F447650

General Info

Members Datasets Scaffolds Average Seq Length
455 373 910 618

Family's Representative Sequence

Representative Sequence 3300046531|Ga0495665_0013662|Ga0495665_0013662_510_2408
Length 625
Sequence MSMEVTAWNAMYNAMHAQEDRRPFSRTTLRRIARFALPHRRSLGWYLLLSVVTAALAVATPVLAGRVVNAIVGGDAVSVVVRLAALIXXXAVLESALALWTRWLSASIGENLILDLRTAVFDHVQKMPIAFFTRTRTGALVSRLNNDVIGAQRAFSDTLSGVVSNLVTLGITLIVMVGISWQITLCALLLLPIFVLPARRMGARLAQLNREAANHNSVMSTQMTERFSAPGATLVKLFGRPSEESAEFAVRARRVRNIGVRTAMLQSVFVTALTLVVYGLGGFYALRGQLDAGAVVAMAMLLTRLYSPLTALASARMDVMSALVSFERVFEVLDLTPLIAEKPDAVAVPEGPVSVEFDSVEFAYPSADKVSLASLEEVATLDTRGGVDVLHRLSFRAEPGQMIALVGSSGAGKSTIAQLVPRLYDADAGSVRLGGVDVRDLTADSVRATVGMVTQDGHLFHDTVRANLLLARPGATRADLDEVLERARLTELVAALPDGLDTVVGERGYRLSGGERQRLTIARLLLAHPRVVILDEATAHLDSTSEAAVQEALGEALAGRTAVVIAHRLSTVRAADLILVVEAGRIVERGTHTELLAAGGRYEELYRTQFDTGTVSSPALTEVLR

Samples

Sample ID Description Type Environment
1 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
33 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
34 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
35 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
47 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
49 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
50 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
51 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
54 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
55 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
56 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
57 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
58 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
61 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
62 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
63 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
67 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
68 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
69 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
70 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
71 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
72 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
73 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
74 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
75 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
83 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
87 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
91 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
94 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
95 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
96 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
97 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
98 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
99 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
100 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
101 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
112 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
116 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
117 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
118 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
119 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
120 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
121 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
122 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
125 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
126 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
129 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
156 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
157 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
164 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
165 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
166 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
167 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
168 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
169 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
170 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
171 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
172 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
173 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
174 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
175 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
176 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
177 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
178 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
183 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
184 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
185 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
186 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
187 2547132424 Nocardia nova SH22a Isolate Unclassified
188 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
189 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
190 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
191 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
192 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
193 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
194 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
195 2643221548 Streptomyces sp. Root55 Isolate Unclassified
196 2643221576 Nocardioides sp. Root614 Isolate Unclassified
197 2643221578 Streptomyces sp. Root63 Isolate Unclassified
198 2643221590 Nocardioides sp. Root682 Isolate Unclassified
199 2643221617 Nocardioides sp. Root79 Isolate Unclassified
200 2643221620 Nocardioides sp. Root240 Isolate Unclassified
201 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
202 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
203 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
204 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
205 2643221692 Nocardia sp. Root136 Isolate Unclassified
206 2643221714 Streptomyces sp. Root264 Isolate Unclassified
207 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
208 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
209 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
210 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
211 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
212 2738541305 Nocardioides sp. CF167 Isolate Unclassified
213 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
214 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
215 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
216 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
217 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
218 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
219 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
220 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
221 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
222 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
223 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
224 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
225 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
226 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
227 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
228 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
229 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
230 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
231 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
232 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
233 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
234 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
235 2808606448 Streptomyces sp. 193411 Isolate Unclassified
236 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
237 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
238 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
239 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
240 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
241 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
242 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
243 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
244 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
245 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
246 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
247 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
248 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
249 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
250 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
251 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
252 2858882152 Micromonospora noduli MED15 Isolate Nodule
253 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
254 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
255 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
256 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
257 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
258 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
259 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
260 2862574272 Streptomyces sp. AcE210 Isolate Nodule
261 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
262 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
263 2867428634 Streptomyces sp. RP5T Isolate Unclassified
264 2867475112 Streptomyces sp. TM32 Isolate Unclassified
265 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
266 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
267 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
268 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
269 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
270 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
271 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
272 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
273 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
274 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
275 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
276 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
277 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
278 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
279 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
280 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
281 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
282 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
283 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
284 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
285 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
286 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
287 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
288 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
289 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
290 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
291 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
292 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
293 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
294 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
295 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
296 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
297 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
298 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
299 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
300 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
301 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
302 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
303 2922554459 Rhodococcus sp. 66b Isolate Unclassified
304 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
305 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
306 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
307 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
308 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
309 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
310 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
311 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
312 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
313 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
314 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
315 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
316 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
317 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
318 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
319 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
320 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
321 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
322 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
323 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
324 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
325 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
326 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
327 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
328 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
329 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
330 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
331 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
332 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
333 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
334 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
335 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
336 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
337 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
338 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
339 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
340 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
341 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
342 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
343 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
344 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
345 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
346 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
347 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
348 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
349 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
350 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
351 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
352 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
353 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
354 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
355 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
356 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
357 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
358 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
359 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
360 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
361 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
362 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
363 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
364 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
365 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
366 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
367 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
368 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
369 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
370 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
371 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
372 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
373 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 57.36
Metatranscriptomes 0
Isolates 42.64

Biome Distribution

Category Percentage (%)
Aerial Root 0.44
Bulb 0
Endosphere 5.05
Nodule 1.98
Rhizoplane 0.66
Rhizosphere 69.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495665_0013662 3300046531 Bacteria 4387
2 JGI24739J22299_10004493 3300001989 Bacteria 5336
3 Ga0070683_100003557 3300005329 Bacteria 12680
4 Ga0068869_100050311 3300005334 Bacteria 3020
5 Ga0068868_100041912 3300005338 Bacteria 3569
6 Ga0070668_100002469 3300005347 Bacteria 13618
7 Ga0070675_100005121 3300005354 Bacteria 10002
8 Ga0070675_100061344 3300005354 Bacteria 3105
9 Ga0070710_10000190 3300005437 Bacteria 28568
10 Ga0070710_10002043 3300005437 Bacteria 9561
11 Ga0070700_100002340 3300005441 Bacteria 9649
12 Ga0070700_100050975 3300005441 Bacteria 2575
13 Ga0070663_100009004 3300005455 Bacteria 6163
14 Ga0070681_10062879 3300005458 Bacteria 3685
15 Ga0070684_100044101 3300005535 Bacteria 3856
16 Ga0070696_100022726 3300005546 Bacteria 4262
17 Ga0070704_100066793 3300005549 Bacteria 2595
18 Ga0068857_100006018 3300005577 Bacteria 10360
19 Ga0068854_100043259 3300005578 Bacteria 3192
20 Ga0068852_100032388 3300005616 Bacteria 4328
21 Ga0068852_100080761 3300005616 Bacteria 2884
22 Ga0068851_10030006 3300005834 Bacteria 2694
23 Ga0068862_100049777 3300005844 Bacteria 3579
24 Ga0081455_10000154 3300005937 Bacteria 82712
25 Ga0081455_10020900 3300005937 Bacteria 6151
26 Ga0081538_10002665 3300005981 Bacteria 17218
27 Ga0075368_10016836 3300006042 Bacteria 2728
28 Ga0075367_10003498 3300006178 Bacteria 7499
29 Ga0075430_100053311 3300006846 Bacteria 3406
30 Ga0075430_100131971 3300006846 Bacteria 2082
31 Ga0075431_100010855 3300006847 Bacteria 9163
32 Ga0075431_100011918 3300006847 Bacteria 8772
33 Ga0075431_100037138 3300006847 Bacteria 5020
34 Ga0075431_100079610 3300006847 Bacteria 3382
35 Ga0075429_100013258 3300006880 Bacteria 7148
36 Ga0075429_100105368 3300006880 Bacteria 2463
37 Ga0105245_10001438 3300009098 Bacteria 21593
38 Ga0114129_10007962 3300009147 Bacteria 15086
39 Ga0105239_10092793 3300010375 Bacteria 3333
40 Ga0157370_10012121 3300013104 Bacteria 8968
41 Ga0157369_10031939 3300013105 Bacteria 5793
42 Ga0183367_1001 3300015688 Bacteria 1225545
43 Ga0209758_1009189 3300025297 Bacteria 6213
44 Ga0207426_1002455 3300025302 Bacteria 11801
45 Ga0207692_10000143 3300025898 Bacteria 22120
46 Ga0207692_10002030 3300025898 Bacteria 7723
47 Ga0207688_10009338 3300025901 Bacteria 5347
48 Ga0207707_10043662 3300025912 Bacteria 3909
49 Ga0207687_10106705 3300025927 Bacteria 2071
50 Ga0207706_10120917 3300025933 Bacteria 2302
51 Ga0207689_10013800 3300025942 Bacteria 6885
52 Ga0207689_10016095 3300025942 Bacteria 6330
53 Ga0207679_10008725 3300025945 Bacteria 6467
54 Ga0207678_10056873 3300026067 Bacteria 3366
55 Ga0207708_10015356 3300026075 Bacteria 5744
56 Ga0207708_10071043 3300026075 Bacteria 2666
57 Ga0207708_10092695 3300026075 Bacteria 2331
58 Ga0207674_10010600 3300026116 Bacteria 10428
59 Ga0207674_10034355 3300026116 Bacteria 5302
60 Ga0207675_100042184 3300026118 Bacteria 4258
61 Ga0207675_100113274 3300026118 Bacteria 2561
62 Ga0209813_10013513 3300027866 Bacteria 2182
63 Ga0268265_10020631 3300028380 Bacteria 4602
64 Ga0307515_10000146 3300028794 Bacteria 170674
65 Ga0307515_10108683 3300028794 Bacteria 3265
66 Ga0307515_10181153 3300028794 Bacteria 2056
67 Ga0307511_10002049 3300030521 Bacteria 21100
68 Ga0307512_10001417 3300030522 Bacteria 34111
69 Ga0316180_1089130 3300030736 Bacteria 2955
70 Ga0265327_10000004 3300031251 Bacteria 803973
71 Ga0265327_10007149 3300031251 Bacteria 8707
72 Ga0307513_10005359 3300031456 Bacteria 16958
73 Ga0307513_10016837 3300031456 Bacteria 8795
74 Ga0307513_10088308 3300031456 Bacteria 3169
75 Ga0307509_10006530 3300031507 Bacteria 15634
76 Ga0307508_10001267 3300031616 Bacteria 28767
77 Ga0307508_10017950 3300031616 Bacteria 6429
78 Ga0307508_10040231 3300031616 Bacteria 4198
79 Ga0307508_10083803 3300031616 Bacteria 2770
80 Ga0307516_10013181 3300031730 Bacteria 8827
81 Ga0307516_10049204 3300031730 Bacteria 4144
82 Ga0307516_10057710 3300031730 Bacteria 3780
83 Ga0307413_10016199 3300031824 Bacteria 3842
84 Ga0307409_100005448 3300031995 Bacteria 7328
85 Ga0307409_100013611 3300031995 Bacteria 5247
86 Ga0307416_100057023 3300032002 Bacteria 3157
87 Ga0307416_100065136 3300032002 Bacteria 2993
88 Ga0307411_10104133 3300032005 Bacteria 2014
89 Ga0307415_100007697 3300032126 Bacteria 5916
90 Ga0307415_100022964 3300032126 Bacteria 3862
91 Ga0307507_10010610 3300033179 Bacteria 11858
92 Ga0307507_10012866 3300033179 Bacteria 10265
93 Ga0307510_10019295 3300033180 Bacteria 8000
94 Ga0395900_0024976 3300037418 Bacteria 6115
95 Ga0395898_0014869 3300037466 Bacteria 7989
96 Ga0395898_0037154 3300037466 Bacteria 4833
97 Ga0451853_0416102 3300041512 Bacteria 5829
98 Ga0439433_0000129 3300041999 Bacteria 11061
99 Ga0439448_0002000 3300042005 Bacteria 5448
100 Ga0439457_000042 3300042014 Bacteria 26881
101 Ga0450894_000006 3300042131 Bacteria 27729
102 Ga0450898_000062 3300042134 Bacteria 9359
103 Ga0450903_000031 3300042138 Bacteria 28230
104 Ga0450906_000767 3300042145 Bacteria 6986
105 Ga0466972_0006439 3300044658 Bacteria 5898
106 Ga0466972_0012305 3300044658 Bacteria 4300
107 Ga0466972_0014626 3300044658 Bacteria 3928
108 Ga0466965_0001102 3300044683 Bacteria 10527
109 Ga0466965_0002758 3300044683 Bacteria 7541
110 Ga0466966_0005811 3300044684 Bacteria 8133
111 Ga0466961_0002252 3300044693 Bacteria 11994
112 Ga0466963_0001442 3300044694 Bacteria 12805
113 Ga0466971_0000376 3300044719 Bacteria 17124
114 Ga0466970_0000235 3300044765 Bacteria 27066
115 Ga0466970_0006990 3300044765 Bacteria 5652
116 Ga0466957_0006086 3300044842 Bacteria 6810
117 Ga0466960_0034420 3300044901 Bacteria 2360
118 Ga0466959_0000228 3300045049 Bacteria 35389
119 Ga0466958_0007319 3300045836 Bacteria 6064
120 Ga0466967_0005028 3300045976 Bacteria 9061
121 Ga0466967_0143628 3300045976 Bacteria 2225
122 Ga0495592_0006709 3300046454 Bacteria 8587
123 Ga0495592_0021814 3300046454 Bacteria 4872
124 Ga0495603_0000249 3300046455 Bacteria 28144
125 Ga0495603_0003289 3300046455 Bacteria 9620
126 Ga0495603_0003791 3300046455 Bacteria 8997
127 Ga0495629_0007673 3300046459 Bacteria 7943
128 Ga0495629_0007675 3300046459 Bacteria 7941
129 Ga0495629_0031004 3300046459 Bacteria 3787
130 Ga0495629_0038449 3300046459 Bacteria 3370
131 Ga0495629_0050084 3300046459 Bacteria 2926
132 Ga0495651_0000902 3300046462 Bacteria 23044
133 Ga0495651_0003698 3300046462 Bacteria 11721
134 Ga0495653_0004438 3300046463 Bacteria 11331
135 Ga0495653_0009499 3300046463 Bacteria 7960
136 Ga0495662_0000318 3300046476 Bacteria 20980
137 Ga0495662_0002844 3300046476 Bacteria 8752
138 Ga0495664_0000319 3300046477 Bacteria 23147
139 Ga0495583_0008909 3300046506 Bacteria 6063
140 Ga0495606_0003153 3300046507 Bacteria 17851
141 Ga0495606_0003687 3300046507 Bacteria 16021
142 Ga0495608_0006386 3300046511 Bacteria 8366
143 Ga0495616_0009190 3300046513 Bacteria 5798
144 Ga0495620_0002530 3300046515 Bacteria 10585
145 Ga0495630_0042292 3300046517 Bacteria 3403
146 Ga0495631_0012744 3300046518 Bacteria 4097
147 Ga0495643_0006030 3300046522 Bacteria 8085
148 Ga0495648_0044756 3300046524 Bacteria 2760
149 Ga0495640_0004865 3300046533 Bacteria 10684
150 Ga0495587_0002853 3300046536 Bacteria 11582
151 Ga0495645_0008511 3300046543 Bacteria 7166
152 Ga0495645_0009458 3300046543 Bacteria 6807
153 Ga0495645_0049278 3300046543 Bacteria 3067
154 Ga0495667_0041617 3300046559 Bacteria 3047
155 Ga0495668_0000349 3300046616 Bacteria 61429
156 Ga0495634_0001575 3300046642 Bacteria 20069
157 Ga0495634_0039331 3300046642 Bacteria 3220
158 Ga0495625_0002961 3300046660 Bacteria 17661
159 Ga0495625_0005060 3300046660 Bacteria 12203
160 Ga0495588_0010863 3300046674 Bacteria 4254
161 Ga0495588_0011696 3300046674 Bacteria 4124
162 Ga0495657_0000666 3300046675 Bacteria 31065
163 Ga0495657_0007885 3300046675 Bacteria 8171
164 Ga0495623_0015470 3300046679 Bacteria 4932
165 Ga0495646_0001333 3300046680 Bacteria 14574
166 Ga0495646_0031889 3300046680 Bacteria 3281
167 Ga0495658_0061879 3300046683 Bacteria 2150
168 Ga0495613_0005488 3300046689 Bacteria 9528
169 Ga0495613_0009961 3300046689 Bacteria 7062
170 Ga0495613_0018227 3300046689 Bacteria 5235
171 Ga0495613_0019086 3300046689 Bacteria 5110
172 Ga0495613_0044653 3300046689 Bacteria 3277
173 Ga0495613_0073229 3300046689 Bacteria 2496
174 Ga0495613_0099317 3300046689 Bacteria 2103
175 Ga0495670_0024728 3300046691 Bacteria 2969
176 Ga0495671_0006565 3300046692 Bacteria 6707
177 Ga0495589_0007273 3300046794 Bacteria 5797
178 Ga0495581_0004972 3300047315 Bacteria 7695
179 Ga0495581_0006006 3300047315 Bacteria 7038
180 Ga0495604_0000508 3300047317 Bacteria 34206
181 Ga0495604_0000748 3300047317 Bacteria 27300
182 Ga0495636_0001063 3300047318 Bacteria 10328
183 Ga0495636_0001726 3300047318 Bacteria 8342
184 Ga0495676_0043985 3300047321 Bacteria 3649
185 Ga0495687_000309 3300047443 Bacteria 63997
186 Ga0495687_036362 3300047443 Bacteria 2204
187 Ga0495675_0003441 3300047444 Bacteria 9533
188 Ga0495675_0011089 3300047444 Bacteria 5650
189 Ga0495685_000630 3300047447 Bacteria 10794
190 Ga0495685_005716 3300047447 Bacteria 4065
191 Ga0495681_0003886 3300047470 Bacteria 10307
192 Ga0495681_0005414 3300047470 Bacteria 8550
193 Ga0495593_0001397 3300047673 Bacteria 14124
194 Ga0495593_0040579 3300047673 Bacteria 2505
195 Ga0495602_0043983 3300048088 Bacteria 4054
196 Ga0495614_0016851 3300048089 Bacteria 3178
197 Ga0495614_0018621 3300048089 Bacteria 3007
198 Ga0495626_0000427 3300048091 Bacteria 43189
199 Ga0496108_0026235 3300048911 Bacteria 4805
200 Ga0496114_0147483 3300048917 Bacteria 2040
201 Ga0501031_0010615 3300049568 Bacteria 5998
202 Ga0501032_0014542 3300049569 Bacteria 5573
203 Ga0501032_0025736 3300049569 Bacteria 4056
204 Ga0501033_0001296 3300049570 Bacteria 22234
205 Ga0501034_0000825 3300049571 Bacteria 46038
206 Ga0501036_0003460 3300049572 Bacteria 12620
207 Ga0501036_0006555 3300049572 Bacteria 9456
208 Ga0501036_0010478 3300049572 Bacteria 7657
209 Ga0501037_0057829 3300049573 Bacteria 2830
210 Ga0501038_0034880 3300049574 Bacteria 4421
211 Ga0501039_0012895 3300049575 Bacteria 6392
212 Ga0501039_0032091 3300049575 Bacteria 4049
213 Ga0501040_0026023 3300049576 Bacteria 3936
214 Ga0501042_0003569 3300049578 Bacteria 9800
215 Ga0501043_0000723 3300049579 Bacteria 29237
216 Ga0501048_0007345 3300049582 Bacteria 8354
217 Ga0501048_0020087 3300049582 Bacteria 4900
218 Ga0501067_0016597 3300049583 Bacteria 4069
219 Ga0501070_0002571 3300049586 Bacteria 15885
220 Ga0501071_0103688 3300049587 Bacteria 2099
221 Ga0501074_0001600 3300049590 Bacteria 15356
222 Ga0501075_0011809 3300049591 Bacteria 6193
223 Ga0501076_0021992 3300049592 Bacteria 4898
224 Ga0501076_0039915 3300049592 Bacteria 3687
225 Ga0501077_0007491 3300049593 Bacteria 6734
226 Ga0501079_0015783 3300049741 Bacteria 5770
227 Ga0501080_0057592 3300049742 Bacteria 3618
228 Ga0501081_0025335 3300049743 Bacteria 3990
229 Ga0501035_0012131 3300049822 Bacteria 7969
230 Ga0501035_0014078 3300049822 Bacteria 7378
231 Ga0501045_0070892 3300049824 Bacteria 2564
232 nmdc:mga06z11_2691_c1 3300050494 Bacteria 6802
233 nmdc:mga04h51_13333_c1 3300050495 Bacteria 2325
234 nmdc:mga05p37_40274_c1 3300050507 Bacteria 5737
235 nmdc:mga09592_9629_c1 3300050508 Bacteria 7851
236 nmdc:mga0qj67_38703_c1 3300050509 Bacteria 3742
237 nmdc:mga0qj67_7502_c1 3300050509 Bacteria 8056
238 nmdc:mga0qj67_77301_c1 3300050509 Bacteria 2663
239 nmdc:mga06r32_110802_c1 3300050510 Bacteria 2701
240 nmdc:mga06r32_2152_c1 3300050510 Bacteria 17619
241 nmdc:mga08y16_2613_c1 3300050511 Bacteria 18493
242 Ga0500610_0009869 3300053079 Bacteria 4263
243 Ga0500640_029500 3300053095 Bacteria 2399
244 Ga0500641_0002437 3300053096 Bacteria 6592
245 Ga0500654_030119 3300053099 Bacteria 3281
246 Ga0500660_036491 3300053100 Bacteria 2531
247 Ga0500569_006493 3300053109 Bacteria 2571
248 Ga0500652_011765 3300053131 Bacteria 3044
249 Ga0500658_0021482 3300053134 Bacteria 2445
250 Ga0500559_0007128 3300053136 Bacteria 4983
251 Ga0500561_0001117 3300053137 Bacteria 4331
252 Ga0500568_0000069 3300053139 Bacteria 99921
253 Ga0500573_0007622 3300053140 Bacteria 5915
254 Ga0500600_0012558 3300053149 Bacteria 5141
255 Ga0500633_0001760 3300053160 Bacteria 4227
256 Ga0500634_0012627 3300053161 Bacteria 4406
257 Ga0500587_001243 3300053739 Bacteria 3552
258 Ga0501084_0022019 3300054114 Bacteria 5317
259 Ga0501082_0022323 3300060353 Bacteria 5452
260 Ga0466962_0000713 3300061719 Bacteria 14809
261 Ga0530510_0045581 3300061734 Bacteria 3168
262 2515851782 2515154155 Bacteria 7985436
263 2523382774 2523231044 Bacteria 6434991
264 2537898928 2537561592 Bacteria 4348607
265 2547412354 2547132111 Bacteria 8013147
266 2548699834 2547132424 Bacteria 8348532
267 2552111718 2551306166 Bacteria 9731570
268 2566997424 2565956761 Bacteria 6601618
269 2585296778 2582581312 Bacteria 7308206
270 2585304274 2582581313 Bacteria 10042643
271 2585314902 2582581314 Bacteria 11452267
272 2616698843 2616644814 Bacteria 11555299
273 2616900555 2616644941 Bacteria 8510691
274 2643762249 2643221548 Bacteria 8053412
275 2643888865 2643221576 Bacteria 5214352
276 2643898921 2643221578 Bacteria 9213798
277 2643957920 2643221590 Bacteria 5214697
278 2644098524 2643221617 Bacteria 5139111
279 2644114618 2643221620 Bacteria 5134593
280 2644403519 2643221673 Bacteria 9196637
281 2644440814 2643221678 Bacteria 9540101
282 2644458972 2643221682 Bacteria 6743283
283 2644486817 2643221687 Bacteria 6500351
284 2644518066 2643221692 Bacteria 7282860
285 2644631554 2643221714 Bacteria 9015452
286 2645722613 2643221961 Bacteria 3919167
287 2645725577 2643221962 Bacteria 3874254
288 2676475035 2675903058 Bacteria 6822861
289 2676490654 2675903060 Bacteria 10051191
290 2731907019 2731639228 Bacteria 4187555
291 2738869793 2738541305 Bacteria 4910150
292 2739235958 2738543011 Bacteria 5731169
293 2739365039 2738543034 Bacteria 6084756
294 2744953756 2744054611 Bacteria 5611514
295 2753037320 2751185725 Bacteria 5740550
296 2753073519 2751185734 Bacteria 8863695
297 2753074950 2751185734 Bacteria 8863695
298 2753303264 2751185788 Bacteria 4541048
299 2753325189 2751185792 Bacteria 5739090
300 2772645980 2772190715 Bacteria 6959372
301 2784592025 2784132148 Bacteria 8627943
302 2785339694 2784746763 Bacteria 9783172
303 2785373344 2784746768 Bacteria 10036182
304 2786674645 2786546132 Bacteria 10419719
305 2791914724 2791354901 Bacteria 8322202
306 2793979993 2791355406 Bacteria 11364898
307 2799183924 2799112218 Bacteria 4315149
308 2804843441 2802429296 Bacteria 7227771
309 2808830065 2808606357 Bacteria 4466944
310 2808845452 2808606359 Bacteria 9866990
311 2808851241 2808606360 Bacteria 4404006
312 2808876234 2808606366 Bacteria 4415912
313 2808897737 2808606371 Bacteria 4251511
314 2808915163 2808606375 Bacteria 9466072
315 2809235658 2808606448 Bacteria 8656184
316 2810363154 2808606700 Bacteria 3482157
317 2811846318 2808606982 Bacteria 7791042
318 2812318159 2811994871 Bacteria 4497550
319 2812332500 2811994874 Bacteria 5367947
320 2812354294 2811994879 Bacteria 9313447
321 2812482879 2811994917 Bacteria 7761064
322 2816425760 2816332119 Bacteria 8120218
323 2816504829 2816332139 Bacteria 9138787
324 2819699507 2818991463 Bacteria 7948711
325 2827630795 2827628540 Bacteria 6858585
326 2852635917 2852635781 Bacteria 8251373
327 2852679751 2852677369 Bacteria 3768884
328 2855670935 2855670206 Bacteria 7120389
329 2855681247 2855676851 Bacteria 7063653
330 2857294011 2857288857 Bacteria 7189066
331 2858851828 2858848962 Bacteria 6963058
332 2858882675 2858882152 Bacteria 7230291
333 2858894849 2858888857 Bacteria 7060307
334 2858899841 2858895516 Bacteria 7378898
335 2862180799 2862178590 Bacteria 8583590
336 2862282924 2862281513 Bacteria 9621493
337 2862296717 2862290372 Bacteria 7471434
338 2862386732 2862382967 Bacteria 10317375
339 2862512263 2862507626 Bacteria 9425308
340 2862575292 2862574272 Bacteria 10567477
341 2862995118 2862993130 Bacteria 3860849
342 2863410386 2863404153 Bacteria 9672205
343 2867437476 2867428634 Bacteria 9590268
344 2867480280 2867475112 Bacteria 6909112
345 2868088575 2868088558 Bacteria 7609351
346 2869052357 2869048445 Bacteria 6875584
347 2869066822 2869061728 Bacteria 7112407
348 2869075052 2869068681 Bacteria 7205615
349 2870725691 2870721527 Bacteria 9689237
350 2870725935 2870721527 Bacteria 9689237
351 2873152525 2873151551 Bacteria 8625867
352 2873319170 2873314349 Bacteria 8512634
353 2875392235 2875391855 Bacteria 7600475
354 2877677566 2877676314 Bacteria 9512378
355 2880490720 2880489317 Bacteria 7096270
356 2880501860 2880495981 Bacteria 7340502
357 2884703649 2884693830 Bacteria 11273186
358 2887486790 2887478801 Bacteria 8972725
359 2889305556 2889300758 Bacteria 5690814
360 2891330316 2891326441 Bacteria 6439512
361 2893685641 2893684298 Bacteria 2897960
362 2895435241 2895427314 Bacteria 13147766
363 2895447361 2895442618 Bacteria 11027144
364 2902797394 2902792274 Bacteria 7270173
365 2902843087 2902837492 Bacteria 6697721
366 2904504478 2904501621 Bacteria 3401437
367 2904768873 2904765812 Bacteria 5369154
368 2904771838 2904770941 Bacteria 5580202
369 2905928641 2905926851 Bacteria 4423176
370 2908676701 2908674828 Bacteria 3382763
371 2908812934 2908811453 Bacteria 5478616
372 2909077538 2909074476 Bacteria 3436050
373 2912715830 2912715099 Bacteria 9460473
374 2912728819 2912723979 Bacteria 8557534
375 2912758003 2912757875 Bacteria 7940295
376 2919035564 2919034639 Bacteria 4763403
377 2919041573 2919039151 Bacteria 3391018
378 2919054905 2919051321 Bacteria 4210889
379 2919395355 2919391150 Bacteria 4884741
380 2919422231 2919420072 Bacteria 5390363
381 2919434211 2919432681 Bacteria 5390474
382 2919472821 2919468124 Bacteria 9133025
383 2919539218 2919538618 Bacteria 4677069
384 2922557545 2922554459 Bacteria 6683962
385 2928105992 2928104781 Bacteria 3877447
386 2928502819 2928500415 Bacteria 3384541
387 2929217721 2929212328 Bacteria 7708288
388 2929221678 2929219909 Bacteria 6984360
389 2929230346 2929226422 Bacteria 7248583
390 2932399736 2932398195 Bacteria 3847976
391 2939584946 2939582691 Bacteria 7088898
392 2939599368 2939598168 Bacteria 4687164
393 2939650254 2939647034 Bacteria 4681660
394 2939663582 2939660829 Bacteria 3784848
395 2939743692 2939743619 Bacteria 5762299
396 2945944457 2945941187 Bacteria 4682474
397 2946003379 2946003308 Bacteria 3857229
398 2946040375 2946037020 Bacteria 4900426
399 2946052643 2946045630 Bacteria 8527308
400 2946071405 2946064051 Bacteria 8957905
401 2946079251 2946072368 Bacteria 8999607
402 2947225316 2947224130 Bacteria 9938529
403 2954009481 2954002825 Bacteria 9173742
404 2954382328 2954380949 Bacteria 10050426
405 2954680758 2954673503 Bacteria 9685905
406 2954683395 2954682443 Bacteria 9862841
407 2954693143 2954691527 Bacteria 10720516
408 2954708241 2954701450 Bacteria 10834262
409 2954712809 2954711539 Bacteria 10867210
410 2954722767 2954721474 Bacteria 10456478
411 2954739061 2954731030 Bacteria 10243860
412 2954741678 2954740390 Bacteria 10229294
413 2954757920 2954749733 Bacteria 10366972
414 2954760658 2954759201 Bacteria 9358192
415 2964328821 2964326757 Bacteria 3290868
416 2966599671 2966598605 Bacteria 7676064
417 2966925253 2966924647 Bacteria 3268643
418 2974319955 2974315732 Bacteria 4602776
419 2984523824 2984523437 Bacteria 4508481
420 2984551656 2984551494 Bacteria 3877562
421 2990059922 2990059506 Bacteria 9321252
422 2997451961 2997451912 Bacteria 8492419
423 2997605710 2997600082 Bacteria 9896405
424 3003007509 3002998708 Bacteria 11715108
425 3006427188 3006425503 Bacteria 6491253
426 3006494527 3006493962 Bacteria 8825450
427 8003875519 8003870546 Bacteria 7396674
428 8004022457 8004021418 Bacteria 4313954
429 8004026918 8004025490 Bacteria 4327753
430 8008564343 8008558824 Bacteria 10610750
431 8008575767 8008574985 Bacteria 7815457
432 8023625614 8023623736 Bacteria 8593882
433 8025418595 8025413630 Bacteria 7014048
434 8025485656 8025478263 Bacteria 8209203
435 8025534005 8025530807 Bacteria 8495698
436 8033689182 8033684223 Bacteria 6906479
437 8047716580 8047710418 Bacteria 11023148
438 8047720229 8047710418 Bacteria 11023148
439 8047894811 8047893842 Bacteria 11723082
440 8048131460 8048127548 Bacteria 11053136
441 8048364238 8048356638 Bacteria 11044339
442 8048371830 8048369669 Bacteria 11666822
443 8048380763 8048379754 Bacteria 11877923
444 8048411576 8048406513 Bacteria 8936924
445 8053949133 8053945823 Bacteria 8962862
446 8054109699 8054107350 Bacteria 5022511
447 8054162691 8054160619 Bacteria 7783213
448 8054705705 8054704163 Bacteria 7247792
449 8054733847 8054727385 Bacteria 7558670
450 8054735434 8054734606 Bacteria 6947278
451 8055071288 8055066027 Bacteria 9479577
452 8055176742 8055172936 Bacteria 9305943
453 8055414285 8055412473 Bacteria 6257500
454 8056452625 8056447290 Bacteria 7680491
455 8056836215 8056829672 Bacteria 9045328
456 Ga0495665_0013662
457 JGI24739J22299_10004493
458 Ga0070683_100003557
459 Ga0068869_100050311
460 Ga0068868_100041912
461 Ga0070668_100002469
462 Ga0070675_100005121
463 Ga0070675_100061344
464 Ga0070710_10000190
465 Ga0070710_10002043
466 Ga0070700_100002340
467 Ga0070700_100050975
468 Ga0070663_100009004
469 Ga0070681_10062879
470 Ga0070684_100044101
471 Ga0070696_100022726
472 Ga0070704_100066793
473 Ga0068857_100006018
474 Ga0068854_100043259
475 Ga0068852_100032388
476 Ga0068852_100080761
477 Ga0068851_10030006
478 Ga0068862_100049777
479 Ga0081455_10000154
480 Ga0081455_10020900
481 Ga0081538_10002665
482 Ga0075368_10016836
483 Ga0075367_10003498
484 Ga0075430_100053311
485 Ga0075430_100131971
486 Ga0075431_100010855
487 Ga0075431_100011918
488 Ga0075431_100037138
489 Ga0075431_100079610
490 Ga0075429_100013258
491 Ga0075429_100105368
492 Ga0105245_10001438
493 Ga0114129_10007962
494 Ga0105239_10092793
495 Ga0157370_10012121
496 Ga0157369_10031939
497 Ga0183367_1001
498 Ga0209758_1009189
499 Ga0207426_1002455
500 Ga0207692_10000143
501 Ga0207692_10002030
502 Ga0207688_10009338
503 Ga0207707_10043662
504 Ga0207687_10106705
505 Ga0207706_10120917
506 Ga0207689_10013800
507 Ga0207689_10016095
508 Ga0207679_10008725
509 Ga0207678_10056873
510 Ga0207708_10015356
511 Ga0207708_10071043
512 Ga0207708_10092695
513 Ga0207674_10010600
514 Ga0207674_10034355
515 Ga0207675_100042184
516 Ga0207675_100113274
517 Ga0209813_10013513
518 Ga0268265_10020631
519 Ga0307515_10000146
520 Ga0307515_10108683
521 Ga0307515_10181153
522 Ga0307511_10002049
523 Ga0307512_10001417
524 Ga0316180_1089130
525 Ga0265327_10000004
526 Ga0265327_10007149
527 Ga0307513_10005359
528 Ga0307513_10016837
529 Ga0307513_10088308
530 Ga0307509_10006530
531 Ga0307508_10001267
532 Ga0307508_10017950
533 Ga0307508_10040231
534 Ga0307508_10083803
535 Ga0307516_10013181
536 Ga0307516_10049204
537 Ga0307516_10057710
538 Ga0307413_10016199
539 Ga0307409_100005448
540 Ga0307409_100013611
541 Ga0307416_100057023
542 Ga0307416_100065136
543 Ga0307411_10104133
544 Ga0307415_100007697
545 Ga0307415_100022964
546 Ga0307507_10010610
547 Ga0307507_10012866
548 Ga0307510_10019295
549 Ga0395900_0024976
550 Ga0395898_0014869
551 Ga0395898_0037154
552 Ga0451853_0416102
553 Ga0439433_0000129
554 Ga0439448_0002000
555 Ga0439457_000042
556 Ga0450894_000006
557 Ga0450898_000062
558 Ga0450903_000031
559 Ga0450906_000767
560 Ga0466972_0006439
561 Ga0466972_0012305
562 Ga0466972_0014626
563 Ga0466965_0001102
564 Ga0466965_0002758
565 Ga0466966_0005811
566 Ga0466961_0002252
567 Ga0466963_0001442
568 Ga0466971_0000376
569 Ga0466970_0000235
570 Ga0466970_0006990
571 Ga0466957_0006086
572 Ga0466960_0034420
573 Ga0466959_0000228
574 Ga0466958_0007319
575 Ga0466967_0005028
576 Ga0466967_0143628
577 Ga0495592_0006709
578 Ga0495592_0021814
579 Ga0495603_0000249
580 Ga0495603_0003289
581 Ga0495603_0003791
582 Ga0495629_0007673
583 Ga0495629_0007675
584 Ga0495629_0031004
585 Ga0495629_0038449
586 Ga0495629_0050084
587 Ga0495651_0000902
588 Ga0495651_0003698
589 Ga0495653_0004438
590 Ga0495653_0009499
591 Ga0495662_0000318
592 Ga0495662_0002844
593 Ga0495664_0000319
594 Ga0495583_0008909
595 Ga0495606_0003153
596 Ga0495606_0003687
597 Ga0495608_0006386
598 Ga0495616_0009190
599 Ga0495620_0002530
600 Ga0495630_0042292
601 Ga0495631_0012744
602 Ga0495643_0006030
603 Ga0495648_0044756
604 Ga0495640_0004865
605 Ga0495587_0002853
606 Ga0495645_0008511
607 Ga0495645_0009458
608 Ga0495645_0049278
609 Ga0495667_0041617
610 Ga0495668_0000349
611 Ga0495634_0001575
612 Ga0495634_0039331
613 Ga0495625_0002961
614 Ga0495625_0005060
615 Ga0495588_0010863
616 Ga0495588_0011696
617 Ga0495657_0000666
618 Ga0495657_0007885
619 Ga0495623_0015470
620 Ga0495646_0001333
621 Ga0495646_0031889
622 Ga0495658_0061879
623 Ga0495613_0005488
624 Ga0495613_0009961
625 Ga0495613_0018227
626 Ga0495613_0019086
627 Ga0495613_0044653
628 Ga0495613_0073229
629 Ga0495613_0099317
630 Ga0495670_0024728
631 Ga0495671_0006565
632 Ga0495589_0007273
633 Ga0495581_0004972
634 Ga0495581_0006006
635 Ga0495604_0000508
636 Ga0495604_0000748
637 Ga0495636_0001063
638 Ga0495636_0001726
639 Ga0495676_0043985
640 Ga0495687_000309
641 Ga0495687_036362
642 Ga0495675_0003441
643 Ga0495675_0011089
644 Ga0495685_000630
645 Ga0495685_005716
646 Ga0495681_0003886
647 Ga0495681_0005414
648 Ga0495593_0001397
649 Ga0495593_0040579
650 Ga0495602_0043983
651 Ga0495614_0016851
652 Ga0495614_0018621
653 Ga0495626_0000427
654 Ga0496108_0026235
655 Ga0496114_0147483
656 Ga0501031_0010615
657 Ga0501032_0014542
658 Ga0501032_0025736
659 Ga0501033_0001296
660 Ga0501034_0000825
661 Ga0501036_0003460
662 Ga0501036_0006555
663 Ga0501036_0010478
664 Ga0501037_0057829
665 Ga0501038_0034880
666 Ga0501039_0012895
667 Ga0501039_0032091
668 Ga0501040_0026023
669 Ga0501042_0003569
670 Ga0501043_0000723
671 Ga0501048_0007345
672 Ga0501048_0020087
673 Ga0501067_0016597
674 Ga0501070_0002571
675 Ga0501071_0103688
676 Ga0501074_0001600
677 Ga0501075_0011809
678 Ga0501076_0021992
679 Ga0501076_0039915
680 Ga0501077_0007491
681 Ga0501079_0015783
682 Ga0501080_0057592
683 Ga0501081_0025335
684 Ga0501035_0012131
685 Ga0501035_0014078
686 Ga0501045_0070892
687 nmdc:mga06z11_2691_c1
688 nmdc:mga04h51_13333_c1
689 nmdc:mga05p37_40274_c1
690 nmdc:mga09592_9629_c1
691 nmdc:mga0qj67_38703_c1
692 nmdc:mga0qj67_7502_c1
693 nmdc:mga0qj67_77301_c1
694 nmdc:mga06r32_110802_c1
695 nmdc:mga06r32_2152_c1
696 nmdc:mga08y16_2613_c1
697 Ga0500610_0009869
698 Ga0500640_029500
699 Ga0500641_0002437
700 Ga0500654_030119
701 Ga0500660_036491
702 Ga0500569_006493
703 Ga0500652_011765
704 Ga0500658_0021482
705 Ga0500559_0007128
706 Ga0500561_0001117
707 Ga0500568_0000069
708 Ga0500573_0007622
709 Ga0500600_0012558
710 Ga0500633_0001760
711 Ga0500634_0012627
712 Ga0500587_001243
713 Ga0501084_0022019
714 Ga0501082_0022323
715 Ga0466962_0000713
716 Ga0530510_0045581
717 2515851782
718 2523382774
719 2537898928
720 2547412354
721 2548699834
722 2552111718
723 2566997424
724 2585296778
725 2585304274
726 2585314902
727 2616698843
728 2616900555
729 2643762249
730 2643888865
731 2643898921
732 2643957920
733 2644098524
734 2644114618
735 2644403519
736 2644440814
737 2644458972
738 2644486817
739 2644518066
740 2644631554
741 2645722613
742 2645725577
743 2676475035
744 2676490654
745 2731907019
746 2738869793
747 2739235958
748 2739365039
749 2744953756
750 2753037320
751 2753073519
752 2753074950
753 2753303264
754 2753325189
755 2772645980
756 2784592025
757 2785339694
758 2785373344
759 2786674645
760 2791914724
761 2793979993
762 2799183924
763 2804843441
764 2808830065
765 2808845452
766 2808851241
767 2808876234
768 2808897737
769 2808915163
770 2809235658
771 2810363154
772 2811846318
773 2812318159
774 2812332500
775 2812354294
776 2812482879
777 2816425760
778 2816504829
779 2819699507
780 2827630795
781 2852635917
782 2852679751
783 2855670935
784 2855681247
785 2857294011
786 2858851828
787 2858882675
788 2858894849
789 2858899841
790 2862180799
791 2862282924
792 2862296717
793 2862386732
794 2862512263
795 2862575292
796 2862995118
797 2863410386
798 2867437476
799 2867480280
800 2868088575
801 2869052357
802 2869066822
803 2869075052
804 2870725691
805 2870725935
806 2873152525
807 2873319170
808 2875392235
809 2877677566
810 2880490720
811 2880501860
812 2884703649
813 2887486790
814 2889305556
815 2891330316
816 2893685641
817 2895435241
818 2895447361
819 2902797394
820 2902843087
821 2904504478
822 2904768873
823 2904771838
824 2905928641
825 2908676701
826 2908812934
827 2909077538
828 2912715830
829 2912728819
830 2912758003
831 2919035564
832 2919041573
833 2919054905
834 2919395355
835 2919422231
836 2919434211
837 2919472821
838 2919539218
839 2922557545
840 2928105992
841 2928502819
842 2929217721
843 2929221678
844 2929230346
845 2932399736
846 2939584946
847 2939599368
848 2939650254
849 2939663582
850 2939743692
851 2945944457
852 2946003379
853 2946040375
854 2946052643
855 2946071405
856 2946079251
857 2947225316
858 2954009481
859 2954382328
860 2954680758
861 2954683395
862 2954693143
863 2954708241
864 2954712809
865 2954722767
866 2954739061
867 2954741678
868 2954757920
869 2954760658
870 2964328821
871 2966599671
872 2966925253
873 2974319955
874 2984523824
875 2984551656
876 2990059922
877 2997451961
878 2997605710
879 3003007509
880 3006427188
881 3006494527
882 8003875519
883 8004022457
884 8004026918
885 8008564343
886 8008575767
887 8023625614
888 8025418595
889 8025485656
890 8025534005
891 8033689182
892 8047716580
893 8047720229
894 8047894811
895 8048131460
896 8048364238
897 8048371830
898 8048380763
899 8048411576
900 8053949133
901 8054109699
902 8054162691
903 8054705705
904 8054733847
905 8054735434
906 8055071288
907 8055176742
908 8055414285
909 8056452625
910 8056836215

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

390

539

0.96

PF00664

ABC_membrane

ABC transporter transmembrane region

43

309

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ghi-assembly3.cif.gz_C crystal structure of plasmodium yoelii multidrug resistance protein 2 0.9503 347 604
2ghi-assembly4.cif.gz_D crystal structure of plasmodium yoelii multidrug resistance protein 2 0.9499 347 604
4q7l-assembly3.cif.gz_C structure of nbd288 of tm287/288 0.9454 349 607
2ghi-assembly2.cif.gz_B crystal structure of plasmodium yoelii multidrug resistance protein 2 0.9377 347 604
4q7l-assembly2.cif.gz_B structure of nbd288 of tm287/288 0.9359 348 606
ID Description Score Start End Superfamily
af_Q19015_1020_1270_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9555 388 607 3.40.50.300
af_P0AAG5_335_579_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9549 344 606 3.40.50.300
af_Q2FVJ2_326_574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9544 341 609 3.40.50.300
af_Q2FVJ2_326_574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9507 341 609 3.40.50.300
2ghiC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9503 347 604 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3D3GPI7-F1-model_v4 ABC transporter domain-containing protein 0.9777 395 604 GO:0005524
GO:0016887
GO:0034040
AF-A0A7V9FMT5-F1-model_v4 ATP-binding cassette domain-containing protein 0.9756 384 606 GO:0005524
GO:0016887
GO:0034040
AF-A0A847KX24-F1-model_v4 deleted 0.9682 395 604
AF-A0A6I5CFE6-F1-model_v4 ATP-binding cassette domain-containing protein 0.9659 398 597 GO:0005524
GO:0016887
GO:0034040
AF-A0A7Y4NIU2-F1-model_v4 ATP-binding cassette domain-containing protein 0.9597 413 606 GO:0005524
GO:0015421
GO:0016887
GO:0090374

Map