F447737

General Info

Members Datasets Scaffolds Average Seq Length
456 270 456 308

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10030623|Ga0081538_100306231
Length 315
Sequence MTTAQASEQPPAKEGGLSTRAKVLIALGIYLGVAVLLYAIFGDDGRNEEFQPQDEFKLDPWIEIKIGGIDLSFNKAVLYLLIGCALTVGTMLLIARRMQQRPNRTQTIMEGAYDLTYTNIAKGNMDEAAAARWFPFVATLFFFIWFSNMIGYIPLPVNDHEKVDIAGIEFPSFALYAATANLSIPLVLTLTVFVLYQAYGIRRHGFVKYLKGWLPAGVSGGAAVPIFIIEVISQFVRIISLSVRLFANILAGHLLILFMGGGLAVLLGITALGWITLPIAVAFFIFEVGLIATLQAFIFATLTSIYFGEASAGGH

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
140 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
163 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
164 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
190 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
191 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
196 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
197 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
198 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
199 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
200 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
221 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
238 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
254 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
255 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
263 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
264 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
267 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.29
Nodule 0
Rhizoplane 10.31
Rhizosphere 85.09
Stem 0
Stem Tuber 0
Unclassified 1.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000315 3300001977 Bacteria 6963
2 JGI24737J22298_10041849 3300001990 Bacteria 1405
3 JGI24735J21928_10022663 3300002067 Bacteria 1909
4 JGI24748J21848_1000586 3300002074 Bacteria 3913
5 JGI24034J26672_10017446 3300002239 Unclassified 1111
6 JGI24742J22300_10001127 3300002244 Bacteria 4144
7 JGI24742J22300_10014452 3300002244 Bacteria 1326
8 JGI25407J50210_10012036 3300003373 Bacteria 2216
9 Ga0070658_10171056 3300005327 Bacteria 1825
10 Ga0070683_100007965 3300005329 Bacteria 8989
11 Ga0070677_10000057 3300005333 Bacteria 34822
12 Ga0070666_10019445 3300005335 Bacteria 4384
13 Ga0070682_100001629 3300005337 Bacteria 12482
14 Ga0068868_100000151 3300005338 Bacteria 44963
15 Ga0068868_100028702 3300005338 Bacteria 4257
16 Ga0070660_100001214 3300005339 Bacteria 17496
17 Ga0070689_100035143 3300005340 Bacteria 3828
18 Ga0070691_10000133 3300005341 Bacteria 23011
19 Ga0070691_10012036 3300005341 Bacteria 3962
20 Ga0070687_100053723 3300005343 Bacteria 2096
21 Ga0070661_100000742 3300005344 Bacteria 23671
22 Ga0070692_10058144 3300005345 Bacteria 2030
23 Ga0070668_100036849 3300005347 Bacteria 3733
24 Ga0070675_100000053 3300005354 Bacteria 70601
25 Ga0070675_100052994 3300005354 Bacteria 3336
26 Ga0070674_100000008 3300005356 Bacteria 143844
27 Ga0070674_100000082 3300005356 Bacteria 44418
28 Ga0070673_100009564 3300005364 Bacteria 6513
29 Ga0070673_100182619 3300005364 Bacteria 1796
30 Ga0070688_100000012 3300005365 Bacteria 79406
31 Ga0070688_100000492 3300005365 Bacteria 20007
32 Ga0070688_100042986 3300005365 Bacteria 2782
33 Ga0070659_100002102 3300005366 Bacteria 14198
34 Ga0070667_100025502 3300005367 Bacteria 4915
35 Ga0070667_100120149 3300005367 Bacteria 2285
36 Ga0070667_100134235 3300005367 Bacteria 2163
37 Ga0070714_100468067 3300005435 Bacteria 1199
38 Ga0070701_10010964 3300005438 Bacteria 4030
39 Ga0070711_100009855 3300005439 Bacteria 5892
40 Ga0070711_100080257 3300005439 Bacteria 2322
41 Ga0070705_100262334 3300005440 Bacteria 1219
42 Ga0070694_100053345 3300005444 Bacteria 2736
43 Ga0070678_100005092 3300005456 Bacteria 7542
44 Ga0070662_100000016 3300005457 Bacteria 105820
45 Ga0070662_100021714 3300005457 Bacteria 4387
46 Ga0070681_10016762 3300005458 Bacteria 7315
47 Ga0070681_10353789 3300005458 Unclassified 1379
48 Ga0070685_10000018 3300005466 Bacteria 110132
49 Ga0070685_10000460 3300005466 Bacteria 23676
50 Ga0070685_10019608 3300005466 Bacteria 3652
51 Ga0070685_10048203 3300005466 Bacteria 2453
52 Ga0070679_100001299 3300005530 Bacteria 22062
53 Ga0070679_100067083 3300005530 Bacteria 3578
54 Ga0070684_100068082 3300005535 Bacteria 3129
55 Ga0068853_100019642 3300005539 Bacteria 5608
56 Ga0068853_100242391 3300005539 Bacteria 1653
57 Ga0070672_100000091 3300005543 Bacteria 44187
58 Ga0070686_100064111 3300005544 Bacteria 2383
59 Ga0070693_100003254 3300005547 Bacteria 7539
60 Ga0070665_100000244 3300005548 Bacteria 90284
61 Ga0070665_100706326 3300005548 Bacteria 1021
62 Ga0068855_100413806 3300005563 Bacteria 1476
63 Ga0070664_100016760 3300005564 Bacteria 6012
64 Ga0068854_100000031 3300005578 Bacteria 107298
65 Ga0068854_100009544 3300005578 Bacteria 6262
66 Ga0068856_100024596 3300005614 Bacteria 5862
67 Ga0068856_100241439 3300005614 Bacteria 1822
68 Ga0068856_100246618 3300005614 Bacteria 1801
69 Ga0070702_100076656 3300005615 Bacteria 1990
70 Ga0068852_100012745 3300005616 Bacteria 6401
71 Ga0068852_100075715 3300005616 Bacteria 2969
72 Ga0068866_10000001 3300005718 Bacteria 519680
73 Ga0068866_10000170 3300005718 Bacteria 30223
74 Ga0068851_10000333 3300005834 Bacteria 21364
75 Ga0068858_100000109 3300005842 Bacteria 86772
76 Ga0068858_100000450 3300005842 Bacteria 43091
77 Ga0068860_100003359 3300005843 Bacteria 16475
78 Ga0068860_100046586 3300005843 Bacteria 4134
79 Ga0068862_100008805 3300005844 Bacteria 8357
80 Ga0068862_100455316 3300005844 Bacteria 1207
81 Ga0081455_10015359 3300005937 Bacteria 7444
82 Ga0081455_10024588 3300005937 Bacteria 5575
83 Ga0081455_10048254 3300005937 Bacteria 3681
84 Ga0081455_10059037 3300005937 Bacteria 3241
85 Ga0081455_10089283 3300005937 Bacteria 2501
86 Ga0081455_10282767 3300005937 Bacteria 1198
87 Ga0081538_10000030 3300005981 Bacteria 124321
88 Ga0081538_10000426 3300005981 Bacteria 47299
89 Ga0081538_10017283 3300005981 Bacteria 5482
90 Ga0081538_10030623 3300005981 Bacteria 3648
91 Ga0081538_10062841 3300005981 Bacteria 2114
92 Ga0081540_1027734 3300005983 Bacteria 3200
93 Ga0081539_10003705 3300005985 Bacteria 18213
94 Ga0075365_10013530 3300006038 Bacteria 4885
95 Ga0075365_10040866 3300006038 Bacteria 3026
96 Ga0075365_10063196 3300006038 Unclassified 2478
97 Ga0075363_100070428 3300006048 Bacteria 1899
98 Ga0075363_100071464 3300006048 Bacteria 1886
99 Ga0075364_10056377 3300006051 Bacteria 2573
100 Ga0075364_10129084 3300006051 Unclassified 1696
101 Ga0070715_10000001 3300006163 Bacteria 693690
102 Ga0070712_100004464 3300006175 Bacteria 8638
103 Ga0075367_10041075 3300006178 Bacteria 2703
104 Ga0075369_10015275 3300006186 Bacteria 3080
105 Ga0075430_100040535 3300006846 Bacteria 3942
106 Ga0075431_100008782 3300006847 Bacteria 10125
107 Ga0075431_100049054 3300006847 Bacteria 4355
108 Ga0075433_10000478 3300006852 Bacteria 26067
109 Ga0075433_10027471 3300006852 Bacteria 4827
110 Ga0068865_100000402 3300006881 Bacteria 24075
111 Ga0068865_100009454 3300006881 Bacteria 6047
112 Ga0075436_100060401 3300006914 Bacteria 2618
113 Ga0105240_10138101 3300009093 Bacteria 2917
114 Ga0105240_10154974 3300009093 Bacteria 2726
115 Ga0111539_10624819 3300009094 Bacteria 1254
116 Ga0111539_10748723 3300009094 Bacteria 1137
117 Ga0105245_10000180 3300009098 Bacteria 59695
118 Ga0105245_10000619 3300009098 Bacteria 32213
119 Ga0105247_10000322 3300009101 Bacteria 42918
120 Ga0114129_10092683 3300009147 Bacteria 4185
121 Ga0105242_10000132 3300009176 Bacteria 54347
122 Ga0105242_10063020 3300009176 Bacteria 3053
123 Ga0105242_10154271 3300009176 Bacteria 2005
124 Ga0105242_10370040 3300009176 Bacteria 1329
125 Ga0105248_10000118 3300009177 Bacteria 90018
126 Ga0105238_10061765 3300009551 Bacteria 3749
127 Ga0105249_10000068 3300009553 Bacteria 148594
128 Ga0105249_10029618 3300009553 Bacteria 4945
129 Ga0105249_10051368 3300009553 Bacteria 3761
130 Ga0105249_10318012 3300009553 Bacteria 1567
131 Ga0105249_10453424 3300009553 Bacteria 1321
132 Ga0105246_10207740 3300011119 Bacteria 1526
133 Ga0157371_10086413 3300013102 Bacteria 2221
134 Ga0157370_10007239 3300013104 Bacteria 12106
135 Ga0157369_10000142 3300013105 Bacteria 101760
136 Ga0157378_10018651 3300013297 Bacteria 6100
137 Ga0157378_10029504 3300013297 Bacteria 4843
138 Ga0163162_10583033 3300013306 Bacteria 1245
139 Ga0157372_10003159 3300013307 Bacteria 17764
140 Ga0157372_10081714 3300013307 Bacteria 3658
141 Ga0157375_10000367 3300013308 Bacteria 41173
142 Ga0157380_10000059 3300014326 Bacteria 62280
143 Ga0157380_10002780 3300014326 Bacteria 11890
144 Ga0157380_10145284 3300014326 Bacteria 2043
145 Ga0157377_10021783 3300014745 Bacteria 3376
146 Ga0157379_10011621 3300014968 Bacteria 7688
147 Ga0157379_10023859 3300014968 Bacteria 5429
148 Ga0207656_10000696 3300025321 Bacteria 10993
149 Ga0207656_10021606 3300025321 Bacteria 2573
150 Ga0207682_10000129 3300025893 Bacteria 33994
151 Ga0207642_10000006 3300025899 Bacteria 230268
152 Ga0207642_10000007 3300025899 Bacteria 226017
153 Ga0207642_10000222 3300025899 Bacteria 16787
154 Ga0207642_10087345 3300025899 Bacteria 1531
155 Ga0207710_10000158 3300025900 Bacteria 72527
156 Ga0207688_10004232 3300025901 Bacteria 7822
157 Ga0207680_10089821 3300025903 Bacteria 1951
158 Ga0207685_10000011 3300025905 Bacteria 213430
159 Ga0207705_10084687 3300025909 Bacteria 2315
160 Ga0207707_10033967 3300025912 Bacteria 4464
161 Ga0207695_10080470 3300025913 Bacteria 3299
162 Ga0207693_10054160 3300025915 Bacteria 3147
163 Ga0207663_10006691 3300025916 Bacteria 5926
164 Ga0207662_10043224 3300025918 Bacteria 2657
165 Ga0207657_10032142 3300025919 Bacteria 4745
166 Ga0207649_10000076 3300025920 Bacteria 83824
167 Ga0207652_10002610 3300025921 Bacteria 15138
168 Ga0207652_10004210 3300025921 Bacteria 11747
169 Ga0207694_10389477 3300025924 Bacteria 1158
170 Ga0207659_10000010 3300025926 Bacteria 286639
171 Ga0207659_10012687 3300025926 Bacteria 5375
172 Ga0207687_10000007 3300025927 Bacteria 604185
173 Ga0207687_10000018 3300025927 Bacteria 236159
174 Ga0207687_10000269 3300025927 Bacteria 35470
175 Ga0207687_10098663 3300025927 Bacteria 2145
176 Ga0207700_10000025 3300025928 Bacteria 147429
177 Ga0207664_10414929 3300025929 Bacteria 1199
178 Ga0207690_10006437 3300025932 Bacteria 6960
179 Ga0207690_10024040 3300025932 Bacteria 3811
180 Ga0207706_10000068 3300025933 Bacteria 105795
181 Ga0207706_10001582 3300025933 Bacteria 22593
182 Ga0207686_10000033 3300025934 Bacteria 143602
183 Ga0207686_10000428 3300025934 Bacteria 28669
184 Ga0207686_10139076 3300025934 Bacteria 1676
185 Ga0207669_10000004 3300025937 Bacteria 196828
186 Ga0207669_10000012 3300025937 Bacteria 138242
187 Ga0207704_10000190 3300025938 Bacteria 32246
188 Ga0207704_10004819 3300025938 Bacteria 6191
189 Ga0207691_10000190 3300025940 Bacteria 58438
190 Ga0207691_10425256 3300025940 Bacteria 1132
191 Ga0207711_10000020 3300025941 Bacteria 363325
192 Ga0207661_10002022 3300025944 Bacteria 13980
193 Ga0207661_10002688 3300025944 Bacteria 12229
194 Ga0207661_10003810 3300025944 Bacteria 10514
195 Ga0207661_10087203 3300025944 Bacteria 2591
196 Ga0207679_10162892 3300025945 Bacteria 1828
197 Ga0207651_10001019 3300025960 Bacteria 12393
198 Ga0207712_10000007 3300025961 Bacteria 539589
199 Ga0207712_10004400 3300025961 Bacteria 8905
200 Ga0207712_10020131 3300025961 Bacteria 4367
201 Ga0207668_10017860 3300025972 Bacteria 4453
202 Ga0207640_10000015 3300025981 Bacteria 215411
203 Ga0207640_10014004 3300025981 Bacteria 4607
204 Ga0207658_10055167 3300025986 Bacteria 2943
205 Ga0207658_10073793 3300025986 Bacteria 2590
206 Ga0207677_10000421 3300026023 Bacteria 28837
207 Ga0207677_10000919 3300026023 Bacteria 16454
208 Ga0207703_10000040 3300026035 Bacteria 168191
209 Ga0207703_10000322 3300026035 Bacteria 52048
210 Ga0207703_10122263 3300026035 Bacteria 2236
211 Ga0207639_10018955 3300026041 Bacteria 4898
212 Ga0207678_10000834 3300026067 Bacteria 28248
213 Ga0207678_10001751 3300026067 Bacteria 19873
214 Ga0207702_10000016 3300026078 Bacteria 226633
215 Ga0207702_10234047 3300026078 Bacteria 1718
216 Ga0207641_10005415 3300026088 Bacteria 10899
217 Ga0207648_10101570 3300026089 Bacteria 2520
218 Ga0207676_10000016 3300026095 Bacteria 311561
219 Ga0207683_10011233 3300026121 Bacteria 7633
220 Ga0207683_10127807 3300026121 Bacteria 2285
221 Ga0207698_10000012 3300026142 Bacteria 260061
222 Ga0268266_10000020 3300028379 Bacteria 527065
223 Ga0268266_10000085 3300028379 Bacteria 201288
224 Ga0268266_10044964 3300028379 Bacteria 3775
225 Ga0268265_10009333 3300028380 Bacteria 6630
226 Ga0268265_10227130 3300028380 Bacteria 1638
227 Ga0268264_10006922 3300028381 Bacteria 9516
228 Ga0265338_10000486 3300028800 Bacteria 70900
229 Ga0265331_10049004 3300031250 Bacteria 2030
230 Ga0316578_10134705 3300031728 Bacteria 1487
231 Ga0307416_100384511 3300032002 Bacteria 1435
232 Ga0307415_100010918 3300032126 Bacteria 5168
233 Ga0316574_0007213 3300035398 Bacteria 6077
234 Ga0316574_0112067 3300035398 Bacteria 1749
235 Ga0373937_0145908 3300036401 Bacteria 2215
236 Ga0316584_0050287 3300036712 Bacteria 3116
237 Ga0395899_0253765 3300037312 Bacteria 1206
238 Ga0395900_0372104 3300037418 Unclassified 1398
239 Ga0395898_0145672 3300037466 Bacteria 2267
240 Ga0395901_0276627 3300038443 Unclassified 1745
241 Ga0395901_0320159 3300038443 Bacteria 1605
242 Ga0451853_1421606 3300041512 Bacteria 3730
243 Ga0466963_0000023 3300044694 Bacteria 52546
244 Ga0466963_0012059 3300044694 Bacteria 5281
245 Ga0466963_0026375 3300044694 Bacteria 3716
246 Ga0466957_0029211 3300044842 Bacteria 3286
247 Ga0466958_0025323 3300045836 Bacteria 3498
248 Ga0466967_0000027 3300045976 Bacteria 64265
249 Ga0466967_0010631 3300045976 Bacteria 6916
250 Ga0495592_0000036 3300046454 Bacteria 125461
251 Ga0495603_0000097 3300046455 Bacteria 40321
252 Ga0495629_0000189 3300046459 Bacteria 55743
253 Ga0495629_0031189 3300046459 Bacteria 3775
254 Ga0495641_0000003 3300046461 Bacteria 242879
255 Ga0495641_0014845 3300046461 Bacteria 4196
256 Ga0495651_0068491 3300046462 Bacteria 2705
257 Ga0495653_0013986 3300046463 Bacteria 6544
258 Ga0495653_0029748 3300046463 Bacteria 4356
259 Ga0495582_0000029 3300046473 Bacteria 77919
260 Ga0495639_0074963 3300046475 Bacteria 1568
261 Ga0495662_0000030 3300046476 Bacteria 48917
262 Ga0495662_0014754 3300046476 Bacteria 3799
263 Ga0495584_0116184 3300046491 Bacteria 1355
264 Ga0495594_0000003 3300046499 Bacteria 199267
265 Ga0495606_0000221 3300046507 Bacteria 101157
266 Ga0495608_0000031 3300046511 Bacteria 145255
267 Ga0495608_0000204 3300046511 Bacteria 42513
268 Ga0495608_0004209 3300046511 Bacteria 10311
269 Ga0495620_0001199 3300046515 Bacteria 15860
270 Ga0495628_0000924 3300046516 Bacteria 26910
271 Ga0495628_0055723 3300046516 Bacteria 3113
272 Ga0495630_0000018 3300046517 Bacteria 186064
273 Ga0495630_0003066 3300046517 Bacteria 11586
274 Ga0495630_0003393 3300046517 Bacteria 11094
275 Ga0495630_0034263 3300046517 Bacteria 3791
276 Ga0495630_0086016 3300046517 Bacteria 2374
277 Ga0495644_0000535 3300046523 Bacteria 16123
278 Ga0495652_0004947 3300046529 Bacteria 12631
279 Ga0495586_0017818 3300046535 Bacteria 3779
280 Ga0495587_0006846 3300046536 Bacteria 7420
281 Ga0495587_0108909 3300046536 Bacteria 1592
282 Ga0495621_0011941 3300046539 Bacteria 2700
283 Ga0495622_0000014 3300046557 Bacteria 182142
284 Ga0495667_0000032 3300046559 Bacteria 143493
285 Ga0495656_0000617 3300046615 Bacteria 11371
286 Ga0495634_0000401 3300046642 Bacteria 42619
287 Ga0495634_0021454 3300046642 Bacteria 4565
288 Ga0495625_0101241 3300046660 Bacteria 1979
289 Ga0495635_0000016 3300046663 Bacteria 214088
290 Ga0495588_0000663 3300046674 Bacteria 15934
291 Ga0495657_0000024 3300046675 Bacteria 145255
292 Ga0495657_0016686 3300046675 Bacteria 5344
293 Ga0495657_0018124 3300046675 Bacteria 5101
294 Ga0495623_0071163 3300046679 Bacteria 2165
295 Ga0495647_0000025 3300046681 Bacteria 65184
296 Ga0495647_0000576 3300046681 Bacteria 10839
297 Ga0495658_0000026 3300046683 Bacteria 77681
298 Ga0495669_0000260 3300046684 Bacteria 30549
299 Ga0495613_0000073 3300046689 Bacteria 98688
300 Ga0495613_0000152 3300046689 Bacteria 68384
301 Ga0495613_0049733 3300046689 Bacteria 3093
302 Ga0495624_0000009 3300046690 Bacteria 145026
303 Ga0495624_0000661 3300046690 Bacteria 26956
304 Ga0495671_0122790 3300046692 Bacteria 1267
305 Ga0495649_0003829 3300046694 Bacteria 9961
306 Ga0495600_0017803 3300046809 Bacteria 4522
307 Ga0495604_0000019 3300047317 Bacteria 175064
308 Ga0495604_0002440 3300047317 Bacteria 14879
309 Ga0495674_0000731 3300047319 Bacteria 31001
310 Ga0495672_0050579 3300047320 Bacteria 2452
311 Ga0495676_0000676 3300047321 Bacteria 28342
312 Ga0495676_0008238 3300047321 Bacteria 9561
313 Ga0495680_0000061 3300047322 Bacteria 90676
314 Ga0495680_0001562 3300047322 Bacteria 24515
315 Ga0495680_0004057 3300047322 Bacteria 14116
316 Ga0495675_0000428 3300047444 Bacteria 28143
317 Ga0495675_0040106 3300047444 Bacteria 2983
318 Ga0495679_011449 3300047446 Bacteria 3423
319 Ga0495685_010313 3300047447 Bacteria 3131
320 Ga0495684_0203687 3300047471 Bacteria 1458
321 Ga0495593_0059796 3300047673 Bacteria 1996
322 Ga0495602_0000021 3300048088 Bacteria 168585
323 Ga0495602_0035128 3300048088 Bacteria 4678
324 Ga0496100_0000002 3300048903 Bacteria 489057
325 Ga0496100_0000018 3300048903 Bacteria 162451
326 Ga0496101_0000001 3300048904 Bacteria 489057
327 Ga0496101_0000221 3300048904 Bacteria 42499
328 Ga0496102_0000146 3300048905 Bacteria 96361
329 Ga0496102_0050254 3300048905 Bacteria 3796
330 Ga0496102_0152078 3300048905 Bacteria 2175
331 Ga0496103_0000043 3300048906 Bacteria 167983
332 Ga0496104_0000004 3300048907 Bacteria 641830
333 Ga0496104_0000009 3300048907 Bacteria 488055
334 Ga0496104_0220363 3300048907 Bacteria 1809
335 Ga0496105_0000001 3300048908 Bacteria 1328178
336 Ga0496105_0000027 3300048908 Bacteria 148197
337 Ga0496105_0008527 3300048908 Bacteria 7963
338 Ga0496106_0000018 3300048909 Bacteria 175028
339 Ga0496106_0000149 3300048909 Bacteria 51656
340 Ga0496106_0000955 3300048909 Bacteria 21074
341 Ga0496106_0008559 3300048909 Bacteria 7570
342 Ga0496107_0000006 3300048910 Bacteria 258746
343 Ga0496107_0000013 3300048910 Bacteria 178284
344 Ga0496107_0241268 3300048910 Bacteria 1345
345 Ga0496107_0384814 3300048910 Unclassified 1043
346 Ga0496108_0000001 3300048911 Bacteria 919044
347 Ga0496108_0000107 3300048911 Bacteria 86395
348 Ga0496108_0000132 3300048911 Bacteria 73888
349 Ga0496108_0013136 3300048911 Bacteria 6750
350 Ga0496108_0082419 3300048911 Bacteria 2728
351 Ga0496108_0239084 3300048911 Bacteria 1580
352 Ga0496108_0400007 3300048911 Bacteria 1199
353 Ga0496109_0000003 3300048912 Bacteria 420862
354 Ga0496109_0000007 3300048912 Bacteria 247554
355 Ga0496109_0000028 3300048912 Bacteria 168138
356 Ga0496109_0000190 3300048912 Bacteria 61169
357 Ga0496109_0078248 3300048912 Bacteria 3044
358 Ga0496109_0083812 3300048912 Bacteria 2940
359 Ga0496109_0174088 3300048912 Bacteria 2020
360 Ga0496110_0046579 3300048913 Bacteria 3794
361 Ga0496110_0143098 3300048913 Bacteria 2162
362 Ga0496110_0186286 3300048913 Bacteria 1885
363 Ga0496111_0042554 3300048914 Bacteria 3262
364 Ga0496112_0000003 3300048915 Bacteria 660147
365 Ga0496113_0032616 3300048916 Bacteria 3786
366 Ga0496113_0043897 3300048916 Bacteria 3310
367 Ga0496113_0063296 3300048916 Bacteria 2795
368 Ga0496114_0000014 3300048917 Bacteria 297902
369 Ga0496114_0494325 3300048917 Bacteria 1082
370 Ga0496115_0000989 3300048918 Bacteria 20585
371 Ga0496119_0023523 3300048922 Bacteria 4364
372 Ga0496119_0051528 3300048922 Bacteria 2529
373 Ga0496120_0015155 3300048923 Bacteria 5099
374 Ga0496121_0060850 3300048924 Bacteria 3103
375 Ga0496124_0068611 3300048927 Bacteria 2946
376 Ga0501032_0000899 3300049569 Bacteria 24104
377 Ga0501033_0001140 3300049570 Bacteria 24003
378 Ga0501034_0022851 3300049571 Bacteria 6371
379 Ga0501034_0396937 3300049571 Bacteria 1302
380 Ga0501036_0001260 3300049572 Bacteria 19408
381 Ga0501037_0000774 3300049573 Bacteria 24049
382 Ga0501038_0001146 3300049574 Bacteria 24003
383 Ga0501040_0020292 3300049576 Bacteria 4428
384 Ga0501041_0177632 3300049577 Unclassified 1333
385 Ga0501042_0031003 3300049578 Bacteria 3782
386 Ga0501042_0058480 3300049578 Bacteria 2752
387 Ga0501042_0145697 3300049578 Bacteria 1707
388 Ga0501043_0001082 3300049579 Bacteria 23968
389 Ga0501043_0082624 3300049579 Bacteria 2525
390 Ga0501046_0000447 3300049580 Bacteria 41432
391 Ga0501047_0001335 3300049581 Bacteria 24206
392 Ga0501047_0074650 3300049581 Bacteria 3264
393 Ga0501047_0151114 3300049581 Unclassified 2198
394 Ga0501048_0000734 3300049582 Bacteria 24021
395 Ga0501068_0051688 3300049584 Bacteria 2486
396 Ga0501068_0075635 3300049584 Bacteria 2060
397 Ga0501069_0083173 3300049585 Bacteria 1804
398 Ga0501070_0001137 3300049586 Bacteria 23887
399 Ga0501070_0006027 3300049586 Bacteria 10324
400 Ga0501070_0049980 3300049586 Bacteria 3471
401 Ga0501071_0008734 3300049587 Bacteria 6706
402 Ga0501072_0012297 3300049588 Bacteria 6541
403 Ga0501072_0064461 3300049588 Bacteria 2889
404 Ga0501072_0462330 3300049588 Bacteria 1005
405 Ga0501073_0014644 3300049589 Bacteria 5698
406 Ga0501073_0016359 3300049589 Bacteria 5376
407 Ga0501074_0033768 3300049590 Bacteria 3708
408 Ga0501074_0046514 3300049590 Bacteria 3137
409 Ga0501074_0120453 3300049590 Bacteria 1877
410 Ga0501076_0124186 3300049592 Bacteria 2091
411 Ga0501077_0023713 3300049593 Bacteria 3890
412 Ga0501077_0102467 3300049593 Bacteria 1814
413 Ga0501079_0037573 3300049741 Bacteria 3732
414 Ga0501080_0032766 3300049742 Bacteria 4847
415 Ga0501080_0034163 3300049742 Bacteria 4746
416 Ga0501080_0165696 3300049742 Bacteria 2039
417 Ga0501081_0164065 3300049743 Bacteria 1602
418 Ga0501081_0317629 3300049743 Bacteria 1144
419 Ga0501083_0015145 3300049744 Bacteria 5399
420 Ga0501083_0029438 3300049744 Bacteria 3776
421 Ga0501035_0004594 3300049822 Bacteria 13088
422 Ga0501035_0083570 3300049822 Bacteria 2817
423 Ga0501044_0025332 3300049823 Bacteria 6286
424 Ga0501044_0085187 3300049823 Bacteria 3193
425 Ga0501044_0156510 3300049823 Unclassified 2258
426 Ga0501045_0043030 3300049824 Bacteria 3288
427 nmdc:mga03n38_85223_c1 3300050490 Bacteria 1493
428 nmdc:mga00v17_105302_c1 3300050491 Bacteria 1785
429 nmdc:mga00v17_45209_c1 3300050491 Bacteria 2659
430 nmdc:mga0yw44_143773_c1 3300050492 Bacteria 1551
431 nmdc:mga0qj67_35695_c1 3300050509 Bacteria 3888
432 nmdc:mga0qj67_63189_c1 3300050509 Unclassified 2944
433 nmdc:mga06r32_6365_c1 3300050510 Bacteria 10611
434 nmdc:mga0n895_26632_c1 3300050512 Bacteria 5480
435 nmdc:mga08x19_59015_c1 3300050514 Bacteria 2483
436 nmdc:mga0a205_11_c1 3300050515 Bacteria 121735
437 nmdc:mga0a205_437_c2 3300050515 Bacteria 25944
438 nmdc:mga0a205_88844_c1 3300050515 Bacteria 2987
439 Ga0495601_0000039 3300053077 Bacteria 79594
440 Ga0495601_0003264 3300053077 Bacteria 9268
441 Ga0495601_0132891 3300053077 Bacteria 1621
442 Ga0495612_0019716 3300053078 Bacteria 2701
443 Ga0495612_0046039 3300053078 Bacteria 1786
444 Ga0495612_0053953 3300053078 Bacteria 1655
445 Ga0495655_0000001 3300053083 Bacteria 419518
446 Ga0495655_0035206 3300053083 Bacteria 1244
447 Ga0495595_0000014 3300053084 Bacteria 145255
448 Ga0495619_0000021 3300053085 Bacteria 187095
449 Ga0495619_0000147 3300053085 Bacteria 51947
450 Ga0495619_0034908 3300053085 Bacteria 3269
451 Ga0500614_000026 3300053123 Bacteria 35584
452 Ga0500628_000017 3300053129 Bacteria 90481
453 Ga0501084_0161958 3300054114 Bacteria 1887
454 Ga0587111_0006462 3300060346 Bacteria 1860
455 Ga0530510_0006221 3300061734 Bacteria 8301
456 Ga0530510_0021805 3300061734 Bacteria 4559

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048088 Ga0495602_0000021 Ga0495602_0000021_95464_96444 283
2 3300005466 Ga0070685_10048203 Ga0070685_100482032 285
3 3300005543 Ga0070672_100000091 Ga0070672_1000000912 285
4 3300046459 Ga0495629_0000189 Ga0495629_0000189_10144_11118 285
5 3300005578 Ga0068854_100000031 Ga0068854_10000003168 286
6 3300005614 Ga0068856_100246618 Ga0068856_1002466182 286
7 3300009177 Ga0105248_10000118 Ga0105248_1000011853 286
8 3300025941 Ga0207711_10000020 Ga0207711_10000020124 286
9 3300025981 Ga0207640_10000015 Ga0207640_10000015148 286
10 3300026078 Ga0207702_10234047 Ga0207702_102340472 286
11 3300026142 Ga0207698_10000012 Ga0207698_10000012124 286
12 3300044842 Ga0466957_0029211 Ga0466957_0029211_1530_2492 286
13 3300047673 Ga0495593_0059796 Ga0495593_0059796_194_1153 286
14 3300053083 Ga0495655_0000001 Ga0495655_0000001_69238_70224 286
15 3300053129 Ga0500628_000017 Ga0500628_000017_27043_28029 286
16 3300013307 Ga0157372_10003159 Ga0157372_1000315916 287
17 3300005834 Ga0068851_10000333 Ga0068851_100003334 288
18 3300025321 Ga0207656_10000696 Ga0207656_100006967 288
19 3300005327 Ga0070658_10171056 Ga0070658_101710562 289
20 3300025909 Ga0207705_10084687 Ga0207705_100846872 289
21 3300046507 Ga0495606_0000221 Ga0495606_0000221_58356_59330 289
22 3300046681 Ga0495647_0000576 Ga0495647_0000576_444_1418 289
23 3300047320 Ga0495672_0050579 Ga0495672_0050579_786_1760 289
24 3300005439 Ga0070711_100080257 Ga0070711_1000802573 290
25 3300005563 Ga0068855_100413806 Ga0068855_1004138061 290
26 3300048914 Ga0496111_0042554 Ga0496111_0042554_1043_2017 290
27 3300048905 Ga0496102_0000146 Ga0496102_0000146_22880_23830 291
28 3300048906 Ga0496103_0000043 Ga0496103_0000043_1876_2826 291
29 3300005341 Ga0070691_10000133 Ga0070691_1000013322 292
30 3300009176 Ga0105242_10000132 Ga0105242_1000013250 296
31 3300025934 Ga0207686_10000033 Ga0207686_10000033143 296
32 3300037312 Ga0395899_0253765 Ga0395899_0253765_72_1013 297
33 3300005981 Ga0081538_10030623 Ga0081538_100306231 301
34 3300001990 JGI24737J22298_10041849 JGI24737J22298_100418492 302
35 3300002067 JGI24735J21928_10022663 JGI24735J21928_100226632 302
36 3300002074 JGI24748J21848_1000586 JGI24748J21848_10005862 302
37 3300002239 JGI24034J26672_10017446 JGI24034J26672_100174462 302
38 3300002244 JGI24742J22300_10001127 JGI24742J22300_100011276 302
39 3300002244 JGI24742J22300_10014452 JGI24742J22300_100144521 302
40 3300003373 JGI25407J50210_10012036 JGI25407J50210_100120363 302
41 3300005329 Ga0070683_100007965 Ga0070683_1000079658 302
42 3300005333 Ga0070677_10000057 Ga0070677_1000005727 302
43 3300005335 Ga0070666_10019445 Ga0070666_100194453 302
44 3300005337 Ga0070682_100001629 Ga0070682_1000016292 302
45 3300005338 Ga0068868_100000151 Ga0068868_10000015126 302
46 3300005338 Ga0068868_100028702 Ga0068868_1000287023 302
47 3300005339 Ga0070660_100001214 Ga0070660_10000121410 302
48 3300005340 Ga0070689_100035143 Ga0070689_1000351435 302
49 3300005341 Ga0070691_10012036 Ga0070691_100120363 302
50 3300005343 Ga0070687_100053723 Ga0070687_1000537232 302
51 3300005344 Ga0070661_100000742 Ga0070661_1000007427 302
52 3300005345 Ga0070692_10058144 Ga0070692_100581444 302
53 3300005347 Ga0070668_100036849 Ga0070668_1000368492 302
54 3300005354 Ga0070675_100000053 Ga0070675_10000005346 302
55 3300005354 Ga0070675_100052994 Ga0070675_1000529944 302
56 3300005356 Ga0070674_100000008 Ga0070674_100000008124 302
57 3300005356 Ga0070674_100000082 Ga0070674_10000008222 302
58 3300005364 Ga0070673_100009564 Ga0070673_1000095645 302
59 3300005364 Ga0070673_100182619 Ga0070673_1001826192 302
60 3300005365 Ga0070688_100000012 Ga0070688_10000001282 302
61 3300005365 Ga0070688_100000492 Ga0070688_1000004924 302
62 3300005365 Ga0070688_100042986 Ga0070688_1000429861 302
63 3300005366 Ga0070659_100002102 Ga0070659_10000210213 302
64 3300005367 Ga0070667_100120149 Ga0070667_1001201493 302
65 3300005367 Ga0070667_100134235 Ga0070667_1001342352 302
66 3300005435 Ga0070714_100468067 Ga0070714_1004680672 302
67 3300005438 Ga0070701_10010964 Ga0070701_100109643 302
68 3300005439 Ga0070711_100009855 Ga0070711_1000098556 302
69 3300005440 Ga0070705_100262334 Ga0070705_1002623342 302
70 3300005444 Ga0070694_100053345 Ga0070694_1000533453 302
71 3300005456 Ga0070678_100005092 Ga0070678_1000050925 302
72 3300005457 Ga0070662_100000016 Ga0070662_10000001643 302
73 3300005457 Ga0070662_100021714 Ga0070662_1000217144 302
74 3300005458 Ga0070681_10016762 Ga0070681_100167623 302
75 3300005458 Ga0070681_10353789 Ga0070681_103537892 302
76 3300005466 Ga0070685_10000018 Ga0070685_100000184 302
77 3300005466 Ga0070685_10000460 Ga0070685_100004604 302
78 3300005466 Ga0070685_10019608 Ga0070685_100196084 302
79 3300005530 Ga0070679_100001299 Ga0070679_1000012995 302
80 3300005530 Ga0070679_100067083 Ga0070679_1000670835 302
81 3300005535 Ga0070684_100068082 Ga0070684_1000680824 302
82 3300005539 Ga0068853_100019642 Ga0068853_1000196425 302
83 3300005539 Ga0068853_100242391 Ga0068853_1002423911 302
84 3300005547 Ga0070693_100003254 Ga0070693_1000032547 302
85 3300005548 Ga0070665_100000244 Ga0070665_10000024468 302
86 3300005548 Ga0070665_100706326 Ga0070665_1007063261 302
87 3300005564 Ga0070664_100016760 Ga0070664_1000167606 302
88 3300005578 Ga0068854_100009544 Ga0068854_1000095445 302
89 3300005614 Ga0068856_100024596 Ga0068856_1000245964 302
90 3300005614 Ga0068856_100241439 Ga0068856_1002414392 302
91 3300005615 Ga0070702_100076656 Ga0070702_1000766562 302
92 3300005616 Ga0068852_100012745 Ga0068852_1000127455 302
93 3300005616 Ga0068852_100075715 Ga0068852_1000757153 302
94 3300005718 Ga0068866_10000001 Ga0068866_10000001206 302
95 3300005718 Ga0068866_10000170 Ga0068866_1000017026 302
96 3300005842 Ga0068858_100000109 Ga0068858_1000001096 302
97 3300005842 Ga0068858_100000450 Ga0068858_10000045048 302
98 3300005843 Ga0068860_100003359 Ga0068860_10000335910 302
99 3300005844 Ga0068862_100455316 Ga0068862_1004553161 302
100 3300005937 Ga0081455_10015359 Ga0081455_100153592 302
101 3300005937 Ga0081455_10048254 Ga0081455_100482543 302
102 3300005937 Ga0081455_10089283 Ga0081455_100892834 302
103 3300005937 Ga0081455_10282767 Ga0081455_102827672 302
104 3300005981 Ga0081538_10000030 Ga0081538_10000030108 302
105 3300005981 Ga0081538_10000426 Ga0081538_1000042619 302
106 3300005981 Ga0081538_10017283 Ga0081538_100172833 302
107 3300005981 Ga0081538_10062841 Ga0081538_100628412 302
108 3300006038 Ga0075365_10013530 Ga0075365_100135305 302
109 3300006051 Ga0075364_10056377 Ga0075364_100563772 302
110 3300006051 Ga0075364_10129084 Ga0075364_101290843 302
111 3300006163 Ga0070715_10000001 Ga0070715_10000001179 302
112 3300006175 Ga0070712_100004464 Ga0070712_1000044642 302
113 3300006847 Ga0075431_100008782 Ga0075431_1000087829 302
114 3300006852 Ga0075433_10000478 Ga0075433_1000047814 302
115 3300006852 Ga0075433_10027471 Ga0075433_100274714 302
116 3300006881 Ga0068865_100000402 Ga0068865_1000004025 302
117 3300006881 Ga0068865_100009454 Ga0068865_1000094545 302
118 3300006914 Ga0075436_100060401 Ga0075436_1000604014 302
119 3300009093 Ga0105240_10154974 Ga0105240_101549743 302
120 3300009094 Ga0111539_10624819 Ga0111539_106248192 302
121 3300009094 Ga0111539_10748723 Ga0111539_107487232 302
122 3300009098 Ga0105245_10000180 Ga0105245_100001802 302
123 3300009098 Ga0105245_10000619 Ga0105245_100006197 302
124 3300009147 Ga0114129_10092683 Ga0114129_100926834 302
125 3300009176 Ga0105242_10063020 Ga0105242_100630203 302
126 3300009176 Ga0105242_10154271 Ga0105242_101542712 302
127 3300009176 Ga0105242_10370040 Ga0105242_103700402 302
128 3300009551 Ga0105238_10061765 Ga0105238_100617655 302
129 3300009553 Ga0105249_10000068 Ga0105249_1000006837 302
130 3300009553 Ga0105249_10029618 Ga0105249_100296185 302
131 3300009553 Ga0105249_10453424 Ga0105249_104534242 302
132 3300011119 Ga0105246_10207740 Ga0105246_102077401 302
133 3300013102 Ga0157371_10086413 Ga0157371_100864132 302
134 3300013104 Ga0157370_10007239 Ga0157370_100072397 302
135 3300013105 Ga0157369_10000142 Ga0157369_1000014211 302
136 3300013297 Ga0157378_10018651 Ga0157378_100186512 302
137 3300013306 Ga0163162_10583033 Ga0163162_105830332 302
138 3300013307 Ga0157372_10081714 Ga0157372_100817143 302
139 3300013308 Ga0157375_10000367 Ga0157375_1000036716 302
140 3300014326 Ga0157380_10000059 Ga0157380_1000005927 302
141 3300014326 Ga0157380_10002780 Ga0157380_1000278010 302
142 3300014326 Ga0157380_10145284 Ga0157380_101452842 302
143 3300014745 Ga0157377_10021783 Ga0157377_100217835 302
144 3300014968 Ga0157379_10011621 Ga0157379_100116219 302
145 3300014968 Ga0157379_10023859 Ga0157379_100238593 302
146 3300025321 Ga0207656_10021606 Ga0207656_100216063 302
147 3300025893 Ga0207682_10000129 Ga0207682_100001299 302
148 3300025899 Ga0207642_10000006 Ga0207642_10000006209 302
149 3300025899 Ga0207642_10000007 Ga0207642_1000000727 302
150 3300025899 Ga0207642_10000222 Ga0207642_1000022216 302
151 3300025899 Ga0207642_10087345 Ga0207642_100873451 302
152 3300025901 Ga0207688_10004232 Ga0207688_100042325 302
153 3300025903 Ga0207680_10089821 Ga0207680_100898213 302
154 3300025905 Ga0207685_10000011 Ga0207685_10000011179 302
155 3300025912 Ga0207707_10033967 Ga0207707_100339673 302
156 3300025915 Ga0207693_10054160 Ga0207693_100541604 302
157 3300025916 Ga0207663_10006691 Ga0207663_100066913 302
158 3300025918 Ga0207662_10043224 Ga0207662_100432244 302
159 3300025919 Ga0207657_10032142 Ga0207657_100321423 302
160 3300025920 Ga0207649_10000076 Ga0207649_1000007669 302
161 3300025921 Ga0207652_10002610 Ga0207652_100026105 302
162 3300025921 Ga0207652_10004210 Ga0207652_1000421011 302
163 3300025924 Ga0207694_10389477 Ga0207694_103894772 302
164 3300025926 Ga0207659_10000010 Ga0207659_10000010253 302
165 3300025926 Ga0207659_10012687 Ga0207659_100126876 302
166 3300025927 Ga0207687_10000007 Ga0207687_10000007239 302
167 3300025927 Ga0207687_10000018 Ga0207687_1000001855 302
168 3300025927 Ga0207687_10000269 Ga0207687_100002697 302
169 3300025927 Ga0207687_10098663 Ga0207687_100986633 302
170 3300025929 Ga0207664_10414929 Ga0207664_104149292 302
171 3300025932 Ga0207690_10024040 Ga0207690_100240402 302
172 3300025933 Ga0207706_10000068 Ga0207706_1000006843 302
173 3300025933 Ga0207706_10001582 Ga0207706_1000158220 302
174 3300025934 Ga0207686_10139076 Ga0207686_101390762 302
175 3300025937 Ga0207669_10000004 Ga0207669_1000000482 302
176 3300025937 Ga0207669_10000012 Ga0207669_1000001226 302
177 3300025938 Ga0207704_10000190 Ga0207704_1000019011 302
178 3300025938 Ga0207704_10004819 Ga0207704_100048195 302
179 3300025940 Ga0207691_10000190 Ga0207691_1000019048 302
180 3300025940 Ga0207691_10425256 Ga0207691_104252562 302
181 3300025944 Ga0207661_10002022 Ga0207661_1000202212 302
182 3300025944 Ga0207661_10002688 Ga0207661_100026887 302
183 3300025944 Ga0207661_10003810 Ga0207661_100038102 302
184 3300025944 Ga0207661_10087203 Ga0207661_100872032 302
185 3300025960 Ga0207651_10001019 Ga0207651_100010195 302
186 3300025961 Ga0207712_10000007 Ga0207712_10000007189 302
187 3300025961 Ga0207712_10020131 Ga0207712_100201314 302
188 3300025972 Ga0207668_10017860 Ga0207668_100178602 302
189 3300025981 Ga0207640_10014004 Ga0207640_100140046 302
190 3300025986 Ga0207658_10055167 Ga0207658_100551673 302
191 3300026023 Ga0207677_10000421 Ga0207677_100004215 302
192 3300026023 Ga0207677_10000919 Ga0207677_100009193 302
193 3300026035 Ga0207703_10000040 Ga0207703_1000004087 302
194 3300026035 Ga0207703_10000322 Ga0207703_1000032248 302
195 3300026035 Ga0207703_10122263 Ga0207703_101222633 302
196 3300026041 Ga0207639_10018955 Ga0207639_100189554 302
197 3300026067 Ga0207678_10000834 Ga0207678_1000083417 302
198 3300026067 Ga0207678_10001751 Ga0207678_100017512 302
199 3300026078 Ga0207702_10000016 Ga0207702_10000016215 302
200 3300026089 Ga0207648_10101570 Ga0207648_101015703 302
201 3300026121 Ga0207683_10011233 Ga0207683_100112335 302
202 3300026121 Ga0207683_10127807 Ga0207683_101278074 302
203 3300028379 Ga0268266_10000020 Ga0268266_1000002066 302
204 3300028379 Ga0268266_10000085 Ga0268266_1000008574 302
205 3300028379 Ga0268266_10044964 Ga0268266_100449642 302
206 3300028380 Ga0268265_10227130 Ga0268265_102271302 302
207 3300028381 Ga0268264_10006922 Ga0268264_100069225 302
208 3300031250 Ga0265331_10049004 Ga0265331_100490043 302
209 3300031728 Ga0316578_10134705 Ga0316578_101347052 302
210 3300032002 Ga0307416_100384511 Ga0307416_1003845112 302
211 3300032126 Ga0307415_100010918 Ga0307415_1000109185 302
212 3300035398 Ga0316574_0112067 Ga0316574_0112067_356_1264 302
213 3300036401 Ga0373937_0145908 Ga0373937_0145908_890_1798 302
214 3300036712 Ga0316584_0050287 Ga0316584_0050287_949_1857 302
215 3300038443 Ga0395901_0320159 Ga0395901_0320159_371_1285 302
216 3300041512 Ga0451853_1421606 Ga0451853_1421606_1949_2857 302
217 3300044694 Ga0466963_0000023 Ga0466963_0000023_30986_31894 302
218 3300044694 Ga0466963_0012059 Ga0466963_0012059_983_1942 302
219 3300044694 Ga0466963_0026375 Ga0466963_0026375_640_1599 302
220 3300045836 Ga0466958_0025323 Ga0466958_0025323_332_1294 302
221 3300045976 Ga0466967_0000027 Ga0466967_0000027_43941_44900 302
222 3300045976 Ga0466967_0010631 Ga0466967_0010631_5771_6709 302
223 3300046454 Ga0495592_0000036 Ga0495592_0000036_34592_35500 302
224 3300046455 Ga0495603_0000097 Ga0495603_0000097_23210_24118 302
225 3300046461 Ga0495641_0000003 Ga0495641_0000003_201831_202739 302
226 3300046461 Ga0495641_0014845 Ga0495641_0014845_2483_3457 302
227 3300046462 Ga0495651_0068491 Ga0495651_0068491_180_1088 302
228 3300046463 Ga0495653_0013986 Ga0495653_0013986_731_1639 302
229 3300046463 Ga0495653_0029748 Ga0495653_0029748_2998_3906 302
230 3300046473 Ga0495582_0000029 Ga0495582_0000029_52113_53021 302
231 3300046475 Ga0495639_0074963 Ga0495639_0074963_334_1242 302
232 3300046476 Ga0495662_0000030 Ga0495662_0000030_35805_36713 302
233 3300046511 Ga0495608_0000031 Ga0495608_0000031_117750_118658 302
234 3300046511 Ga0495608_0000204 Ga0495608_0000204_29389_30297 302
235 3300046511 Ga0495608_0004209 Ga0495608_0004209_4773_5681 302
236 3300046515 Ga0495620_0001199 Ga0495620_0001199_6925_7833 302
237 3300046516 Ga0495628_0055723 Ga0495628_0055723_1486_2394 302
238 3300046517 Ga0495630_0000018 Ga0495630_0000018_113911_114885 302
239 3300046517 Ga0495630_0003066 Ga0495630_0003066_54_962 302
240 3300046517 Ga0495630_0003393 Ga0495630_0003393_2197_3105 302
241 3300046517 Ga0495630_0034263 Ga0495630_0034263_1053_1961 302
242 3300046517 Ga0495630_0086016 Ga0495630_0086016_1274_2182 302
243 3300046523 Ga0495644_0000535 Ga0495644_0000535_2475_3383 302
244 3300046535 Ga0495586_0017818 Ga0495586_0017818_2083_2991 302
245 3300046536 Ga0495587_0006846 Ga0495587_0006846_2409_3317 302
246 3300046539 Ga0495621_0011941 Ga0495621_0011941_1739_2647 302
247 3300046559 Ga0495667_0000032 Ga0495667_0000032_100235_101143 302
248 3300046642 Ga0495634_0000401 Ga0495634_0000401_3758_4666 302
249 3300046663 Ga0495635_0000016 Ga0495635_0000016_34442_35350 302
250 3300046674 Ga0495588_0000663 Ga0495588_0000663_1543_2517 302
251 3300046675 Ga0495657_0000024 Ga0495657_0000024_117750_118658 302
252 3300046675 Ga0495657_0016686 Ga0495657_0016686_1170_2078 302
253 3300046675 Ga0495657_0018124 Ga0495657_0018124_2067_2975 302
254 3300046679 Ga0495623_0071163 Ga0495623_0071163_868_2061 302
255 3300046681 Ga0495647_0000025 Ga0495647_0000025_26530_27438 302
256 3300046683 Ga0495658_0000026 Ga0495658_0000026_24922_25830 302
257 3300046684 Ga0495669_0000260 Ga0495669_0000260_20294_21202 302
258 3300046689 Ga0495613_0000152 Ga0495613_0000152_23798_24706 302
259 3300046689 Ga0495613_0049733 Ga0495613_0049733_1661_2569 302
260 3300046690 Ga0495624_0000009 Ga0495624_0000009_117210_118118 302
261 3300046690 Ga0495624_0000661 Ga0495624_0000661_20196_21170 302
262 3300046692 Ga0495671_0122790 Ga0495671_0122790_11_919 302
263 3300046694 Ga0495649_0003829 Ga0495649_0003829_4903_5811 302
264 3300047317 Ga0495604_0000019 Ga0495604_0000019_39791_40699 302
265 3300047321 Ga0495676_0000676 Ga0495676_0000676_24432_25340 302
266 3300047322 Ga0495680_0000061 Ga0495680_0000061_72409_73317 302
267 3300047322 Ga0495680_0001562 Ga0495680_0001562_21609_22517 302
268 3300047322 Ga0495680_0004057 Ga0495680_0004057_4328_5236 302
269 3300047444 Ga0495675_0000428 Ga0495675_0000428_26598_27506 302
270 3300047446 Ga0495679_011449 Ga0495679_011449_211_1119 302
271 3300047447 Ga0495685_010313 Ga0495685_010313_1923_2831 302
272 3300047471 Ga0495684_0203687 Ga0495684_0203687_313_1221 302
273 3300048903 Ga0496100_0000002 Ga0496100_0000002_181531_182439 302
274 3300048904 Ga0496101_0000001 Ga0496101_0000001_181531_182439 302
275 3300048905 Ga0496102_0050254 Ga0496102_0050254_942_1850 302
276 3300048905 Ga0496102_0152078 Ga0496102_0152078_303_1211 302
277 3300048907 Ga0496104_0000009 Ga0496104_0000009_9647_10555 302
278 3300048907 Ga0496104_0220363 Ga0496104_0220363_95_1003 302
279 3300048908 Ga0496105_0000027 Ga0496105_0000027_137970_138878 302
280 3300048909 Ga0496106_0000149 Ga0496106_0000149_30537_31445 302
281 3300048909 Ga0496106_0000955 Ga0496106_0000955_4848_5756 302
282 3300048909 Ga0496106_0008559 Ga0496106_0008559_1584_2492 302
283 3300048910 Ga0496107_0000013 Ga0496107_0000013_9253_10161 302
284 3300048910 Ga0496107_0241268 Ga0496107_0241268_47_955 302
285 3300048910 Ga0496107_0384814 Ga0496107_0384814_111_1019 302
286 3300048911 Ga0496108_0000001 Ga0496108_0000001_465877_466785 302
287 3300048911 Ga0496108_0000107 Ga0496108_0000107_4229_5137 302
288 3300048911 Ga0496108_0000132 Ga0496108_0000132_47451_48413 302
289 3300048911 Ga0496108_0013136 Ga0496108_0013136_4836_5744 302
290 3300048911 Ga0496108_0239084 Ga0496108_0239084_75_983 302
291 3300048911 Ga0496108_0400007 Ga0496108_0400007_12_920 302
292 3300048912 Ga0496109_0000003 Ga0496109_0000003_140423_141331 302
293 3300048912 Ga0496109_0000007 Ga0496109_0000007_154285_155247 302
294 3300048912 Ga0496109_0000028 Ga0496109_0000028_52986_53966 302
295 3300048912 Ga0496109_0000190 Ga0496109_0000190_56106_57014 302
296 3300048912 Ga0496109_0078248 Ga0496109_0078248_1237_2145 302
297 3300048912 Ga0496109_0083812 Ga0496109_0083812_85_993 302
298 3300048912 Ga0496109_0174088 Ga0496109_0174088_33_941 302
299 3300048913 Ga0496110_0046579 Ga0496110_0046579_122_1030 302
300 3300048915 Ga0496112_0000003 Ga0496112_0000003_152567_153475 302
301 3300048916 Ga0496113_0032616 Ga0496113_0032616_2107_3015 302
302 3300048916 Ga0496113_0043897 Ga0496113_0043897_1327_2235 302
303 3300048917 Ga0496114_0494325 Ga0496114_0494325_42_1016 302
304 3300048922 Ga0496119_0023523 Ga0496119_0023523_1761_2669 302
305 3300048924 Ga0496121_0060850 Ga0496121_0060850_1802_2710 302
306 3300048927 Ga0496124_0068611 Ga0496124_0068611_1897_2805 302
307 3300049569 Ga0501032_0000899 Ga0501032_0000899_2864_3775 302
308 3300049570 Ga0501033_0001140 Ga0501033_0001140_2873_3784 302
309 3300049571 Ga0501034_0022851 Ga0501034_0022851_909_1820 302
310 3300049572 Ga0501036_0001260 Ga0501036_0001260_2876_3787 302
311 3300049573 Ga0501037_0000774 Ga0501037_0000774_20126_21037 302
312 3300049574 Ga0501038_0001146 Ga0501038_0001146_20234_21145 302
313 3300049576 Ga0501040_0020292 Ga0501040_0020292_816_1727 302
314 3300049577 Ga0501041_0177632 Ga0501041_0177632_138_1046 302
315 3300049578 Ga0501042_0031003 Ga0501042_0031003_910_1821 302
316 3300049579 Ga0501043_0001082 Ga0501043_0001082_2862_3773 302
317 3300049579 Ga0501043_0082624 Ga0501043_0082624_787_1695 302
318 3300049580 Ga0501046_0000447 Ga0501046_0000447_2860_3771 302
319 3300049581 Ga0501047_0001335 Ga0501047_0001335_3020_3931 302
320 3300049581 Ga0501047_0074650 Ga0501047_0074650_1234_2142 302
321 3300049582 Ga0501048_0000734 Ga0501048_0000734_2846_3757 302
322 3300049584 Ga0501068_0051688 Ga0501068_0051688_225_1136 302
323 3300049585 Ga0501069_0083173 Ga0501069_0083173_235_1143 302
324 3300049586 Ga0501070_0001137 Ga0501070_0001137_2851_3762 302
325 3300049586 Ga0501070_0049980 Ga0501070_0049980_2310_3218 302
326 3300049587 Ga0501071_0008734 Ga0501071_0008734_2579_3487 302
327 3300049588 Ga0501072_0012297 Ga0501072_0012297_5240_6148 302
328 3300049588 Ga0501072_0462330 Ga0501072_0462330_18_926 302
329 3300049589 Ga0501073_0016359 Ga0501073_0016359_1664_2575 302
330 3300049590 Ga0501074_0033768 Ga0501074_0033768_1014_1922 302
331 3300049590 Ga0501074_0120453 Ga0501074_0120453_844_1752 302
332 3300049593 Ga0501077_0023713 Ga0501077_0023713_2892_3800 302
333 3300049741 Ga0501079_0037573 Ga0501079_0037573_554_1462 302
334 3300049742 Ga0501080_0032766 Ga0501080_0032766_1080_1991 302
335 3300049742 Ga0501080_0165696 Ga0501080_0165696_869_1777 302
336 3300049743 Ga0501081_0164065 Ga0501081_0164065_153_1061 302
337 3300049743 Ga0501081_0317629 Ga0501081_0317629_19_927 302
338 3300049744 Ga0501083_0015145 Ga0501083_0015145_1618_2526 302
339 3300049744 Ga0501083_0029438 Ga0501083_0029438_874_1785 302
340 3300049822 Ga0501035_0004594 Ga0501035_0004594_1974_2885 302
341 3300049823 Ga0501044_0025332 Ga0501044_0025332_2862_3773 302
342 3300049823 Ga0501044_0085187 Ga0501044_0085187_689_1597 302
343 3300049824 Ga0501045_0043030 Ga0501045_0043030_1401_2309 302
344 3300050509 nmdc:mga0qj67_35695_c1 nmdc:mga0qj67_35695_c1_2564_3475 302
345 3300050510 nmdc:mga06r32_6365_c1 nmdc:mga06r32_6365_c1_7748_8659 302
346 3300050512 nmdc:mga0n895_26632_c1 nmdc:mga0n895_26632_c1_1340_2248 302
347 3300050514 nmdc:mga08x19_59015_c1 nmdc:mga08x19_59015_c1_209_1117 302
348 3300050515 nmdc:mga0a205_11_c1 nmdc:mga0a205_11_c1_57490_58398 302
349 3300050515 nmdc:mga0a205_437_c2 nmdc:mga0a205_437_c2_8203_9111 302
350 3300050515 nmdc:mga0a205_88844_c1 nmdc:mga0a205_88844_c1_2060_2968 302
351 3300053078 Ga0495612_0019716 Ga0495612_0019716_1412_2320 302
352 3300053078 Ga0495612_0046039 Ga0495612_0046039_398_1306 302
353 3300053078 Ga0495612_0053953 Ga0495612_0053953_364_1338 302
354 3300053083 Ga0495655_0035206 Ga0495655_0035206_318_1226 302
355 3300053084 Ga0495595_0000014 Ga0495595_0000014_26598_27506 302
356 3300053085 Ga0495619_0000021 Ga0495619_0000021_101165_102073 302
357 3300053085 Ga0495619_0000147 Ga0495619_0000147_26598_27506 302
358 3300053085 Ga0495619_0034908 Ga0495619_0034908_777_1685 302
359 3300053123 Ga0500614_000026 Ga0500614_000026_32112_33020 302
360 3300054114 Ga0501084_0161958 Ga0501084_0161958_879_1787 302
361 3300060346 Ga0587111_0006462 Ga0587111_0006462_310_1218 302
362 3300061734 Ga0530510_0006221 Ga0530510_0006221_7288_8196 302
363 3300061734 Ga0530510_0021805 Ga0530510_0021805_1233_2141 302
364 3300005544 Ga0070686_100064111 Ga0070686_1000641114 303
365 3300005985 Ga0081539_10003705 Ga0081539_1000370518 303
366 3300046476 Ga0495662_0014754 Ga0495662_0014754_396_1355 303
367 3300048911 Ga0496108_0082419 Ga0496108_0082419_1328_2293 303
368 3300005937 Ga0081455_10059037 Ga0081455_100590375 304
369 3300006038 Ga0075365_10063196 Ga0075365_100631963 304
370 3300006048 Ga0075363_100071464 Ga0075363_1000714642 304
371 3300006178 Ga0075367_10041075 Ga0075367_100410753 304
372 3300006846 Ga0075430_100040535 Ga0075430_1000405353 304
373 3300006847 Ga0075431_100049054 Ga0075431_1000490543 304
374 3300009093 Ga0105240_10138101 Ga0105240_101381013 304
375 3300009101 Ga0105247_10000322 Ga0105247_1000032237 304
376 3300013297 Ga0157378_10029504 Ga0157378_100295043 304
377 3300025900 Ga0207710_10000158 Ga0207710_1000015857 304
378 3300025913 Ga0207695_10080470 Ga0207695_100804703 304
379 3300025928 Ga0207700_10000025 Ga0207700_1000002557 304
380 3300025932 Ga0207690_10006437 Ga0207690_100064375 304
381 3300025934 Ga0207686_10000428 Ga0207686_100004285 304
382 3300025945 Ga0207679_10162892 Ga0207679_101628922 304
383 3300026088 Ga0207641_10005415 Ga0207641_1000541510 304
384 3300026095 Ga0207676_10000016 Ga0207676_10000016143 304
385 3300028800 Ga0265338_10000486 Ga0265338_1000048646 304
386 3300046459 Ga0495629_0031189 Ga0495629_0031189_280_1233 304
387 3300046499 Ga0495594_0000003 Ga0495594_0000003_52126_53091 304
388 3300046516 Ga0495628_0000924 Ga0495628_0000924_10174_11139 304
389 3300046529 Ga0495652_0004947 Ga0495652_0004947_393_1358 304
390 3300046536 Ga0495587_0108909 Ga0495587_0108909_473_1438 304
391 3300046557 Ga0495622_0000014 Ga0495622_0000014_14217_15182 304
392 3300046615 Ga0495656_0000617 Ga0495656_0000617_1454_2410 304
393 3300046642 Ga0495634_0021454 Ga0495634_0021454_876_1844 304
394 3300046689 Ga0495613_0000073 Ga0495613_0000073_30524_31501 304
395 3300046809 Ga0495600_0017803 Ga0495600_0017803_119_1096 304
396 3300047317 Ga0495604_0002440 Ga0495604_0002440_11295_12272 304
397 3300047319 Ga0495674_0000731 Ga0495674_0000731_24908_25873 304
398 3300047321 Ga0495676_0008238 Ga0495676_0008238_250_1206 304
399 3300047444 Ga0495675_0040106 Ga0495675_0040106_495_1460 304
400 3300048088 Ga0495602_0035128 Ga0495602_0035128_2432_3397 304
401 3300048903 Ga0496100_0000018 Ga0496100_0000018_9107_10063 304
402 3300048904 Ga0496101_0000221 Ga0496101_0000221_18768_19724 304
403 3300048907 Ga0496104_0000004 Ga0496104_0000004_68997_69959 304
404 3300048908 Ga0496105_0000001 Ga0496105_0000001_571872_572834 304
405 3300048908 Ga0496105_0008527 Ga0496105_0008527_5256_6221 304
406 3300048909 Ga0496106_0000018 Ga0496106_0000018_151324_152280 304
407 3300048910 Ga0496107_0000006 Ga0496107_0000006_78030_78986 304
408 3300048913 Ga0496110_0143098 Ga0496110_0143098_958_1941 304
409 3300048913 Ga0496110_0186286 Ga0496110_0186286_201_1169 304
410 3300048916 Ga0496113_0063296 Ga0496113_0063296_547_1515 304
411 3300048917 Ga0496114_0000014 Ga0496114_0000014_129904_130869 304
412 3300048918 Ga0496115_0000989 Ga0496115_0000989_16476_17441 304
413 3300048922 Ga0496119_0051528 Ga0496119_0051528_589_1551 304
414 3300048923 Ga0496120_0015155 Ga0496120_0015155_638_1600 304
415 3300049571 Ga0501034_0396937 Ga0501034_0396937_17_976 304
416 3300049578 Ga0501042_0058480 Ga0501042_0058480_1788_2732 304
417 3300049578 Ga0501042_0145697 Ga0501042_0145697_213_1190 304
418 3300049581 Ga0501047_0151114 Ga0501047_0151114_1190_2149 304
419 3300049584 Ga0501068_0075635 Ga0501068_0075635_200_1174 304
420 3300049586 Ga0501070_0006027 Ga0501070_0006027_7768_8742 304
421 3300049588 Ga0501072_0064461 Ga0501072_0064461_961_1935 304
422 3300049589 Ga0501073_0014644 Ga0501073_0014644_2726_3700 304
423 3300049590 Ga0501074_0046514 Ga0501074_0046514_1170_2144 304
424 3300049592 Ga0501076_0124186 Ga0501076_0124186_1054_1977 304
425 3300049593 Ga0501077_0102467 Ga0501077_0102467_704_1627 304
426 3300049742 Ga0501080_0034163 Ga0501080_0034163_1212_2186 304
427 3300049822 Ga0501035_0083570 Ga0501035_0083570_1684_2643 304
428 3300049823 Ga0501044_0156510 Ga0501044_0156510_1223_2182 304
429 3300050490 nmdc:mga03n38_85223_c1 nmdc:mga03n38_85223_c1_510_1475 304
430 3300050509 nmdc:mga0qj67_63189_c1 nmdc:mga0qj67_63189_c1_1732_2697 304
431 3300053077 Ga0495601_0000039 Ga0495601_0000039_19688_20665 304
432 3300053077 Ga0495601_0003264 Ga0495601_0003264_5160_6125 304
433 3300053077 Ga0495601_0132891 Ga0495601_0132891_452_1417 304
434 3300001977 JGI24746J21847_1000315 JGI24746J21847_10003156 305
435 3300005367 Ga0070667_100025502 Ga0070667_1000255022 305
436 3300005843 Ga0068860_100046586 Ga0068860_1000465865 305
437 3300005844 Ga0068862_100008805 Ga0068862_1000088054 305
438 3300005937 Ga0081455_10024588 Ga0081455_100245884 305
439 3300005983 Ga0081540_1027734 Ga0081540_10277343 305
440 3300006038 Ga0075365_10040866 Ga0075365_100408662 305
441 3300006048 Ga0075363_100070428 Ga0075363_1000704283 305
442 3300006186 Ga0075369_10015275 Ga0075369_100152753 305
443 3300009553 Ga0105249_10051368 Ga0105249_100513685 305
444 3300009553 Ga0105249_10318012 Ga0105249_103180122 305
445 3300025961 Ga0207712_10004400 Ga0207712_100044004 305
446 3300025986 Ga0207658_10073793 Ga0207658_100737933 305
447 3300028380 Ga0268265_10009333 Ga0268265_100093334 305
448 3300035398 Ga0316574_0007213 Ga0316574_0007213_2465_3421 305
449 3300037418 Ga0395900_0372104 Ga0395900_0372104_349_1290 305
450 3300037466 Ga0395898_0145672 Ga0395898_0145672_1039_1968 305
451 3300038443 Ga0395901_0276627 Ga0395901_0276627_707_1636 305
452 3300046491 Ga0495584_0116184 Ga0495584_0116184_118_1044 305
453 3300046660 Ga0495625_0101241 Ga0495625_0101241_345_1316 305
454 3300050491 nmdc:mga00v17_105302_c1 nmdc:mga00v17_105302_c1_628_1554 305
455 3300050491 nmdc:mga00v17_45209_c1 nmdc:mga00v17_45209_c1_1458_2375 305
456 3300050492 nmdc:mga0yw44_143773_c1 nmdc:mga0yw44_143773_c1_613_1539 305

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00119

ATP-synt_A

ATP synthase A chain

77

308

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6n2d-assembly1.cif.gz_a bacillus ps3 atp synthase membrane region 0.6709 51 299
6n2d-assembly1.cif.gz_a bacillus ps3 atp synthase membrane region 0.6597 51 299
7jg5-assembly1.cif.gz_a cryo-em structure of bedaquiline-free mycobacterium smegmatis atp synthase rotational state 1 0.6408 68 302
7njp-assembly1.cif.gz_a mycobacterium smegmatis atp synthase state 2 0.6371 46 302
7jg5-assembly1.cif.gz_a cryo-em structure of bedaquiline-free mycobacterium smegmatis atp synthase rotational state 1 0.6364 68 302
ID Description Score Start End Superfamily
af_Q27559_82_244_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.587 119 300 1.20.120.220
af_M1FN39_66_236_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.5813 113 302 1.20.120.220
af_M1FN39_66_236_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.5737 113 302 1.20.120.220
af_Q27559_82_244_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.5709 119 300 1.20.120.220
af_P00854_92_259_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.568 118 303 1.20.120.220
ID Description Score Start End GO Terms
AF-A0A382V4S5-F1-model_v4 F0F1 ATP synthase subunit A 0.7054 41 140 GO:0045263
GO:0046933
AF-A0A2H6K2G6-F1-model_v4 ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6) 0.7042 37 305 GO:0005886
GO:0045263
GO:0046933
AF-A0A382M5F1-F1-model_v4 ATP synthase subunit a 0.7029 38 141 GO:0045263
GO:0046933
AF-A0A7V9MGF7-F1-model_v4 ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6) 0.7022 38 305 GO:0005886
GO:0045263
GO:0046933
AF-A0A7V9MGF7-F1-model_v4 ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6) 0.7008 38 305 GO:0005886
GO:0045263
GO:0046933

Feature Viewer

pLDDT pTM Quality
66.32 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map