 302 |
| 131 | 3300009553 | Ga0105249_10453424 | Ga0105249_104534242 | 302 |
| 132 | 3300011119 | Ga0105246_10207740 | Ga0105246_102077401 | 302 |
| 133 | 3300013102 | Ga0157371_10086413 | Ga0157371_100864132 | 302 |
| 134 | 3300013104 | Ga0157370_10007239 | Ga0157370_100072397 | 302 |
| 135 | 3300013105 | Ga0157369_10000142 | Ga0157369_1000014211 | 302 |
| 136 | 3300013297 | Ga0157378_10018651 | Ga0157378_100186512 | 302 |
| 137 | 3300013306 | Ga0163162_10583033 | Ga0163162_105830332 | 302 |
| 138 | 3300013307 | Ga0157372_10081714 | Ga0157372_100817143 | 302 |
| 139 | 3300013308 | Ga0157375_10000367 | Ga0157375_1000036716 | 302 |
| 140 | 3300014326 | Ga0157380_10000059 | Ga0157380_1000005927 | 302 |
| 141 | 3300014326 | Ga0157380_10002780 | Ga0157380_1000278010 | 302 |
| 142 | 3300014326 | Ga0157380_10145284 | Ga0157380_101452842 | 302 |
| 143 | 3300014745 | Ga0157377_10021783 | Ga0157377_100217835 | 302 |
| 144 | 3300014968 | Ga0157379_10011621 | Ga0157379_100116219 | 302 |
| 145 | 3300014968 | Ga0157379_10023859 | Ga0157379_100238593 | 302 |
| 146 | 3300025321 | Ga0207656_10021606 | Ga0207656_100216063 | 302 |
| 147 | 3300025893 | Ga0207682_10000129 | Ga0207682_100001299 | 302 |
| 148 | 3300025899 | Ga0207642_10000006 | Ga0207642_10000006209 | 302 |
| 149 | 3300025899 | Ga0207642_10000007 | Ga0207642_1000000727 | 302 |
| 150 | 3300025899 | Ga0207642_10000222 | Ga0207642_1000022216 | 302 |
| 151 | 3300025899 | Ga0207642_10087345 | Ga0207642_100873451 | 302 |
| 152 | 3300025901 | Ga0207688_10004232 | Ga0207688_100042325 | 302 |
| 153 | 3300025903 | Ga0207680_10089821 | Ga0207680_100898213 | 302 |
| 154 | 3300025905 | Ga0207685_10000011 | Ga0207685_10000011179 | 302 |
| 155 | 3300025912 | Ga0207707_10033967 | Ga0207707_100339673 | 302 |
| 156 | 3300025915 | Ga0207693_10054160 | Ga0207693_100541604 | 302 |
| 157 | 3300025916 | Ga0207663_10006691 | Ga0207663_100066913 | 302 |
| 158 | 3300025918 | Ga0207662_10043224 | Ga0207662_100432244 | 302 |
| 159 | 3300025919 | Ga0207657_10032142 | Ga0207657_100321423 | 302 |
| 160 | 3300025920 | Ga0207649_10000076 | Ga0207649_1000007669 | 302 |
| 161 | 3300025921 | Ga0207652_10002610 | Ga0207652_100026105 | 302 |
| 162 | 3300025921 | Ga0207652_10004210 | Ga0207652_1000421011 | 302 |
| 163 | 3300025924 | Ga0207694_10389477 | Ga0207694_103894772 | 302 |
| 164 | 3300025926 | Ga0207659_10000010 | Ga0207659_10000010253 | 302 |
| 165 | 3300025926 | Ga0207659_10012687 | Ga0207659_100126876 | 302 |
| 166 | 3300025927 | Ga0207687_10000007 | Ga0207687_10000007239 | 302 |
| 167 | 3300025927 | Ga0207687_10000018 | Ga0207687_1000001855 | 302 |
| 168 | 3300025927 | Ga0207687_10000269 | Ga0207687_100002697 | 302 |
| 169 | 3300025927 | Ga0207687_10098663 | Ga0207687_100986633 | 302 |
| 170 | 3300025929 | Ga0207664_10414929 | Ga0207664_104149292 | 302 |
| 171 | 3300025932 | Ga0207690_10024040 | Ga0207690_100240402 | 302 |
| 172 | 3300025933 | Ga0207706_10000068 | Ga0207706_1000006843 | 302 |
| 173 | 3300025933 | Ga0207706_10001582 | Ga0207706_1000158220 | 302 |
| 174 | 3300025934 | Ga0207686_10139076 | Ga0207686_101390762 | 302 |
| 175 | 3300025937 | Ga0207669_10000004 | Ga0207669_1000000482 | 302 |
| 176 | 3300025937 | Ga0207669_10000012 | Ga0207669_1000001226 | 302 |
| 177 | 3300025938 | Ga0207704_10000190 | Ga0207704_1000019011 | 302 |
| 178 | 3300025938 | Ga0207704_10004819 | Ga0207704_100048195 | 302 |
| 179 | 3300025940 | Ga0207691_10000190 | Ga0207691_1000019048 | 302 |
| 180 | 3300025940 | Ga0207691_10425256 | Ga0207691_104252562 | 302 |
| 181 | 3300025944 | Ga0207661_10002022 | Ga0207661_1000202212 | 302 |
| 182 | 3300025944 | Ga0207661_10002688 | Ga0207661_100026887 | 302 |
| 183 | 3300025944 | Ga0207661_10003810 | Ga0207661_100038102 | 302 |
| 184 | 3300025944 | Ga0207661_10087203 | Ga0207661_100872032 | 302 |
| 185 | 3300025960 | Ga0207651_10001019 | Ga0207651_100010195 | 302 |
| 186 | 3300025961 | Ga0207712_10000007 | Ga0207712_10000007189 | 302 |
| 187 | 3300025961 | Ga0207712_10020131 | Ga0207712_100201314 | 302 |
| 188 | 3300025972 | Ga0207668_10017860 | Ga0207668_100178602 | 302 |
| 189 | 3300025981 | Ga0207640_10014004 | Ga0207640_100140046 | 302 |
| 190 | 3300025986 | Ga0207658_10055167 | Ga0207658_100551673 | 302 |
| 191 | 3300026023 | Ga0207677_10000421 | Ga0207677_100004215 | 302 |
| 192 | 3300026023 | Ga0207677_10000919 | Ga0207677_100009193 | 302 |
| 193 | 3300026035 | Ga0207703_10000040 | Ga0207703_1000004087 | 302 |
| 194 | 3300026035 | Ga0207703_10000322 | Ga0207703_1000032248 | 302 |
| 195 | 3300026035 | Ga0207703_10122263 | Ga0207703_101222633 | 302 |
| 196 | 3300026041 | Ga0207639_10018955 | Ga0207639_100189554 | 302 |
| 197 | 3300026067 | Ga0207678_10000834 | Ga0207678_1000083417 | 302 |
| 198 | 3300026067 | Ga0207678_10001751 | Ga0207678_100017512 | 302 |
| 199 | 3300026078 | Ga0207702_10000016 | Ga0207702_10000016215 | 302 |
| 200 | 3300026089 | Ga0207648_10101570 | Ga0207648_101015703 | 302 |
| 201 | 3300026121 | Ga0207683_10011233 | Ga0207683_100112335 | 302 |
| 202 | 3300026121 | Ga0207683_10127807 | Ga0207683_101278074 | 302 |
| 203 | 3300028379 | Ga0268266_10000020 | Ga0268266_1000002066 | 302 |
| 204 | 3300028379 | Ga0268266_10000085 | Ga0268266_1000008574 | 302 |
| 205 | 3300028379 | Ga0268266_10044964 | Ga0268266_100449642 | 302 |
| 206 | 3300028380 | Ga0268265_10227130 | Ga0268265_102271302 | 302 |
| 207 | 3300028381 | Ga0268264_10006922 | Ga0268264_100069225 | 302 |
| 208 | 3300031250 | Ga0265331_10049004 | Ga0265331_100490043 | 302 |
| 209 | 3300031728 | Ga0316578_10134705 | Ga0316578_101347052 | 302 |
| 210 | 3300032002 | Ga0307416_100384511 | Ga0307416_1003845112 | 302 |
| 211 | 3300032126 | Ga0307415_100010918 | Ga0307415_1000109185 | 302 |
| 212 | 3300035398 | Ga0316574_0112067 | Ga0316574_0112067_356_1264 | 302 |
| 213 | 3300036401 | Ga0373937_0145908 | Ga0373937_0145908_890_1798 | 302 |
| 214 | 3300036712 | Ga0316584_0050287 | Ga0316584_0050287_949_1857 | 302 |
| 215 | 3300038443 | Ga0395901_0320159 | Ga0395901_0320159_371_1285 | 302 |
| 216 | 3300041512 | Ga0451853_1421606 | Ga0451853_1421606_1949_2857 | 302 |
| 217 | 3300044694 | Ga0466963_0000023 | Ga0466963_0000023_30986_31894 | 302 |
| 218 | 3300044694 | Ga0466963_0012059 | Ga0466963_0012059_983_1942 | 302 |
| 219 | 3300044694 | Ga0466963_0026375 | Ga0466963_0026375_640_1599 | 302 |
| 220 | 3300045836 | Ga0466958_0025323 | Ga0466958_0025323_332_1294 | 302 |
| 221 | 3300045976 | Ga0466967_0000027 | Ga0466967_0000027_43941_44900 | 302 |
| 222 | 3300045976 | Ga0466967_0010631 | Ga0466967_0010631_5771_6709 | 302 |
| 223 | 3300046454 | Ga0495592_0000036 | Ga0495592_0000036_34592_35500 | 302 |
| 224 | 3300046455 | Ga0495603_0000097 | Ga0495603_0000097_23210_24118 | 302 |
| 225 | 3300046461 | Ga0495641_0000003 | Ga0495641_0000003_201831_202739 | 302 |
| 226 | 3300046461 | Ga0495641_0014845 | Ga0495641_0014845_2483_3457 | 302 |
| 227 | 3300046462 | Ga0495651_0068491 | Ga0495651_0068491_180_1088 | 302 |
| 228 | 3300046463 | Ga0495653_0013986 | Ga0495653_0013986_731_1639 | 302 |
| 229 | 3300046463 | Ga0495653_0029748 | Ga0495653_0029748_2998_3906 | 302 |
| 230 | 3300046473 | Ga0495582_0000029 | Ga0495582_0000029_52113_53021 | 302 |
| 231 | 3300046475 | Ga0495639_0074963 | Ga0495639_0074963_334_1242 | 302 |
| 232 | 3300046476 | Ga0495662_0000030 | Ga0495662_0000030_35805_36713 | 302 |
| 233 | 3300046511 | Ga0495608_0000031 | Ga0495608_0000031_117750_118658 | 302 |
| 234 | 3300046511 | Ga0495608_0000204 | Ga0495608_0000204_29389_30297 | 302 |
| 235 | 3300046511 | Ga0495608_0004209 | Ga0495608_0004209_4773_5681 | 302 |
| 236 | 3300046515 | Ga0495620_0001199 | Ga0495620_0001199_6925_7833 | 302 |
| 237 | 3300046516 | Ga0495628_0055723 | Ga0495628_0055723_1486_2394 | 302 |
| 238 | 3300046517 | Ga0495630_0000018 | Ga0495630_0000018_113911_114885 | 302 |
| 239 | 3300046517 | Ga0495630_0003066 | Ga0495630_0003066_54_962 | 302 |
| 240 | 3300046517 | Ga0495630_0003393 | Ga0495630_0003393_2197_3105 | 302 |
| 241 | 3300046517 | Ga0495630_0034263 | Ga0495630_0034263_1053_1961 | 302 |
| 242 | 3300046517 | Ga0495630_0086016 | Ga0495630_0086016_1274_2182 | 302 |
| 243 | 3300046523 | Ga0495644_0000535 | Ga0495644_0000535_2475_3383 | 302 |
| 244 | 3300046535 | Ga0495586_0017818 | Ga0495586_0017818_2083_2991 | 302 |
| 245 | 3300046536 | Ga0495587_0006846 | Ga0495587_0006846_2409_3317 | 302 |
| 246 | 3300046539 | Ga0495621_0011941 | Ga0495621_0011941_1739_2647 | 302 |
| 247 | 3300046559 | Ga0495667_0000032 | Ga0495667_0000032_100235_101143 | 302 |
| 248 | 3300046642 | Ga0495634_0000401 | Ga0495634_0000401_3758_4666 | 302 |
| 249 | 3300046663 | Ga0495635_0000016 | Ga0495635_0000016_34442_35350 | 302 |
| 250 | 3300046674 | Ga0495588_0000663 | Ga0495588_0000663_1543_2517 | 302 |
| 251 | 3300046675 | Ga0495657_0000024 | Ga0495657_0000024_117750_118658 | 302 |
| 252 | 3300046675 | Ga0495657_0016686 | Ga0495657_0016686_1170_2078 | 302 |
| 253 | 3300046675 | Ga0495657_0018124 | Ga0495657_0018124_2067_2975 | 302 |
| 254 | 3300046679 | Ga0495623_0071163 | Ga0495623_0071163_868_2061 | 302 |
| 255 | 3300046681 | Ga0495647_0000025 | Ga0495647_0000025_26530_27438 | 302 |
| 256 | 3300046683 | Ga0495658_0000026 | Ga0495658_0000026_24922_25830 | 302 |
| 257 | 3300046684 | Ga0495669_0000260 | Ga0495669_0000260_20294_21202 | 302 |
| 258 | 3300046689 | Ga0495613_0000152 | Ga0495613_0000152_23798_24706 | 302 |
| 259 | 3300046689 | Ga0495613_0049733 | Ga0495613_0049733_1661_2569 | 302 |
| 260 | 3300046690 | Ga0495624_0000009 | Ga0495624_0000009_117210_118118 | 302 |
| 261 | 3300046690 | Ga0495624_0000661 | Ga0495624_0000661_20196_21170 | 302 |
| 262 | 3300046692 | Ga0495671_0122790 | Ga0495671_0122790_11_919 | 302 |
| 263 | 3300046694 | Ga0495649_0003829 | Ga0495649_0003829_4903_5811 | 302 |
| 264 | 3300047317 | Ga0495604_0000019 | Ga0495604_0000019_39791_40699 | 302 |
| 265 | 3300047321 | Ga0495676_0000676 | Ga0495676_0000676_24432_25340 | 302 |
| 266 | 3300047322 | Ga0495680_0000061 | Ga0495680_0000061_72409_73317 | 302 |
| 267 | 3300047322 | Ga0495680_0001562 | Ga0495680_0001562_21609_22517 | 302 |
| 268 | 3300047322 | Ga0495680_0004057 | Ga0495680_0004057_4328_5236 | 302 |
| 269 | 3300047444 | Ga0495675_0000428 | Ga0495675_0000428_26598_27506 | 302 |
| 270 | 3300047446 | Ga0495679_011449 | Ga0495679_011449_211_1119 | 302 |
| 271 | 3300047447 | Ga0495685_010313 | Ga0495685_010313_1923_2831 | 302 |
| 272 | 3300047471 | Ga0495684_0203687 | Ga0495684_0203687_313_1221 | 302 |
| 273 | 3300048903 | Ga0496100_0000002 | Ga0496100_0000002_181531_182439 | 302 |
| 274 | 3300048904 | Ga0496101_0000001 | Ga0496101_0000001_181531_182439 | 302 |
| 275 | 3300048905 | Ga0496102_0050254 | Ga0496102_0050254_942_1850 | 302 |
| 276 | 3300048905 | Ga0496102_0152078 | Ga0496102_0152078_303_1211 | 302 |
| 277 | 3300048907 | Ga0496104_0000009 | Ga0496104_0000009_9647_10555 | 302 |
| 278 | 3300048907 | Ga0496104_0220363 | Ga0496104_0220363_95_1003 | 302 |
| 279 | 3300048908 | Ga0496105_0000027 | Ga0496105_0000027_137970_138878 | 302 |
| 280 | 3300048909 | Ga0496106_0000149 | Ga0496106_0000149_30537_31445 | 302 |
| 281 | 3300048909 | Ga0496106_0000955 | Ga0496106_0000955_4848_5756 | 302 |
| 282 | 3300048909 | Ga0496106_0008559 | Ga0496106_0008559_1584_2492 | 302 |
| 283 | 3300048910 | Ga0496107_0000013 | Ga0496107_0000013_9253_10161 | 302 |
| 284 | 3300048910 | Ga0496107_0241268 | Ga0496107_0241268_47_955 | 302 |
| 285 | 3300048910 | Ga0496107_0384814 | Ga0496107_0384814_111_1019 | 302 |
| 286 | 3300048911 | Ga0496108_0000001 | Ga0496108_0000001_465877_466785 | 302 |
| 287 | 3300048911 | Ga0496108_0000107 | Ga0496108_0000107_4229_5137 | 302 |
| 288 | 3300048911 | Ga0496108_0000132 | Ga0496108_0000132_47451_48413 | 302 |
| 289 | 3300048911 | Ga0496108_0013136 | Ga0496108_0013136_4836_5744 | 302 |
| 290 | 3300048911 | Ga0496108_0239084 | Ga0496108_0239084_75_983 | 302 |
| 291 | 3300048911 | Ga0496108_0400007 | Ga0496108_0400007_12_920 | 302 |
| 292 | 3300048912 | Ga0496109_0000003 | Ga0496109_0000003_140423_141331 | 302 |
| 293 | 3300048912 | Ga0496109_0000007 | Ga0496109_0000007_154285_155247 | 302 |
| 294 | 3300048912 | Ga0496109_0000028 | Ga0496109_0000028_52986_53966 | 302 |
| 295 | 3300048912 | Ga0496109_0000190 | Ga0496109_0000190_56106_57014 | 302 |
| 296 | 3300048912 | Ga0496109_0078248 | Ga0496109_0078248_1237_2145 | 302 |
| 297 | 3300048912 | Ga0496109_0083812 | Ga0496109_0083812_85_993 | 302 |
| 298 | 3300048912 | Ga0496109_0174088 | Ga0496109_0174088_33_941 | 302 |
| 299 | 3300048913 | Ga0496110_0046579 | Ga0496110_0046579_122_1030 | 302 |
| 300 | 3300048915 | Ga0496112_0000003 | Ga0496112_0000003_152567_153475 | 302 |
| 301 | 3300048916 | Ga0496113_0032616 | Ga0496113_0032616_2107_3015 | 302 |
| 302 | 3300048916 | Ga0496113_0043897 | Ga0496113_0043897_1327_2235 | 302 |
| 303 | 3300048917 | Ga0496114_0494325 | Ga0496114_0494325_42_1016 | 302 |
| 304 | 3300048922 | Ga0496119_0023523 | Ga0496119_0023523_1761_2669 | 302 |
| 305 | 3300048924 | Ga0496121_0060850 | Ga0496121_0060850_1802_2710 | 302 |
| 306 | 3300048927 | Ga0496124_0068611 | Ga0496124_0068611_1897_2805 | 302 |
| 307 | 3300049569 | Ga0501032_0000899 | Ga0501032_0000899_2864_3775 | 302 |
| 308 | 3300049570 | Ga0501033_0001140 | Ga0501033_0001140_2873_3784 | 302 |
| 309 | 3300049571 | Ga0501034_0022851 | Ga0501034_0022851_909_1820 | 302 |
| 310 | 3300049572 | Ga0501036_0001260 | Ga0501036_0001260_2876_3787 | 302 |
| 311 | 3300049573 | Ga0501037_0000774 | Ga0501037_0000774_20126_21037 | 302 |
| 312 | 3300049574 | Ga0501038_0001146 | Ga0501038_0001146_20234_21145 | 302 |
| 313 | 3300049576 | Ga0501040_0020292 | Ga0501040_0020292_816_1727 | 302 |
| 314 | 3300049577 | Ga0501041_0177632 | Ga0501041_0177632_138_1046 | 302 |
| 315 | 3300049578 | Ga0501042_0031003 | Ga0501042_0031003_910_1821 | 302 |
| 316 | 3300049579 | Ga0501043_0001082 | Ga0501043_0001082_2862_3773 | 302 |
| 317 | 3300049579 | Ga0501043_0082624 | Ga0501043_0082624_787_1695 | 302 |
| 318 | 3300049580 | Ga0501046_0000447 | Ga0501046_0000447_2860_3771 | 302 |
| 319 | 3300049581 | Ga0501047_0001335 | Ga0501047_0001335_3020_3931 | 302 |
| 320 | 3300049581 | Ga0501047_0074650 | Ga0501047_0074650_1234_2142 | 302 |
| 321 | 3300049582 | Ga0501048_0000734 | Ga0501048_0000734_2846_3757 | 302 |
| 322 | 3300049584 | Ga0501068_0051688 | Ga0501068_0051688_225_1136 | 302 |
| 323 | 3300049585 | Ga0501069_0083173 | Ga0501069_0083173_235_1143 | 302 |
| 324 | 3300049586 | Ga0501070_0001137 | Ga0501070_0001137_2851_3762 | 302 |
| 325 | 3300049586 | Ga0501070_0049980 | Ga0501070_0049980_2310_3218 | 302 |
| 326 | 3300049587 | Ga0501071_0008734 | Ga0501071_0008734_2579_3487 | 302 |
| 327 | 3300049588 | Ga0501072_0012297 | Ga0501072_0012297_5240_6148 | 302 |
| 328 | 3300049588 | Ga0501072_0462330 | Ga0501072_0462330_18_926 | 302 |
| 329 | 3300049589 | Ga0501073_0016359 | Ga0501073_0016359_1664_2575 | 302 |
| 330 | 3300049590 | Ga0501074_0033768 | Ga0501074_0033768_1014_1922 | 302 |
| 331 | 3300049590 | Ga0501074_0120453 | Ga0501074_0120453_844_1752 | 302 |
| 332 | 3300049593 | Ga0501077_0023713 | Ga0501077_0023713_2892_3800 | 302 |
| 333 | 3300049741 | Ga0501079_0037573 | Ga0501079_0037573_554_1462 | 302 |
| 334 | 3300049742 | Ga0501080_0032766 | Ga0501080_0032766_1080_1991 | 302 |
| 335 | 3300049742 | Ga0501080_0165696 | Ga0501080_0165696_869_1777 | 302 |
| 336 | 3300049743 | Ga0501081_0164065 | Ga0501081_0164065_153_1061 | 302 |
| 337 | 3300049743 | Ga0501081_0317629 | Ga0501081_0317629_19_927 | 302 |
| 338 | 3300049744 | Ga0501083_0015145 | Ga0501083_0015145_1618_2526 | 302 |
| 339 | 3300049744 | Ga0501083_0029438 | Ga0501083_0029438_874_1785 | 302 |
| 340 | 3300049822 | Ga0501035_0004594 | Ga0501035_0004594_1974_2885 | 302 |
| 341 | 3300049823 | Ga0501044_0025332 | Ga0501044_0025332_2862_3773 | 302 |
| 342 | 3300049823 | Ga0501044_0085187 | Ga0501044_0085187_689_1597 | 302 |
| 343 | 3300049824 | Ga0501045_0043030 | Ga0501045_0043030_1401_2309 | 302 |
| 344 | 3300050509 | nmdc:mga0qj67_35695_c1 | nmdc:mga0qj67_35695_c1_2564_3475 | 302 |
| 345 | 3300050510 | nmdc:mga06r32_6365_c1 | nmdc:mga06r32_6365_c1_7748_8659 | 302 |
| 346 | 3300050512 | nmdc:mga0n895_26632_c1 | nmdc:mga0n895_26632_c1_1340_2248 | 302 |
| 347 | 3300050514 | nmdc:mga08x19_59015_c1 | nmdc:mga08x19_59015_c1_209_1117 | 302 |
| 348 | 3300050515 | nmdc:mga0a205_11_c1 | nmdc:mga0a205_11_c1_57490_58398 | 302 |
| 349 | 3300050515 | nmdc:mga0a205_437_c2 | nmdc:mga0a205_437_c2_8203_9111 | 302 |
| 350 | 3300050515 | nmdc:mga0a205_88844_c1 | nmdc:mga0a205_88844_c1_2060_2968 | 302 |
| 351 | 3300053078 | Ga0495612_0019716 | Ga0495612_0019716_1412_2320 | 302 |
| 352 | 3300053078 | Ga0495612_0046039 | Ga0495612_0046039_398_1306 | 302 |
| 353 | 3300053078 | Ga0495612_0053953 | Ga0495612_0053953_364_1338 | 302 |
| 354 | 3300053083 | Ga0495655_0035206 | Ga0495655_0035206_318_1226 | 302 |
| 355 | 3300053084 | Ga0495595_0000014 | Ga0495595_0000014_26598_27506 | 302 |
| 356 | 3300053085 | Ga0495619_0000021 | Ga0495619_0000021_101165_102073 | 302 |
| 357 | 3300053085 | Ga0495619_0000147 | Ga0495619_0000147_26598_27506 | 302 |
| 358 | 3300053085 | Ga0495619_0034908 | Ga0495619_0034908_777_1685 | 302 |
| 359 | 3300053123 | Ga0500614_000026 | Ga0500614_000026_32112_33020 | 302 |
| 360 | 3300054114 | Ga0501084_0161958 | Ga0501084_0161958_879_1787 | 302 |
| 361 | 3300060346 | Ga0587111_0006462 | Ga0587111_0006462_310_1218 | 302 |
| 362 | 3300061734 | Ga0530510_0006221 | Ga0530510_0006221_7288_8196 | 302 |
| 363 | 3300061734 | Ga0530510_0021805 | Ga0530510_0021805_1233_2141 | 302 |
| 364 | 3300005544 | Ga0070686_100064111 | Ga0070686_1000641114 | 303 |
| 365 | 3300005985 | Ga0081539_10003705 | Ga0081539_1000370518 | 303 |
| 366 | 3300046476 | Ga0495662_0014754 | Ga0495662_0014754_396_1355 | 303 |
| 367 | 3300048911 | Ga0496108_0082419 | Ga0496108_0082419_1328_2293 | 303 |
| 368 | 3300005937 | Ga0081455_10059037 | Ga0081455_100590375 | 304 |
| 369 | 3300006038 | Ga0075365_10063196 | Ga0075365_100631963 | 304 |
| 370 | 3300006048 | Ga0075363_100071464 | Ga0075363_1000714642 | 304 |
| 371 | 3300006178 | Ga0075367_10041075 | Ga0075367_100410753 | 304 |
| 372 | 3300006846 | Ga0075430_100040535 | Ga0075430_1000405353 | 304 |
| 373 | 3300006847 | Ga0075431_100049054 | Ga0075431_1000490543 | 304 |
| 374 | 3300009093 | Ga0105240_10138101 | Ga0105240_101381013 | 304 |
| 375 | 3300009101 | Ga0105247_10000322 | Ga0105247_1000032237 | 304 |
| 376 | 3300013297 | Ga0157378_10029504 | Ga0157378_100295043 | 304 |
| 377 | 3300025900 | Ga0207710_10000158 | Ga0207710_1000015857 | 304 |
| 378 | 3300025913 | Ga0207695_10080470 | Ga0207695_100804703 | 304 |
| 379 | 3300025928 | Ga0207700_10000025 | Ga0207700_1000002557 | 304 |
| 380 | 3300025932 | Ga0207690_10006437 | Ga0207690_100064375 | 304 |
| 381 | 3300025934 | Ga0207686_10000428 | Ga0207686_100004285 | 304 |
| 382 | 3300025945 | Ga0207679_10162892 | Ga0207679_101628922 | 304 |
| 383 | 3300026088 | Ga0207641_10005415 | Ga0207641_1000541510 | 304 |
| 384 | 3300026095 | Ga0207676_10000016 | Ga0207676_10000016143 | 304 |
| 385 | 3300028800 | Ga0265338_10000486 | Ga0265338_1000048646 | 304 |
| 386 | 3300046459 | Ga0495629_0031189 | Ga0495629_0031189_280_1233 | 304 |
| 387 | 3300046499 | Ga0495594_0000003 | Ga0495594_0000003_52126_53091 | 304 |
| 388 | 3300046516 | Ga0495628_0000924 | Ga0495628_0000924_10174_11139 | 304 |
| 389 | 3300046529 | Ga0495652_0004947 | Ga0495652_0004947_393_1358 | 304 |
| 390 | 3300046536 | Ga0495587_0108909 | Ga0495587_0108909_473_1438 | 304 |
| 391 | 3300046557 | Ga0495622_0000014 | Ga0495622_0000014_14217_15182 | 304 |
| 392 | 3300046615 | Ga0495656_0000617 | Ga0495656_0000617_1454_2410 | 304 |
| 393 | 3300046642 | Ga0495634_0021454 | Ga0495634_0021454_876_1844 | 304 |
| 394 | 3300046689 | Ga0495613_0000073 | Ga0495613_0000073_30524_31501 | 304 |
| 395 | 3300046809 | Ga0495600_0017803 | Ga0495600_0017803_119_1096 | 304 |
| 396 | 3300047317 | Ga0495604_0002440 | Ga0495604_0002440_11295_12272 | 304 |
| 397 | 3300047319 | Ga0495674_0000731 | Ga0495674_0000731_24908_25873 | 304 |
| 398 | 3300047321 | Ga0495676_0008238 | Ga0495676_0008238_250_1206 | 304 |
| 399 | 3300047444 | Ga0495675_0040106 | Ga0495675_0040106_495_1460 | 304 |
| 400 | 3300048088 | Ga0495602_0035128 | Ga0495602_0035128_2432_3397 | 304 |
| 401 | 3300048903 | Ga0496100_0000018 | Ga0496100_0000018_9107_10063 | 304 |
| 402 | 3300048904 | Ga0496101_0000221 | Ga0496101_0000221_18768_19724 | 304 |
| 403 | 3300048907 | Ga0496104_0000004 | Ga0496104_0000004_68997_69959 | 304 |
| 404 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_571872_572834 | 304 |
| 405 | 3300048908 | Ga0496105_0008527 | Ga0496105_0008527_5256_6221 | 304 |
| 406 | 3300048909 | Ga0496106_0000018 | Ga0496106_0000018_151324_152280 | 304 |
| 407 | 3300048910 | Ga0496107_0000006 | Ga0496107_0000006_78030_78986 | 304 |
| 408 | 3300048913 | Ga0496110_0143098 | Ga0496110_0143098_958_1941 | 304 |
| 409 | 3300048913 | Ga0496110_0186286 | Ga0496110_0186286_201_1169 | 304 |
| 410 | 3300048916 | Ga0496113_0063296 | Ga0496113_0063296_547_1515 | 304 |
| 411 | 3300048917 | Ga0496114_0000014 | Ga0496114_0000014_129904_130869 | 304 |
| 412 | 3300048918 | Ga0496115_0000989 | Ga0496115_0000989_16476_17441 | 304 |
| 413 | 3300048922 | Ga0496119_0051528 | Ga0496119_0051528_589_1551 | 304 |
| 414 | 3300048923 | Ga0496120_0015155 | Ga0496120_0015155_638_1600 | 304 |
| 415 | 3300049571 | Ga0501034_0396937 | Ga0501034_0396937_17_976 | 304 |
| 416 | 3300049578 | Ga0501042_0058480 | Ga0501042_0058480_1788_2732 | 304 |
| 417 | 3300049578 | Ga0501042_0145697 | Ga0501042_0145697_213_1190 | 304 |
| 418 | 3300049581 | Ga0501047_0151114 | Ga0501047_0151114_1190_2149 | 304 |
| 419 | 3300049584 | Ga0501068_0075635 | Ga0501068_0075635_200_1174 | 304 |
| 420 | 3300049586 | Ga0501070_0006027 | Ga0501070_0006027_7768_8742 | 304 |
| 421 | 3300049588 | Ga0501072_0064461 | Ga0501072_0064461_961_1935 | 304 |
| 422 | 3300049589 | Ga0501073_0014644 | Ga0501073_0014644_2726_3700 | 304 |
| 423 | 3300049590 | Ga0501074_0046514 | Ga0501074_0046514_1170_2144 | 304 |
| 424 | 3300049592 | Ga0501076_0124186 | Ga0501076_0124186_1054_1977 | 304 |
| 425 | 3300049593 | Ga0501077_0102467 | Ga0501077_0102467_704_1627 | 304 |
| 426 | 3300049742 | Ga0501080_0034163 | Ga0501080_0034163_1212_2186 | 304 |
| 427 | 3300049822 | Ga0501035_0083570 | Ga0501035_0083570_1684_2643 | 304 |
| 428 | 3300049823 | Ga0501044_0156510 | Ga0501044_0156510_1223_2182 | 304 |
| 429 | 3300050490 | nmdc:mga03n38_85223_c1 | nmdc:mga03n38_85223_c1_510_1475 | 304 |
| 430 | 3300050509 | nmdc:mga0qj67_63189_c1 | nmdc:mga0qj67_63189_c1_1732_2697 | 304 |
| 431 | 3300053077 | Ga0495601_0000039 | Ga0495601_0000039_19688_20665 | 304 |
| 432 | 3300053077 | Ga0495601_0003264 | Ga0495601_0003264_5160_6125 | 304 |
| 433 | 3300053077 | Ga0495601_0132891 | Ga0495601_0132891_452_1417 | 304 |
| 434 | 3300001977 | JGI24746J21847_1000315 | JGI24746J21847_10003156 | 305 |
| 435 | 3300005367 | Ga0070667_100025502 | Ga0070667_1000255022 | 305 |
| 436 | 3300005843 | Ga0068860_100046586 | Ga0068860_1000465865 | 305 |
| 437 | 3300005844 | Ga0068862_100008805 | Ga0068862_1000088054 | 305 |
| 438 | 3300005937 | Ga0081455_10024588 | Ga0081455_100245884 | 305 |
| 439 | 3300005983 | Ga0081540_1027734 | Ga0081540_10277343 | 305 |
| 440 | 3300006038 | Ga0075365_10040866 | Ga0075365_100408662 | 305 |
| 441 | 3300006048 | Ga0075363_100070428 | Ga0075363_1000704283 | 305 |
| 442 | 3300006186 | Ga0075369_10015275 | Ga0075369_100152753 | 305 |
| 443 | 3300009553 | Ga0105249_10051368 | Ga0105249_100513685 | 305 |
| 444 | 3300009553 | Ga0105249_10318012 | Ga0105249_103180122 | 305 |
| 445 | 3300025961 | Ga0207712_10004400 | Ga0207712_100044004 | 305 |
| 446 | 3300025986 | Ga0207658_10073793 | Ga0207658_100737933 | 305 |
| 447 | 3300028380 | Ga0268265_10009333 | Ga0268265_100093334 | 305 |
| 448 | 3300035398 | Ga0316574_0007213 | Ga0316574_0007213_2465_3421 | 305 |
| 449 | 3300037418 | Ga0395900_0372104 | Ga0395900_0372104_349_1290 | 305 |
| 450 | 3300037466 | Ga0395898_0145672 | Ga0395898_0145672_1039_1968 | 305 |
| 451 | 3300038443 | Ga0395901_0276627 | Ga0395901_0276627_707_1636 | 305 |
| 452 | 3300046491 | Ga0495584_0116184 | Ga0495584_0116184_118_1044 | 305 |
| 453 | 3300046660 | Ga0495625_0101241 | Ga0495625_0101241_345_1316 | 305 |
| 454 | 3300050491 | nmdc:mga00v17_105302_c1 | nmdc:mga00v17_105302_c1_628_1554 | 305 |
| 455 | 3300050491 | nmdc:mga00v17_45209_c1 | nmdc:mga00v17_45209_c1_1458_2375 | 305 |
| 456 | 3300050492 | nmdc:mga0yw44_143773_c1 | nmdc:mga0yw44_143773_c1_613_1539 | 305 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6n2d-assembly1.cif.gz_a | bacillus ps3 atp synthase membrane region | 0.6709 | 51 | 299 |
| 6n2d-assembly1.cif.gz_a | bacillus ps3 atp synthase membrane region | 0.6597 | 51 | 299 |
| 7jg5-assembly1.cif.gz_a | cryo-em structure of bedaquiline-free mycobacterium smegmatis atp synthase rotational state 1 | 0.6408 | 68 | 302 |
| 7njp-assembly1.cif.gz_a | mycobacterium smegmatis atp synthase state 2 | 0.6371 | 46 | 302 |
| 7jg5-assembly1.cif.gz_a | cryo-em structure of bedaquiline-free mycobacterium smegmatis atp synthase rotational state 1 | 0.6364 | 68 | 302 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q27559_82_244_1.20.120.220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A | 0.587 | 119 | 300 | 1.20.120.220 |
| af_M1FN39_66_236_1.20.120.220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A | 0.5813 | 113 | 302 | 1.20.120.220 |
| af_M1FN39_66_236_1.20.120.220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A | 0.5737 | 113 | 302 | 1.20.120.220 |
| af_Q27559_82_244_1.20.120.220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A | 0.5709 | 119 | 300 | 1.20.120.220 |
| af_P00854_92_259_1.20.120.220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A | 0.568 | 118 | 303 | 1.20.120.220 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382V4S5-F1-model_v4 | F0F1 ATP synthase subunit A | 0.7054 | 41 | 140 |
GO:0045263
GO:0046933 |
| AF-A0A2H6K2G6-F1-model_v4 | ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6) | 0.7042 | 37 | 305 |
GO:0005886
GO:0045263 GO:0046933 |
| AF-A0A382M5F1-F1-model_v4 | ATP synthase subunit a | 0.7029 | 38 | 141 |
GO:0045263
GO:0046933 |
| AF-A0A7V9MGF7-F1-model_v4 | ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6) | 0.7022 | 38 | 305 |
GO:0005886
GO:0045263 GO:0046933 |
| AF-A0A7V9MGF7-F1-model_v4 | ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6) | 0.7008 | 38 | 305 |
GO:0005886
GO:0045263 GO:0046933 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar