F447726

General Info

Members Datasets Scaffolds Average Seq Length
456 232 912 182

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100000269|Ga0070696_10000026917
Length 193
Sequence MTKRRNVIVHIASSADGYIARPDGDMEWLTSRPAPKGFYGLSAFTKSIDTKLLGRKTYEESLRLGAKFDSKKERTIVFSRHAPPANAPSGVEFVSGAIGPFVSRLRKQPGKDIWLMGGGDLIASFLDERAIDEFVVSVVPVFIGDGIPLIARRHRHVLLDLRSVEQFEDGLVQLRYRPTRSPKSEAATGPEEL

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
194 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
200 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.97
Rhizosphere 97.59
Stem 0
Stem Tuber 0
Unclassified 23.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_100000269 3300005546 Bacteria 31305
2 rootL2_10368023 3300003322 Bacteria 1592
3 Ga0065714_10208909 3300005288 Unclassified 872
4 Ga0065704_10113351 3300005289 Unclassified 1914
5 Ga0065712_10017573 3300005290 Unclassified 1554
6 Ga0065712_10249836 3300005290 Unclassified 963
7 Ga0065712_10326765 3300005290 Unclassified 820
8 Ga0065715_10101792 3300005293 Bacteria 3171
9 Ga0065715_10159775 3300005293 Unclassified 1641
10 Ga0065707_10006644 3300005295 Bacteria 2691
11 Ga0065707_10251572 3300005295 Bacteria 1123
12 Ga0070658_10644257 3300005327 Unclassified 919
13 Ga0070676_10003965 3300005328 Bacteria 7766
14 Ga0070676_10070996 3300005328 Unclassified 2091
15 Ga0070683_100038187 3300005329 Bacteria 4400
16 Ga0070683_100061067 3300005329 Unclassified 3504
17 Ga0070683_100203018 3300005329 Bacteria 1883
18 Ga0070683_100509540 3300005329 Bacteria 1150
19 Ga0070690_100049615 3300005330 Bacteria 2676
20 Ga0070690_100724134 3300005330 Bacteria 766
21 Ga0070670_100133464 3300005331 Bacteria 2145
22 Ga0070670_100149643 3300005331 Bacteria 2020
23 Ga0070670_100283679 3300005331 Bacteria 1446
24 Ga0068869_100065837 3300005334 Bacteria 2669
25 Ga0068869_100242581 3300005334 Bacteria 1436
26 Ga0070680_100011532 3300005336 Bacteria 6839
27 Ga0070680_100201709 3300005336 Bacteria 1678
28 Ga0070682_100024180 3300005337 Bacteria 3614
29 Ga0068868_100325873 3300005338 Bacteria 1310
30 Ga0070660_100029368 3300005339 Bacteria 4120
31 Ga0070689_100000235 3300005340 Bacteria 32477
32 Ga0070689_100050999 3300005340 Bacteria 3197
33 Ga0070687_100033956 3300005343 Unclassified 2522
34 Ga0070661_100015244 3300005344 Bacteria 5425
35 Ga0070692_10002697 3300005345 Bacteria 6958
36 Ga0070692_10038943 3300005345 Bacteria 2425
37 Ga0070692_10048175 3300005345 Bacteria 2207
38 Ga0070668_100014283 3300005347 Bacteria 5934
39 Ga0070669_100055908 3300005353 Bacteria 2892
40 Ga0070669_100061072 3300005353 Unclassified 2769
41 Ga0070675_100045436 3300005354 Bacteria 3594
42 Ga0070675_100052646 3300005354 Bacteria 3347
43 Ga0070675_100193936 3300005354 Viruses 1761
44 Ga0070675_100473624 3300005354 Unclassified 1125
45 Ga0070675_100628849 3300005354 Unclassified 975
46 Ga0070671_100370092 3300005355 Bacteria 1224
47 Ga0070671_100405266 3300005355 Bacteria 1167
48 Ga0070671_100587438 3300005355 Bacteria 962
49 Ga0070673_100042479 3300005364 Unclassified 3506
50 Ga0070673_100160870 3300005364 Bacteria 1909
51 Ga0070673_100490875 3300005364 Unclassified 1110
52 Ga0070673_100560901 3300005364 Bacteria 1038
53 Ga0070659_100021339 3300005366 Bacteria 4932
54 Ga0070667_100329741 3300005367 Bacteria 1378
55 Ga0070667_100416723 3300005367 Bacteria 1224
56 Ga0070667_100676530 3300005367 Bacteria 954
57 Ga0070709_10046466 3300005434 Unclassified 2699
58 Ga0070709_10391525 3300005434 Bacteria 1036
59 Ga0070714_100090238 3300005435 Bacteria 2684
60 Ga0070713_100020404 3300005436 Bacteria 5082
61 Ga0070713_100991579 3300005436 Unclassified 810
62 Ga0070710_10237182 3300005437 Bacteria 1167
63 Ga0070701_10045867 3300005438 Bacteria 2245
64 Ga0070701_10061625 3300005438 Bacteria 1979
65 Ga0070705_100048139 3300005440 Unclassified 2468
66 Ga0070700_100028651 3300005441 Bacteria 3315
67 Ga0070700_100089650 3300005441 Bacteria 2004
68 Ga0070694_100052322 3300005444 Bacteria 2760
69 Ga0070694_100626647 3300005444 Unclassified 868
70 Ga0070694_100781605 3300005444 Unclassified 782
71 Ga0070694_100884331 3300005444 Bacteria 737
72 Ga0070663_100288665 3300005455 Bacteria 1310
73 Ga0070678_100317258 3300005456 Bacteria 1330
74 Ga0070662_100049134 3300005457 Bacteria 3041
75 Ga0070681_10004743 3300005458 Bacteria 13023
76 Ga0068867_100234763 3300005459 Bacteria 1484
77 Ga0068867_100335628 3300005459 Unclassified 1257
78 Ga0070685_10194000 3300005466 Bacteria 1316
79 Ga0070685_10584527 3300005466 Unclassified 801
80 Ga0070706_100000833 3300005467 Bacteria 34156
81 Ga0070707_100172704 3300005468 Bacteria 2106
82 Ga0070698_100039877 3300005471 Bacteria 4829
83 Ga0070698_100087575 3300005471 Bacteria 3100
84 Ga0070698_100163220 3300005471 Bacteria 2171
85 Ga0070698_100209824 3300005471 Bacteria 1882
86 Ga0070699_100007212 3300005518 Bacteria 9669
87 Ga0070699_100062539 3300005518 Bacteria 3226
88 Ga0070699_100113502 3300005518 Bacteria 2380
89 Ga0070679_100006171 3300005530 Bacteria 11155
90 Ga0070679_100034233 3300005530 Bacteria 5033
91 Ga0070679_100232785 3300005530 Bacteria 1802
92 Ga0070679_100339756 3300005530 Bacteria 1450
93 Ga0070684_100011911 3300005535 Bacteria 6945
94 Ga0070684_100031124 3300005535 Bacteria 4540
95 Ga0070684_100703664 3300005535 Bacteria 942
96 Ga0070684_100728027 3300005535 Bacteria 925
97 Ga0070684_100836065 3300005535 Bacteria 861
98 Ga0070697_100011627 3300005536 Bacteria 6880
99 Ga0070697_100520345 3300005536 Unclassified 1041
100 Ga0068853_100081640 3300005539 Bacteria 2831
101 Ga0068853_100134429 3300005539 Bacteria 2216
102 Ga0068853_101065761 3300005539 Unclassified 779
103 Ga0070672_100064445 3300005543 Bacteria 2895
104 Ga0070672_100270190 3300005543 Bacteria 1436
105 Ga0070672_100886365 3300005543 Unclassified 788
106 Ga0070686_100195860 3300005544 Unclassified 1445
107 Ga0070686_100204115 3300005544 Bacteria 1419
108 Ga0070695_100061187 3300005545 Bacteria 2442
109 Ga0070695_100101625 3300005545 Bacteria 1937
110 Ga0070695_100116478 3300005545 Bacteria 1822
111 Ga0070695_100171790 3300005545 Bacteria 1530
112 Ga0070695_100540210 3300005545 Unclassified 907
113 Ga0070693_100053496 3300005547 Bacteria 2318
114 Ga0070665_100518500 3300005548 Unclassified 1204
115 Ga0070665_100577714 3300005548 Unclassified 1137
116 Ga0070665_100824675 3300005548 Bacteria 941
117 Ga0070704_100031714 3300005549 Bacteria 3558
118 Ga0070704_100449215 3300005549 Bacteria 1110
119 Ga0070704_100528174 3300005549 Unclassified 1028
120 Ga0070704_100634157 3300005549 Bacteria 942
121 Ga0068855_100177337 3300005563 Bacteria 2410
122 Ga0068855_100944120 3300005563 Unclassified 909
123 Ga0068855_101150288 3300005563 Bacteria 809
124 Ga0070664_100013544 3300005564 Bacteria 6646
125 Ga0070664_100032057 3300005564 Bacteria 4395
126 Ga0070664_100516172 3300005564 Bacteria 1102
127 Ga0070664_100568493 3300005564 Bacteria 1050
128 Ga0068857_100007952 3300005577 Bacteria 9152
129 Ga0068857_100016923 3300005577 Bacteria 6387
130 Ga0068857_100923729 3300005577 Unclassified 837
131 Ga0068857_101008267 3300005577 Bacteria 802
132 Ga0068854_100090876 3300005578 Bacteria 2271
133 Ga0068854_101570610 3300005578 Unclassified 599
134 Ga0068856_100628014 3300005614 Unclassified 1095
135 Ga0070702_100090120 3300005615 Bacteria 1858
136 Ga0070702_100141136 3300005615 Unclassified 1534
137 Ga0070702_100162421 3300005615 Bacteria 1445
138 Ga0070702_100297918 3300005615 Bacteria 1114
139 Ga0068852_100050417 3300005616 Bacteria 3567
140 Ga0068852_100233904 3300005616 Bacteria 1753
141 Ga0068852_100633908 3300005616 Bacteria 1075
142 Ga0068859_100000008 3300005617 Bacteria 383750
143 Ga0068859_100033520 3300005617 Bacteria 5157
144 Ga0068859_100431910 3300005617 Bacteria 1413
145 Ga0068859_100478928 3300005617 Viruses 1340
146 Ga0068859_100575756 3300005617 Unclassified 1220
147 Ga0068859_100679790 3300005617 Unclassified 1121
148 Ga0068859_101147559 3300005617 Unclassified 855
149 Ga0068864_100446972 3300005618 Unclassified 1236
150 Ga0068864_100691084 3300005618 Unclassified 996
151 Ga0068866_10178994 3300005718 Bacteria 1251
152 Ga0068866_10283264 3300005718 Unclassified 1028
153 Ga0068851_10026842 3300005834 Bacteria 2833
154 Ga0068851_10283756 3300005834 Bacteria 948
155 Ga0068870_10004540 3300005840 Bacteria 5979
156 Ga0068870_10027409 3300005840 Unclassified 2849
157 Ga0068870_10059297 3300005840 Bacteria 2051
158 Ga0068870_10117667 3300005840 Bacteria 1526
159 Ga0068863_100057110 3300005841 Bacteria 3694
160 Ga0068863_100403919 3300005841 Bacteria 1336
161 Ga0068858_100046734 3300005842 Bacteria 4012
162 Ga0068858_100923910 3300005842 Unclassified 854
163 Ga0068860_100153379 3300005843 Bacteria 2219
164 Ga0068862_100011408 3300005844 Bacteria 7335
165 Ga0068862_100026926 3300005844 Bacteria 4836
166 Ga0068862_100038005 3300005844 Unclassified 4082
167 Ga0068862_100364910 3300005844 Bacteria 1343
168 Ga0068862_100872538 3300005844 Bacteria 883
169 Ga0081539_10070046 3300005985 Unclassified 1884
170 Ga0070715_10241101 3300006163 Unclassified 940
171 Ga0097621_100330325 3300006237 Bacteria 1352
172 Ga0097621_101078792 3300006237 Bacteria 753
173 Ga0075428_100086871 3300006844 Bacteria 3412
174 Ga0075428_100249216 3300006844 Bacteria 1914
175 Ga0075430_100026548 3300006846 Bacteria 4925
176 Ga0075430_100325328 3300006846 Unclassified 1271
177 Ga0075431_100433721 3300006847 Bacteria 1312
178 Ga0075433_10071295 3300006852 Bacteria 3054
179 Ga0075433_10119858 3300006852 Bacteria 2335
180 Ga0075433_10133519 3300006852 Bacteria 2206
181 Ga0075433_10139127 3300006852 Bacteria 2158
182 Ga0075433_10144212 3300006852 Bacteria 2117
183 Ga0075433_10206630 3300006852 Bacteria 1746
184 Ga0075434_100045624 3300006871 Bacteria 4348
185 Ga0068865_100175946 3300006881 Bacteria 1644
186 Ga0075436_100163705 3300006914 Unclassified 1569
187 Ga0097620_100000008 3300006931 Bacteria 383750
188 Ga0097620_100033520 3300006931 Bacteria 5157
189 Ga0097620_100431905 3300006931 Bacteria 1413
190 Ga0097620_100478933 3300006931 Viruses 1340
191 Ga0097620_100575762 3300006931 Unclassified 1220
192 Ga0097620_100679812 3300006931 Unclassified 1121
193 Ga0097620_101147759 3300006931 Unclassified 855
194 Ga0075435_100046653 3300007076 Bacteria 3476
195 Ga0075435_100108934 3300007076 Bacteria 2302
196 Ga0075435_100474146 3300007076 Bacteria 1081
197 Ga0111539_10340169 3300009094 Bacteria 1747
198 Ga0111539_10438206 3300009094 Unclassified 1521
199 Ga0105245_10084914 3300009098 Bacteria 2901
200 Ga0105245_10285287 3300009098 Unclassified 1615
201 Ga0114129_10083431 3300009147 Bacteria 4439
202 Ga0114129_10214774 3300009147 Bacteria 2598
203 Ga0114129_10224044 3300009147 Bacteria 2535
204 Ga0114129_10498085 3300009147 Unclassified 1592
205 Ga0114129_10535967 3300009147 Bacteria 1524
206 Ga0114129_11035790 3300009147 Unclassified 1031
207 Ga0105243_10181911 3300009148 Bacteria 1829
208 Ga0105243_10208103 3300009148 Bacteria 1720
209 Ga0105241_11178632 3300009174 Unclassified 725
210 Ga0105242_10357688 3300009176 Bacteria 1350
211 Ga0105248_10037060 3300009177 Bacteria 5453
212 Ga0105248_10447193 3300009177 Bacteria 1456
213 Ga0105248_10725795 3300009177 Unclassified 1121
214 Ga0105248_10746535 3300009177 Unclassified 1104
215 Ga0105237_10001794 3300009545 Bacteria 27716
216 Ga0105237_10285047 3300009545 Unclassified 1654
217 Ga0105237_10426297 3300009545 Bacteria 1332
218 Ga0105238_10437116 3300009551 Unclassified 1304
219 Ga0105249_10149648 3300009553 Bacteria 2246
220 Ga0105249_10194923 3300009553 Viruses 1979
221 Ga0105249_11015832 3300009553 Unclassified 898
222 Ga0105249_11508407 3300009553 Bacteria 744
223 Ga0105239_10290384 3300010375 Bacteria 1841
224 Ga0105246_10165363 3300011119 Bacteria 1689
225 Ga0105246_11082474 3300011119 Bacteria 731
226 Ga0157373_10009857 3300013100 Bacteria 7040
227 Ga0157373_10323786 3300013100 Unclassified 1097
228 Ga0157371_10062749 3300013102 Bacteria 2634
229 Ga0157378_10146941 3300013297 Unclassified 2194
230 Ga0163162_10015839 3300013306 Bacteria 7368
231 Ga0163162_10524005 3300013306 Unclassified 1314
232 Ga0163162_10633541 3300013306 Unclassified 1194
233 Ga0157372_10311545 3300013307 Unclassified 1832
234 Ga0157372_10761299 3300013307 Bacteria 1126
235 Ga0157375_10013805 3300013308 Bacteria 7198
236 Ga0157375_10218057 3300013308 Bacteria 2066
237 Ga0157375_10329789 3300013308 Bacteria 1691
238 Ga0157375_10958383 3300013308 Unclassified 997
239 Ga0163163_10663056 3300014325 Bacteria 1107
240 Ga0163163_11547798 3300014325 Bacteria 724
241 Ga0157380_10118883 3300014326 Bacteria 2235
242 Ga0157377_10011230 3300014745 Bacteria 4463
243 Ga0157377_10039909 3300014745 Bacteria 2598
244 Ga0157377_10260517 3300014745 Bacteria 1128
245 Ga0157379_10090094 3300014968 Bacteria 2752
246 Ga0163161_10046786 3300017792 Bacteria 3122
247 Ga0163161_10521641 3300017792 Unclassified 970
248 Ga0207697_10018330 3300025315 Bacteria 2871
249 Ga0207656_10046585 3300025321 Bacteria 1861
250 Ga0207656_10117583 3300025321 Bacteria 1235
251 Ga0207653_10000145 3300025885 Bacteria 50672
252 Ga0207653_10077371 3300025885 Bacteria 1146
253 Ga0207692_10294799 3300025898 Unclassified 985
254 Ga0207688_10019999 3300025901 Bacteria 3652
255 Ga0207688_10351266 3300025901 Bacteria 909
256 Ga0207647_10298913 3300025904 Bacteria 917
257 Ga0207699_10157979 3300025906 Bacteria 1507
258 Ga0207645_10021005 3300025907 Bacteria 4264
259 Ga0207645_10049806 3300025907 Bacteria 2675
260 Ga0207645_10142229 3300025907 Bacteria 1563
261 Ga0207643_10009667 3300025908 Bacteria 5177
262 Ga0207643_10011093 3300025908 Bacteria 4864
263 Ga0207643_10046729 3300025908 Bacteria 2447
264 Ga0207643_10179373 3300025908 Bacteria 1281
265 Ga0207705_10408172 3300025909 Unclassified 1051
266 Ga0207684_10000373 3300025910 Bacteria 60635
267 Ga0207654_10116876 3300025911 Bacteria 1668
268 Ga0207707_10012771 3300025912 Bacteria 7306
269 Ga0207707_10054039 3300025912 Unclassified 3496
270 Ga0207671_10001931 3300025914 Bacteria 22991
271 Ga0207671_10684101 3300025914 Bacteria 816
272 Ga0207660_10013333 3300025917 Bacteria 5386
273 Ga0207662_10010899 3300025918 Bacteria 5027
274 Ga0207662_10022319 3300025918 Bacteria 3628
275 Ga0207657_10040137 3300025919 Unclassified 4150
276 Ga0207657_10173124 3300025919 Unclassified 1748
277 Ga0207657_10415831 3300025919 Bacteria 1057
278 Ga0207649_10009285 3300025920 Bacteria 5380
279 Ga0207649_10116334 3300025920 Unclassified 1795
280 Ga0207649_10192460 3300025920 Bacteria 1436
281 Ga0207649_10563676 3300025920 Bacteria 873
282 Ga0207652_10022868 3300025921 Bacteria 5177
283 Ga0207652_10027256 3300025921 Bacteria 4760
284 Ga0207652_10142646 3300025921 Bacteria 2143
285 Ga0207652_10191874 3300025921 Bacteria 1838
286 Ga0207646_10123219 3300025922 Bacteria 2330
287 Ga0207650_10259075 3300025925 Bacteria 1410
288 Ga0207650_10316003 3300025925 Bacteria 1278
289 Ga0207650_10526737 3300025925 Bacteria 989
290 Ga0207650_10564211 3300025925 Bacteria 955
291 Ga0207659_10039991 3300025926 Bacteria 3275
292 Ga0207659_10234751 3300025926 Bacteria 1481
293 Ga0207659_10357033 3300025926 Bacteria 1214
294 Ga0207687_10314212 3300025927 Bacteria 1266
295 Ga0207700_10059055 3300025928 Bacteria 2900
296 Ga0207700_10225897 3300025928 Unclassified 1589
297 Ga0207644_10074552 3300025931 Bacteria 2491
298 Ga0207690_10018330 3300025932 Bacteria 4292
299 Ga0207690_10084220 3300025932 Unclassified 2228
300 Ga0207706_10000106 3300025933 Bacteria 88479
301 Ga0207706_10000983 3300025933 Bacteria 29009
302 Ga0207709_10348967 3300025935 Unclassified 1116
303 Ga0207670_10001641 3300025936 Bacteria 11673
304 Ga0207670_10014707 3300025936 Bacteria 4654
305 Ga0207670_10199380 3300025936 Bacteria 1520
306 Ga0207670_10265918 3300025936 Bacteria 1331
307 Ga0207704_10126919 3300025938 Bacteria 1758
308 Ga0207665_10966813 3300025939 Unclassified 677
309 Ga0207691_10047062 3300025940 Bacteria 3961
310 Ga0207691_10164910 3300025940 Bacteria 1942
311 Ga0207691_10231842 3300025940 Bacteria 1598
312 Ga0207711_10831726 3300025941 Bacteria 859
313 Ga0207689_10161136 3300025942 Bacteria 1848
314 Ga0207661_10094822 3300025944 Unclassified 2493
315 Ga0207661_10254564 3300025944 Bacteria 1562
316 Ga0207661_10368325 3300025944 Bacteria 1299
317 Ga0207679_10003611 3300025945 Bacteria 9599
318 Ga0207679_10075743 3300025945 Bacteria 2554
319 Ga0207679_10309417 3300025945 Bacteria 1364
320 Ga0207679_10672899 3300025945 Bacteria 938
321 Ga0207667_10123584 3300025949 Bacteria 2666
322 Ga0207651_10221521 3300025960 Bacteria 1530
323 Ga0207651_10240586 3300025960 Bacteria 1475
324 Ga0207651_10315341 3300025960 Bacteria 1305
325 Ga0207651_10337188 3300025960 Unclassified 1266
326 Ga0207712_10051477 3300025961 Bacteria 2881
327 Ga0207712_10126696 3300025961 Viruses 1939
328 Ga0207658_10088459 3300025986 Bacteria 2395
329 Ga0207658_10329802 3300025986 Bacteria 1323
330 Ga0207677_10018261 3300026023 Bacteria 4205
331 Ga0207677_10337847 3300026023 Bacteria 1257
332 Ga0207677_10783852 3300026023 Unclassified 852
333 Ga0207703_10231336 3300026035 Bacteria 1657
334 Ga0207703_10329406 3300026035 Unclassified 1400
335 Ga0207703_10440376 3300026035 Bacteria 1216
336 Ga0207639_10152370 3300026041 Bacteria 1938
337 Ga0207678_10111730 3300026067 Bacteria 2331
338 Ga0207708_10025835 3300026075 Bacteria 4444
339 Ga0207708_10042157 3300026075 Bacteria 3480
340 Ga0207708_10086449 3300026075 Unclassified 2413
341 Ga0207702_10439789 3300026078 Unclassified 1264
342 Ga0207641_10031858 3300026088 Bacteria 4374
343 Ga0207641_10121524 3300026088 Bacteria 2331
344 Ga0207648_10143560 3300026089 Bacteria 2105
345 Ga0207648_10405737 3300026089 Bacteria 1235
346 Ga0207648_10784802 3300026089 Unclassified 886
347 Ga0207648_10972172 3300026089 Unclassified 795
348 Ga0207674_10004134 3300026116 Bacteria 17556
349 Ga0207674_10007218 3300026116 Bacteria 12964
350 Ga0207674_10038565 3300026116 Bacteria 4956
351 Ga0207674_10070948 3300026116 Unclassified 3502
352 Ga0207674_10160958 3300026116 Bacteria 2199
353 Ga0207674_10415196 3300026116 Bacteria 1300
354 Ga0207683_10447648 3300026121 Bacteria 1191
355 Ga0207428_10208892 3300027907 Bacteria 1467
356 Ga0207428_10399909 3300027907 Unclassified 1006
357 Ga0268266_10312098 3300028379 Bacteria 1470
358 Ga0268266_10725973 3300028379 Unclassified 958
359 Ga0268265_10010129 3300028380 Bacteria 6366
360 Ga0268265_10017971 3300028380 Bacteria 4893
361 Ga0268265_10386874 3300028380 Unclassified 1288
362 Ga0268265_10709770 3300028380 Unclassified 972
363 Ga0268264_10045441 3300028381 Bacteria 3646
364 Ga0307408_100052227 3300031548 Bacteria 2948
365 Ga0307408_100664945 3300031548 Bacteria 933
366 Ga0307405_10173926 3300031731 Bacteria 1539
367 Ga0373944_0079076 3300035089 Unclassified 1083
368 Ga0373953_0000842 3300035117 Bacteria 8558
369 Ga0373954_0188489 3300035118 Bacteria 1012
370 Ga0373956_0001426 3300035119 Bacteria 9880
371 Ga0373957_0012485 3300035120 Bacteria 2862
372 Ga0373946_0084327 3300035171 Unclassified 1397
373 Ga0373955_0010721 3300035172 Bacteria 4340
374 Ga0373924_0003553 3300035410 Bacteria 5368
375 Ga0373935_0108939 3300035692 Unclassified 1836
376 Ga0373933_0001009 3300035724 Bacteria 17132
377 Ga0373937_0000510 3300036401 Bacteria 35064
378 Ga0373925_1283799 3300037068 Unclassified 601
379 Ga0395899_0063408 3300037312 Bacteria 2719
380 Ga0395899_0529137 3300037312 Unclassified 761
381 Ga0395900_0003127 3300037418 Bacteria 17965
382 Ga0395898_0388790 3300037466 Bacteria 1330
383 Ga0395905_0006233 3300037471 Bacteria 12042
384 Ga0436364_0878054 3300037853 Bacteria 1154
385 Ga0395901_0001184 3300038443 Bacteria 27748
386 Ga0395901_0971402 3300038443 Unclassified 827
387 Ga0453683_0031160 3300044673 Bacteria 3369
388 Ga0466960_0212521 3300044901 Bacteria 1061
389 Ga0451576_0052128 3300045051 Bacteria 4288
390 Ga0451576_0143394 3300045051 Bacteria 2491
391 Ga0451576_0197990 3300045051 Bacteria 2098
392 Ga0495592_0053617 3300046454 Bacteria 2990
393 Ga0495651_0005243 3300046462 Bacteria 9880
394 Ga0495653_0001660 3300046463 Bacteria 17478
395 Ga0495664_0150656 3300046477 Bacteria 1411
396 Ga0495608_0001052 3300046511 Bacteria 19458
397 Ga0495628_0008294 3300046516 Bacteria 8927
398 Ga0495630_0018037 3300046517 Bacteria 5179
399 Ga0495652_0016130 3300046529 Bacteria 6682
400 Ga0495665_0360992 3300046531 Unclassified 739
401 Ga0495586_0067532 3300046535 Bacteria 1950
402 Ga0495587_0000700 3300046536 Bacteria 22461
403 Ga0495645_0000169 3300046543 Bacteria 45526
404 Ga0495667_0000214 3300046559 Bacteria 38623
405 Ga0495635_0000227 3300046663 Bacteria 35707
406 Ga0495659_0278489 3300046664 Bacteria 702
407 Ga0495657_0006069 3300046675 Bacteria 9483
408 Ga0495599_0008760 3300046678 Bacteria 6159
409 Ga0495623_0002443 3300046679 Bacteria 12327
410 Ga0495646_0004391 3300046680 Bacteria 8882
411 Ga0495600_0007106 3300046809 Bacteria 6842
412 Ga0495604_0003806 3300047317 Bacteria 12012
413 Ga0495636_0095047 3300047318 Bacteria 1298
414 Ga0495674_0002242 3300047319 Bacteria 19001
415 Ga0495672_0136159 3300047320 Bacteria 1288
416 Ga0495680_0004335 3300047322 Bacteria 13591
417 Ga0495675_0003644 3300047444 Bacteria 9302
418 Ga0495684_0002785 3300047471 Bacteria 13796
419 Ga0495602_0002633 3300048088 Bacteria 18336
420 Ga0496100_0808126 3300048903 Bacteria 735
421 Ga0496102_1244507 3300048905 Unclassified 664
422 Ga0496104_0338412 3300048907 Bacteria 1418
423 Ga0496106_0052685 3300048909 Unclassified 3071
424 Ga0496108_0665833 3300048911 Unclassified 904
425 Ga0496109_0350749 3300048912 Unclassified 1394
426 Ga0496113_0117084 3300048916 Unclassified 2080
427 Ga0496114_1101107 3300048917 Unclassified 679
428 Ga0496114_1119922 3300048917 Unclassified 672
429 nmdc:mga05p37_117405_c1 3300050507 Bacteria 3270
430 nmdc:mga05p37_129888_c1 3300050507 Bacteria 3091
431 nmdc:mga05p37_200276_c1 3300050507 Bacteria 2419
432 nmdc:mga05p37_276992_c1 3300050507 Unclassified 2002
433 nmdc:mga05p37_28921_c1 3300050507 Bacteria 6761
434 nmdc:mga05p37_744095_c1 3300050507 Unclassified 1082
435 nmdc:mga09592_218360_c1 3300050508 Bacteria 1652
436 nmdc:mga0qj67_459505_c1 3300050509 Bacteria 1025
437 nmdc:mga06r32_414573_c1 3300050510 Bacteria 1328
438 nmdc:mga08y16_171384_c1 3300050511 Bacteria 2254
439 nmdc:mga08y16_57586_c1 3300050511 Bacteria 4060
440 nmdc:mga0n895_286577_c1 3300050512 Bacteria 1670
441 nmdc:mga0rr50_107786_c1 3300050513 Bacteria 2200
442 nmdc:mga0rr50_208747_c1 3300050513 Bacteria 1608
443 nmdc:mga0rr50_311231_c1 3300050513 Bacteria 1319
444 nmdc:mga0rr50_433989_c1 3300050513 Bacteria 1112
445 nmdc:mga0rr50_94561_c1 3300050513 Bacteria 2334
446 nmdc:mga08x19_189060_c1 3300050514 Unclassified 1408
447 nmdc:mga08x19_46468_c1 3300050514 Bacteria 2777
448 nmdc:mga08x19_883814_c1 3300050514 Bacteria 635
449 nmdc:mga0a205_175939_c1 3300050515 Bacteria 2035
450 nmdc:mga0a205_224754_c1 3300050515 Bacteria 1762
451 nmdc:mga0a205_22731_c1 3300050515 Bacteria 5944
452 nmdc:mga0a205_274877_c1 3300050515 Bacteria 1561
453 nmdc:mga0a205_322287_c1 3300050515 Unclassified 1416
454 Ga0495601_0005509 3300053077 Bacteria 7383
455 Ga0495619_0076712 3300053085 Bacteria 2244
456 Ga0501082_0767126 3300060353 Bacteria 844
457 Ga0070696_100000269
458 rootL2_10368023
459 Ga0065714_10208909
460 Ga0065704_10113351
461 Ga0065712_10017573
462 Ga0065712_10249836
463 Ga0065712_10326765
464 Ga0065715_10101792
465 Ga0065715_10159775
466 Ga0065707_10006644
467 Ga0065707_10251572
468 Ga0070658_10644257
469 Ga0070676_10003965
470 Ga0070676_10070996
471 Ga0070683_100038187
472 Ga0070683_100061067
473 Ga0070683_100203018
474 Ga0070683_100509540
475 Ga0070690_100049615
476 Ga0070690_100724134
477 Ga0070670_100133464
478 Ga0070670_100149643
479 Ga0070670_100283679
480 Ga0068869_100065837
481 Ga0068869_100242581
482 Ga0070680_100011532
483 Ga0070680_100201709
484 Ga0070682_100024180
485 Ga0068868_100325873
486 Ga0070660_100029368
487 Ga0070689_100000235
488 Ga0070689_100050999
489 Ga0070687_100033956
490 Ga0070661_100015244
491 Ga0070692_10002697
492 Ga0070692_10038943
493 Ga0070692_10048175
494 Ga0070668_100014283
495 Ga0070669_100055908
496 Ga0070669_100061072
497 Ga0070675_100045436
498 Ga0070675_100052646
499 Ga0070675_100193936
500 Ga0070675_100473624
501 Ga0070675_100628849
502 Ga0070671_100370092
503 Ga0070671_100405266
504 Ga0070671_100587438
505 Ga0070673_100042479
506 Ga0070673_100160870
507 Ga0070673_100490875
508 Ga0070673_100560901
509 Ga0070659_100021339
510 Ga0070667_100329741
511 Ga0070667_100416723
512 Ga0070667_100676530
513 Ga0070709_10046466
514 Ga0070709_10391525
515 Ga0070714_100090238
516 Ga0070713_100020404
517 Ga0070713_100991579
518 Ga0070710_10237182
519 Ga0070701_10045867
520 Ga0070701_10061625
521 Ga0070705_100048139
522 Ga0070700_100028651
523 Ga0070700_100089650
524 Ga0070694_100052322
525 Ga0070694_100626647
526 Ga0070694_100781605
527 Ga0070694_100884331
528 Ga0070663_100288665
529 Ga0070678_100317258
530 Ga0070662_100049134
531 Ga0070681_10004743
532 Ga0068867_100234763
533 Ga0068867_100335628
534 Ga0070685_10194000
535 Ga0070685_10584527
536 Ga0070706_100000833
537 Ga0070707_100172704
538 Ga0070698_100039877
539 Ga0070698_100087575
540 Ga0070698_100163220
541 Ga0070698_100209824
542 Ga0070699_100007212
543 Ga0070699_100062539
544 Ga0070699_100113502
545 Ga0070679_100006171
546 Ga0070679_100034233
547 Ga0070679_100232785
548 Ga0070679_100339756
549 Ga0070684_100011911
550 Ga0070684_100031124
551 Ga0070684_100703664
552 Ga0070684_100728027
553 Ga0070684_100836065
554 Ga0070697_100011627
555 Ga0070697_100520345
556 Ga0068853_100081640
557 Ga0068853_100134429
558 Ga0068853_101065761
559 Ga0070672_100064445
560 Ga0070672_100270190
561 Ga0070672_100886365
562 Ga0070686_100195860
563 Ga0070686_100204115
564 Ga0070695_100061187
565 Ga0070695_100101625
566 Ga0070695_100116478
567 Ga0070695_100171790
568 Ga0070695_100540210
569 Ga0070693_100053496
570 Ga0070665_100518500
571 Ga0070665_100577714
572 Ga0070665_100824675
573 Ga0070704_100031714
574 Ga0070704_100449215
575 Ga0070704_100528174
576 Ga0070704_100634157
577 Ga0068855_100177337
578 Ga0068855_100944120
579 Ga0068855_101150288
580 Ga0070664_100013544
581 Ga0070664_100032057
582 Ga0070664_100516172
583 Ga0070664_100568493
584 Ga0068857_100007952
585 Ga0068857_100016923
586 Ga0068857_100923729
587 Ga0068857_101008267
588 Ga0068854_100090876
589 Ga0068854_101570610
590 Ga0068856_100628014
591 Ga0070702_100090120
592 Ga0070702_100141136
593 Ga0070702_100162421
594 Ga0070702_100297918
595 Ga0068852_100050417
596 Ga0068852_100233904
597 Ga0068852_100633908
598 Ga0068859_100000008
599 Ga0068859_100033520
600 Ga0068859_100431910
601 Ga0068859_100478928
602 Ga0068859_100575756
603 Ga0068859_100679790
604 Ga0068859_101147559
605 Ga0068864_100446972
606 Ga0068864_100691084
607 Ga0068866_10178994
608 Ga0068866_10283264
609 Ga0068851_10026842
610 Ga0068851_10283756
611 Ga0068870_10004540
612 Ga0068870_10027409
613 Ga0068870_10059297
614 Ga0068870_10117667
615 Ga0068863_100057110
616 Ga0068863_100403919
617 Ga0068858_100046734
618 Ga0068858_100923910
619 Ga0068860_100153379
620 Ga0068862_100011408
621 Ga0068862_100026926
622 Ga0068862_100038005
623 Ga0068862_100364910
624 Ga0068862_100872538
625 Ga0081539_10070046
626 Ga0070715_10241101
627 Ga0097621_100330325
628 Ga0097621_101078792
629 Ga0075428_100086871
630 Ga0075428_100249216
631 Ga0075430_100026548
632 Ga0075430_100325328
633 Ga0075431_100433721
634 Ga0075433_10071295
635 Ga0075433_10119858
636 Ga0075433_10133519
637 Ga0075433_10139127
638 Ga0075433_10144212
639 Ga0075433_10206630
640 Ga0075434_100045624
641 Ga0068865_100175946
642 Ga0075436_100163705
643 Ga0097620_100000008
644 Ga0097620_100033520
645 Ga0097620_100431905
646 Ga0097620_100478933
647 Ga0097620_100575762
648 Ga0097620_100679812
649 Ga0097620_101147759
650 Ga0075435_100046653
651 Ga0075435_100108934
652 Ga0075435_100474146
653 Ga0111539_10340169
654 Ga0111539_10438206
655 Ga0105245_10084914
656 Ga0105245_10285287
657 Ga0114129_10083431
658 Ga0114129_10214774
659 Ga0114129_10224044
660 Ga0114129_10498085
661 Ga0114129_10535967
662 Ga0114129_11035790
663 Ga0105243_10181911
664 Ga0105243_10208103
665 Ga0105241_11178632
666 Ga0105242_10357688
667 Ga0105248_10037060
668 Ga0105248_10447193
669 Ga0105248_10725795
670 Ga0105248_10746535
671 Ga0105237_10001794
672 Ga0105237_10285047
673 Ga0105237_10426297
674 Ga0105238_10437116
675 Ga0105249_10149648
676 Ga0105249_10194923
677 Ga0105249_11015832
678 Ga0105249_11508407
679 Ga0105239_10290384
680 Ga0105246_10165363
681 Ga0105246_11082474
682 Ga0157373_10009857
683 Ga0157373_10323786
684 Ga0157371_10062749
685 Ga0157378_10146941
686 Ga0163162_10015839
687 Ga0163162_10524005
688 Ga0163162_10633541
689 Ga0157372_10311545
690 Ga0157372_10761299
691 Ga0157375_10013805
692 Ga0157375_10218057
693 Ga0157375_10329789
694 Ga0157375_10958383
695 Ga0163163_10663056
696 Ga0163163_11547798
697 Ga0157380_10118883
698 Ga0157377_10011230
699 Ga0157377_10039909
700 Ga0157377_10260517
701 Ga0157379_10090094
702 Ga0163161_10046786
703 Ga0163161_10521641
704 Ga0207697_10018330
705 Ga0207656_10046585
706 Ga0207656_10117583
707 Ga0207653_10000145
708 Ga0207653_10077371
709 Ga0207692_10294799
710 Ga0207688_10019999
711 Ga0207688_10351266
712 Ga0207647_10298913
713 Ga0207699_10157979
714 Ga0207645_10021005
715 Ga0207645_10049806
716 Ga0207645_10142229
717 Ga0207643_10009667
718 Ga0207643_10011093
719 Ga0207643_10046729
720 Ga0207643_10179373
721 Ga0207705_10408172
722 Ga0207684_10000373
723 Ga0207654_10116876
724 Ga0207707_10012771
725 Ga0207707_10054039
726 Ga0207671_10001931
727 Ga0207671_10684101
728 Ga0207660_10013333
729 Ga0207662_10010899
730 Ga0207662_10022319
731 Ga0207657_10040137
732 Ga0207657_10173124
733 Ga0207657_10415831
734 Ga0207649_10009285
735 Ga0207649_10116334
736 Ga0207649_10192460
737 Ga0207649_10563676
738 Ga0207652_10022868
739 Ga0207652_10027256
740 Ga0207652_10142646
741 Ga0207652_10191874
742 Ga0207646_10123219
743 Ga0207650_10259075
744 Ga0207650_10316003
745 Ga0207650_10526737
746 Ga0207650_10564211
747 Ga0207659_10039991
748 Ga0207659_10234751
749 Ga0207659_10357033
750 Ga0207687_10314212
751 Ga0207700_10059055
752 Ga0207700_10225897
753 Ga0207644_10074552
754 Ga0207690_10018330
755 Ga0207690_10084220
756 Ga0207706_10000106
757 Ga0207706_10000983
758 Ga0207709_10348967
759 Ga0207670_10001641
760 Ga0207670_10014707
761 Ga0207670_10199380
762 Ga0207670_10265918
763 Ga0207704_10126919
764 Ga0207665_10966813
765 Ga0207691_10047062
766 Ga0207691_10164910
767 Ga0207691_10231842
768 Ga0207711_10831726
769 Ga0207689_10161136
770 Ga0207661_10094822
771 Ga0207661_10254564
772 Ga0207661_10368325
773 Ga0207679_10003611
774 Ga0207679_10075743
775 Ga0207679_10309417
776 Ga0207679_10672899
777 Ga0207667_10123584
778 Ga0207651_10221521
779 Ga0207651_10240586
780 Ga0207651_10315341
781 Ga0207651_10337188
782 Ga0207712_10051477
783 Ga0207712_10126696
784 Ga0207658_10088459
785 Ga0207658_10329802
786 Ga0207677_10018261
787 Ga0207677_10337847
788 Ga0207677_10783852
789 Ga0207703_10231336
790 Ga0207703_10329406
791 Ga0207703_10440376
792 Ga0207639_10152370
793 Ga0207678_10111730
794 Ga0207708_10025835
795 Ga0207708_10042157
796 Ga0207708_10086449
797 Ga0207702_10439789
798 Ga0207641_10031858
799 Ga0207641_10121524
800 Ga0207648_10143560
801 Ga0207648_10405737
802 Ga0207648_10784802
803 Ga0207648_10972172
804 Ga0207674_10004134
805 Ga0207674_10007218
806 Ga0207674_10038565
807 Ga0207674_10070948
808 Ga0207674_10160958
809 Ga0207674_10415196
810 Ga0207683_10447648
811 Ga0207428_10208892
812 Ga0207428_10399909
813 Ga0268266_10312098
814 Ga0268266_10725973
815 Ga0268265_10010129
816 Ga0268265_10017971
817 Ga0268265_10386874
818 Ga0268265_10709770
819 Ga0268264_10045441
820 Ga0307408_100052227
821 Ga0307408_100664945
822 Ga0307405_10173926
823 Ga0373944_0079076
824 Ga0373953_0000842
825 Ga0373954_0188489
826 Ga0373956_0001426
827 Ga0373957_0012485
828 Ga0373946_0084327
829 Ga0373955_0010721
830 Ga0373924_0003553
831 Ga0373935_0108939
832 Ga0373933_0001009
833 Ga0373937_0000510
834 Ga0373925_1283799
835 Ga0395899_0063408
836 Ga0395899_0529137
837 Ga0395900_0003127
838 Ga0395898_0388790
839 Ga0395905_0006233
840 Ga0436364_0878054
841 Ga0395901_0001184
842 Ga0395901_0971402
843 Ga0453683_0031160
844 Ga0466960_0212521
845 Ga0451576_0052128
846 Ga0451576_0143394
847 Ga0451576_0197990
848 Ga0495592_0053617
849 Ga0495651_0005243
850 Ga0495653_0001660
851 Ga0495664_0150656
852 Ga0495608_0001052
853 Ga0495628_0008294
854 Ga0495630_0018037
855 Ga0495652_0016130
856 Ga0495665_0360992
857 Ga0495586_0067532
858 Ga0495587_0000700
859 Ga0495645_0000169
860 Ga0495667_0000214
861 Ga0495635_0000227
862 Ga0495659_0278489
863 Ga0495657_0006069
864 Ga0495599_0008760
865 Ga0495623_0002443
866 Ga0495646_0004391
867 Ga0495600_0007106
868 Ga0495604_0003806
869 Ga0495636_0095047
870 Ga0495674_0002242
871 Ga0495672_0136159
872 Ga0495680_0004335
873 Ga0495675_0003644
874 Ga0495684_0002785
875 Ga0495602_0002633
876 Ga0496100_0808126
877 Ga0496102_1244507
878 Ga0496104_0338412
879 Ga0496106_0052685
880 Ga0496108_0665833
881 Ga0496109_0350749
882 Ga0496113_0117084
883 Ga0496114_1101107
884 Ga0496114_1119922
885 nmdc:mga05p37_117405_c1
886 nmdc:mga05p37_129888_c1
887 nmdc:mga05p37_200276_c1
888 nmdc:mga05p37_276992_c1
889 nmdc:mga05p37_28921_c1
890 nmdc:mga05p37_744095_c1
891 nmdc:mga09592_218360_c1
892 nmdc:mga0qj67_459505_c1
893 nmdc:mga06r32_414573_c1
894 nmdc:mga08y16_171384_c1
895 nmdc:mga08y16_57586_c1
896 nmdc:mga0n895_286577_c1
897 nmdc:mga0rr50_107786_c1
898 nmdc:mga0rr50_208747_c1
899 nmdc:mga0rr50_311231_c1
900 nmdc:mga0rr50_433989_c1
901 nmdc:mga0rr50_94561_c1
902 nmdc:mga08x19_189060_c1
903 nmdc:mga08x19_46468_c1
904 nmdc:mga08x19_883814_c1
905 nmdc:mga0a205_175939_c1
906 nmdc:mga0a205_224754_c1
907 nmdc:mga0a205_22731_c1
908 nmdc:mga0a205_274877_c1
909 nmdc:mga0a205_322287_c1
910 Ga0495601_0005509
911 Ga0495619_0076712
912 Ga0501082_0767126

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

5

173

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8983 5 177
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8789 5 177
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8778 5 178
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8684 5 178
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.8667 4 179
ID Description Score Start End Superfamily
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8686 5 178 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8667 4 179 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.859 5 178 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8574 4 179 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.851 7 176 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A2V7QWQ4-F1-model_v4 Dihydrofolate reductase 0.9837 1 179 GO:0008703
GO:0009231
AF-A0A537IYY0-F1-model_v4 Dihydrofolate reductase 0.9831 1 133 GO:0008703
GO:0009231
AF-A0A2V7QWQ4-F1-model_v4 Dihydrofolate reductase 0.9676 1 179 GO:0008703
GO:0009231
AF-A0A2V7IGZ6-F1-model_v4 Dihydrofolate reductase 0.965 44 179 GO:0008703
GO:0009231
AF-A0A2V9MNX1-F1-model_v4 Dihydrofolate reductase 0.9561 4 179 GO:0008703
GO:0009231

Map