F447627

General Info

Members Datasets Scaffolds Average Seq Length
455 233 908 151

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0329238|Ga0436363_0329238_459_1010
Length 183
Sequence MKFHLDYWAGGGIVRVMMVTPVPELAQHHSRGVRMARRSFLRQMMALPLLSALGSIAQTPARKSLNIMMKSAWGSDDPTKAAFPFLHGLALSEAGHSVQIFLLGEAVSLMRKSVAAAVVPVGWPPLEQTMTKVAERHVQIYACGACSRARSVSQPDLDHWGAKFGNPTIFVSLVEWSDRVITE

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
98 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
99 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
161 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
175 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.49
Rhizosphere 93.19
Stem 0
Stem Tuber 0
Unclassified 23.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_0329238 3300039450 Bacteria 1322
2 JGI25405J52794_10046934 3300003911 Unclassified 921
3 Ga0065704_10372184 3300005289 Unclassified 758
4 Ga0065715_10000762 3300005293 Bacteria 12324
5 Ga0065715_10062580 3300005293 Bacteria 730
6 Ga0070676_10003493 3300005328 Bacteria 8199
7 Ga0070690_100004458 3300005330 Bacteria 7777
8 Ga0070690_100032809 3300005330 Unclassified 3246
9 Ga0070677_10295208 3300005333 Bacteria 821
10 Ga0068869_100026785 3300005334 Unclassified 4014
11 Ga0068869_100739590 3300005334 Bacteria 841
12 Ga0070680_100076767 3300005336 Bacteria 2750
13 Ga0070682_101255890 3300005337 Bacteria 627
14 Ga0068868_100795883 3300005338 Unclassified 853
15 Ga0068868_101990338 3300005338 Unclassified 551
16 Ga0070660_100669666 3300005339 Bacteria 869
17 Ga0070660_101410923 3300005339 Bacteria 592
18 Ga0070691_10019405 3300005341 Bacteria 3138
19 Ga0070661_100931974 3300005344 Unclassified 718
20 Ga0070668_100125633 3300005347 Unclassified 2054
21 Ga0070668_101109085 3300005347 Bacteria 714
22 Ga0070669_100039099 3300005353 Bacteria 3446
23 Ga0070669_100090512 3300005353 Bacteria 2293
24 Ga0070669_100284709 3300005353 Bacteria 1325
25 Ga0070675_100224021 3300005354 Unclassified 1638
26 Ga0070671_100046506 3300005355 Bacteria 3609
27 Ga0070671_100927214 3300005355 Bacteria 761
28 Ga0070674_100000122 3300005356 Bacteria 35444
29 Ga0070674_100002931 3300005356 Bacteria 9454
30 Ga0070673_100089275 3300005364 Bacteria 2516
31 Ga0070688_100776211 3300005365 Unclassified 748
32 Ga0070667_100010375 3300005367 Bacteria 7692
33 Ga0070709_10028182 3300005434 Bacteria 3347
34 Ga0070709_10090272 3300005434 Bacteria 2019
35 Ga0070709_10325149 3300005434 Unclassified 1130
36 Ga0070709_10453556 3300005434 Unclassified 966
37 Ga0070709_11600421 3300005434 Bacteria 530
38 Ga0070714_100330540 3300005435 Bacteria 1427
39 Ga0070714_100344158 3300005435 Bacteria 1399
40 Ga0070714_100417080 3300005435 Bacteria 1271
41 Ga0070713_100000463 3300005436 Bacteria 25909
42 Ga0070713_100233598 3300005436 Bacteria 1672
43 Ga0070713_100426373 3300005436 Unclassified 1242
44 Ga0070713_100663942 3300005436 Unclassified 993
45 Ga0070713_100748324 3300005436 Unclassified 935
46 Ga0070710_10331615 3300005437 Unclassified 1002
47 Ga0070710_10332692 3300005437 Unclassified 1000
48 Ga0070711_100005724 3300005439 Bacteria 7453
49 Ga0070711_100065707 3300005439 Bacteria 2538
50 Ga0070711_100086119 3300005439 Unclassified 2252
51 Ga0070711_100142217 3300005439 Bacteria 1800
52 Ga0070711_100269702 3300005439 Bacteria 1342
53 Ga0070711_100889582 3300005439 Unclassified 759
54 Ga0070711_101135698 3300005439 Bacteria 674
55 Ga0070705_100021443 3300005440 Bacteria 3437
56 Ga0070705_100054007 3300005440 Bacteria 2354
57 Ga0070705_101436698 3300005440 Unclassified 576
58 Ga0070700_100873655 3300005441 Bacteria 730
59 Ga0070694_100006701 3300005444 Bacteria 6996
60 Ga0070708_100395652 3300005445 Unclassified 1303
61 Ga0070708_100464422 3300005445 Bacteria 1194
62 Ga0070708_100642441 3300005445 Unclassified 1000
63 Ga0070663_100097100 3300005455 Bacteria 2193
64 Ga0070678_100010504 3300005456 Bacteria 5663
65 Ga0070662_100019144 3300005457 Bacteria 4643
66 Ga0070662_100085760 3300005457 Bacteria 2354
67 Ga0070662_100190074 3300005457 Bacteria 1623
68 Ga0068867_100006784 3300005459 Bacteria 8094
69 Ga0070685_10102691 3300005466 Bacteria 1748
70 Ga0070706_100070919 3300005467 Bacteria 3223
71 Ga0070707_100019163 3300005468 Bacteria 6445
72 Ga0070707_100053046 3300005468 Bacteria 3887
73 Ga0070698_100020845 3300005471 Bacteria 6869
74 Ga0070699_100026245 3300005518 Bacteria 5025
75 Ga0070679_100463859 3300005530 Bacteria 1211
76 Ga0070684_101405975 3300005535 Unclassified 657
77 Ga0070697_100039547 3300005536 Bacteria 3813
78 Ga0070697_100124086 3300005536 Bacteria 2162
79 Ga0068853_100045511 3300005539 Bacteria 3758
80 Ga0068853_101051799 3300005539 Bacteria 784
81 Ga0070672_100006835 3300005543 Bacteria 7702
82 Ga0070672_100462058 3300005543 Bacteria 1094
83 Ga0070695_100182254 3300005545 Bacteria 1489
84 Ga0070696_100075141 3300005546 Bacteria 2383
85 Ga0070696_100105897 3300005546 Bacteria 2021
86 Ga0070665_100794325 3300005548 Bacteria 959
87 Ga0070665_100805063 3300005548 Unclassified 953
88 Ga0070704_101516792 3300005549 Bacteria 617
89 Ga0070704_101545722 3300005549 Bacteria 611
90 Ga0068855_100090849 3300005563 Unclassified 3523
91 Ga0068855_100417428 3300005563 Bacteria 1468
92 Ga0070664_100853136 3300005564 Bacteria 853
93 Ga0068854_100031139 3300005578 Bacteria 3705
94 Ga0068856_100359866 3300005614 Bacteria 1474
95 Ga0068856_101653841 3300005614 Bacteria 653
96 Ga0070702_100002809 3300005615 Bacteria 7632
97 Ga0068852_100085268 3300005616 Bacteria 2814
98 Ga0068859_100697970 3300005617 Bacteria 1105
99 Ga0068864_100773511 3300005618 Bacteria 942
100 Ga0068866_10415315 3300005718 Bacteria 871
101 Ga0068861_100171472 3300005719 Bacteria 1799
102 Ga0068858_100081549 3300005842 Unclassified 3006
103 Ga0068858_100528197 3300005842 Bacteria 1141
104 Ga0068858_100781002 3300005842 Unclassified 931
105 Ga0068860_100152405 3300005843 Bacteria 2226
106 Ga0068860_100383775 3300005843 Unclassified 1387
107 Ga0068860_100544621 3300005843 Bacteria 1162
108 Ga0068860_102042645 3300005843 Unclassified 595
109 Ga0068862_100165817 3300005844 Bacteria 1974
110 Ga0081455_10000920 3300005937 Bacteria 37814
111 Ga0081540_1010850 3300005983 Bacteria 6123
112 Ga0081540_1032059 3300005983 Bacteria 2875
113 Ga0070717_10050649 3300006028 Bacteria 3414
114 Ga0070717_10143913 3300006028 Bacteria 2058
115 Ga0070717_10293906 3300006028 Bacteria 1443
116 Ga0070717_10409733 3300006028 Bacteria 1218
117 Ga0070717_10552545 3300006028 Bacteria 1043
118 Ga0070717_10560011 3300006028 Unclassified 1035
119 Ga0070717_10685112 3300006028 Unclassified 931
120 Ga0070715_10043002 3300006163 Bacteria 1902
121 Ga0070715_10126109 3300006163 Unclassified 1226
122 Ga0070715_10194038 3300006163 Bacteria 1027
123 Ga0070716_100015912 3300006173 Bacteria 3875
124 Ga0070716_100070529 3300006173 Unclassified 2052
125 Ga0070716_100212855 3300006173 Bacteria 1293
126 Ga0070716_100633463 3300006173 Bacteria 808
127 Ga0070712_100001174 3300006175 Bacteria 15837
128 Ga0070712_100001549 3300006175 Bacteria 14055
129 Ga0070712_100366750 3300006175 Bacteria 1182
130 Ga0070712_100958531 3300006175 Unclassified 739
131 Ga0097621_100830896 3300006237 Bacteria 857
132 Ga0068871_100098223 3300006358 Bacteria 2449
133 Ga0068871_100688623 3300006358 Bacteria 936
134 Ga0068871_101016678 3300006358 Unclassified 772
135 Ga0068871_101531176 3300006358 Unclassified 630
136 Ga0075434_100863064 3300006871 Bacteria 920
137 Ga0068865_100000836 3300006881 Bacteria 17383
138 Ga0068865_100091234 3300006881 Bacteria 2211
139 Ga0097620_100064369 3300006931 Bacteria 3699
140 Ga0097620_100359624 3300006931 Bacteria 1551
141 Ga0097620_100697961 3300006931 Bacteria 1105
142 Ga0099795_10080569 3300007788 Unclassified 1245
143 Ga0105240_10012016 3300009093 Bacteria 12002
144 Ga0105240_10074506 3300009093 Bacteria 4189
145 Ga0105240_10180284 3300009093 Bacteria 2493
146 Ga0111539_10349126 3300009094 Bacteria 1722
147 Ga0111539_11239245 3300009094 Bacteria 866
148 Ga0105245_10017463 3300009098 Bacteria 6259
149 Ga0105245_10051587 3300009098 Bacteria 3687
150 Ga0105245_10908228 3300009098 Unclassified 922
151 Ga0105247_10146241 3300009101 Unclassified 1553
152 Ga0114129_10153813 3300009147 Bacteria 3147
153 Ga0114129_10349097 3300009147 Bacteria 1960
154 Ga0114129_10375253 3300009147 Bacteria 1879
155 Ga0105243_10081301 3300009148 Bacteria 2645
156 Ga0105243_10589385 3300009148 Bacteria 1068
157 Ga0105241_10080194 3300009174 Bacteria 2554
158 Ga0105241_10414688 3300009174 Bacteria 1184
159 Ga0105248_10022430 3300009177 Bacteria 7002
160 Ga0105248_10160392 3300009177 Bacteria 2537
161 Ga0105248_10742925 3300009177 Bacteria 1107
162 Ga0105248_10798613 3300009177 Bacteria 1065
163 Ga0105248_12719142 3300009177 Unclassified 564
164 Ga0105237_10509443 3300009545 Bacteria 1210
165 Ga0105237_10703745 3300009545 Unclassified 1017
166 Ga0105238_10053578 3300009551 Bacteria 4053
167 Ga0105238_10859903 3300009551 Unclassified 924
168 Ga0105239_10002419 3300010375 Bacteria 23767
169 Ga0105239_10037905 3300010375 Bacteria 5282
170 Ga0105239_10186595 3300010375 Bacteria 2321
171 Ga0105239_11183572 3300010375 Unclassified 881
172 Ga0157373_10772989 3300013100 Bacteria 707
173 Ga0157371_10098910 3300013102 Bacteria 2069
174 Ga0157369_11019441 3300013105 Bacteria 847
175 Ga0157369_11775762 3300013105 Unclassified 626
176 Ga0157374_10110665 3300013296 Bacteria 2642
177 Ga0157374_10125278 3300013296 Bacteria 2483
178 Ga0157374_10171719 3300013296 Bacteria 2115
179 Ga0157374_10265586 3300013296 Bacteria 1691
180 Ga0157378_10013603 3300013297 Bacteria 7116
181 Ga0157378_10033488 3300013297 Bacteria 4543
182 Ga0157378_10161563 3300013297 Unclassified 2095
183 Ga0157378_10642917 3300013297 Bacteria 1076
184 Ga0163162_10045207 3300013306 Bacteria 4411
185 Ga0157372_10231438 3300013307 Bacteria 2143
186 Ga0157372_10607804 3300013307 Bacteria 1274
187 Ga0157375_10137903 3300013308 Bacteria 2564
188 Ga0157379_10440273 3300014968 Unclassified 1202
189 Ga0157379_10798118 3300014968 Unclassified 891
190 Ga0157379_10866959 3300014968 Bacteria 855
191 Ga0157376_10029591 3300014969 Bacteria 4363
192 Ga0157376_10199469 3300014969 Bacteria 1840
193 Ga0157376_10272223 3300014969 Bacteria 1591
194 Ga0163161_10053712 3300017792 Unclassified 2922
195 Ga0213874_10028812 3300021377 Unclassified 1589
196 Ga0228598_1002617 3300024227 Bacteria 3905
197 Ga0207666_1001211 3300025271 Bacteria 3030
198 Ga0207697_10000987 3300025315 Bacteria 15911
199 Ga0207656_10054736 3300025321 Bacteria 1735
200 Ga0207692_10032422 3300025898 Bacteria 2511
201 Ga0207692_10036565 3300025898 Bacteria 2396
202 Ga0207692_10187263 3300025898 Bacteria 1209
203 Ga0207642_10540894 3300025899 Bacteria 718
204 Ga0207688_10001855 3300025901 Bacteria 11313
205 Ga0207647_10022404 3300025904 Bacteria 4196
206 Ga0207685_10157875 3300025905 Bacteria 1033
207 Ga0207699_10011604 3300025906 Bacteria 4457
208 Ga0207699_10024127 3300025906 Bacteria 3321
209 Ga0207699_10046404 3300025906 Bacteria 2541
210 Ga0207699_10089873 3300025906 Bacteria 1926
211 Ga0207699_10167968 3300025906 Unclassified 1466
212 Ga0207645_10000408 3300025907 Bacteria 35564
213 Ga0207645_10002727 3300025907 Bacteria 13752
214 Ga0207684_10007014 3300025910 Bacteria 10189
215 Ga0207684_10064050 3300025910 Bacteria 3121
216 Ga0207684_10180990 3300025910 Bacteria 1818
217 Ga0207684_10368732 3300025910 Unclassified 1235
218 Ga0207684_10867131 3300025910 Bacteria 760
219 Ga0207654_10071219 3300025911 Bacteria 2066
220 Ga0207654_10124768 3300025911 Bacteria 1622
221 Ga0207695_10002957 3300025913 Bacteria 24506
222 Ga0207695_10107291 3300025913 Bacteria 2778
223 Ga0207693_10000005 3300025915 Bacteria 186314
224 Ga0207693_10007694 3300025915 Bacteria 8847
225 Ga0207693_10011252 3300025915 Bacteria 7241
226 Ga0207693_10033315 3300025915 Bacteria 4065
227 Ga0207693_10670707 3300025915 Unclassified 804
228 Ga0207693_10772714 3300025915 Bacteria 741
229 Ga0207663_10004118 3300025916 Bacteria 7208
230 Ga0207663_10019614 3300025916 Bacteria 3814
231 Ga0207663_10039342 3300025916 Bacteria 2864
232 Ga0207663_10089974 3300025916 Bacteria 2034
233 Ga0207663_10489569 3300025916 Bacteria 954
234 Ga0207652_10383618 3300025921 Bacteria 1268
235 Ga0207646_10030790 3300025922 Bacteria 4861
236 Ga0207646_10035848 3300025922 Bacteria 4479
237 Ga0207646_10123684 3300025922 Bacteria 2325
238 Ga0207646_10241045 3300025922 Unclassified 1633
239 Ga0207646_10342359 3300025922 Bacteria 1351
240 Ga0207681_10103213 3300025923 Bacteria 2060
241 Ga0207681_10139407 3300025923 Bacteria 1804
242 Ga0207681_10217657 3300025923 Bacteria 1476
243 Ga0207694_10003512 3300025924 Bacteria 12443
244 Ga0207694_10063677 3300025924 Unclassified 2873
245 Ga0207659_10879957 3300025926 Unclassified 770
246 Ga0207687_10130398 3300025927 Bacteria 1894
247 Ga0207687_10206601 3300025927 Bacteria 1538
248 Ga0207687_10688836 3300025927 Bacteria 867
249 Ga0207687_11487879 3300025927 Unclassified 582
250 Ga0207700_10009249 3300025928 Bacteria 6147
251 Ga0207700_10482026 3300025928 Bacteria 1096
252 Ga0207700_10852039 3300025928 Bacteria 815
253 Ga0207664_10057266 3300025929 Unclassified 3098
254 Ga0207664_10250894 3300025929 Bacteria 1544
255 Ga0207664_10334057 3300025929 Bacteria 1339
256 Ga0207664_10611307 3300025929 Unclassified 979
257 Ga0207664_10623729 3300025929 Unclassified 969
258 Ga0207644_10199521 3300025931 Bacteria 1577
259 Ga0207644_10268302 3300025931 Bacteria 1367
260 Ga0207644_10805855 3300025931 Bacteria 785
261 Ga0207706_10005023 3300025933 Bacteria 12351
262 Ga0207706_10254168 3300025933 Bacteria 1534
263 Ga0207706_10892332 3300025933 Bacteria 751
264 Ga0207686_10002585 3300025934 Bacteria 9827
265 Ga0207709_10023264 3300025935 Bacteria 3525
266 Ga0207670_10554740 3300025936 Bacteria 939
267 Ga0207669_10003451 3300025937 Bacteria 6832
268 Ga0207669_10006760 3300025937 Bacteria 5266
269 Ga0207704_10081880 3300025938 Bacteria 2089
270 Ga0207665_10046081 3300025939 Bacteria 2921
271 Ga0207665_10054167 3300025939 Bacteria 2705
272 Ga0207665_10088375 3300025939 Bacteria 2144
273 Ga0207665_10296377 3300025939 Bacteria 1208
274 Ga0207691_10264415 3300025940 Bacteria 1482
275 Ga0207711_10020536 3300025941 Bacteria 5509
276 Ga0207711_10039950 3300025941 Bacteria 3990
277 Ga0207711_10705918 3300025941 Bacteria 941
278 Ga0207711_10884345 3300025941 Unclassified 831
279 Ga0207689_10030427 3300025942 Bacteria 4499
280 Ga0207679_10278704 3300025945 Bacteria 1433
281 Ga0207667_10476347 3300025949 Bacteria 1267
282 Ga0207667_10572790 3300025949 Bacteria 1140
283 Ga0207651_10110526 3300025960 Bacteria 2062
284 Ga0207712_11594700 3300025961 Unclassified 585
285 Ga0207668_11100034 3300025972 Bacteria 712
286 Ga0207640_10119420 3300025981 Bacteria 1885
287 Ga0207658_10027807 3300025986 Bacteria 3977
288 Ga0207703_10338656 3300026035 Bacteria 1382
289 Ga0207703_10626336 3300026035 Bacteria 1019
290 Ga0207703_10775926 3300026035 Bacteria 914
291 Ga0207639_10207360 3300026041 Unclassified 1685
292 Ga0207678_10099573 3300026067 Bacteria 2483
293 Ga0207678_10141368 3300026067 Bacteria 2054
294 Ga0207678_10362969 3300026067 Bacteria 1250
295 Ga0207708_11304781 3300026075 Bacteria 636
296 Ga0207648_10000067 3300026089 Bacteria 98265
297 Ga0207676_10959411 3300026095 Bacteria 841
298 Ga0207675_100083222 3300026118 Bacteria 3001
299 Ga0207675_100228582 3300026118 Bacteria 1794
300 Ga0207683_10467189 3300026121 Bacteria 1164
301 Ga0207698_10067145 3300026142 Bacteria 2827
302 Ga0268266_10194955 3300028379 Bacteria 1851
303 Ga0268265_10165972 3300028380 Bacteria 1882
304 Ga0268264_10056741 3300028381 Unclassified 3274
305 Ga0268264_10160908 3300028381 Unclassified 2022
306 Ga0268264_10451069 3300028381 Bacteria 1246
307 Ga0265334_10052347 3300028573 Bacteria 1563
308 Ga0265338_10140416 3300028800 Unclassified 1893
309 Ga0265770_1000093 3300030878 Bacteria 10219
310 Ga0265760_10000085 3300031090 Bacteria 23936
311 Ga0265760_10106402 3300031090 Unclassified 890
312 Ga0265760_10321076 3300031090 Unclassified 551
313 Ga0265339_10000046 3300031249 Bacteria 114399
314 Ga0265316_10001769 3300031344 Bacteria 22818
315 Ga0265316_10054267 3300031344 Bacteria 3138
316 Ga0265316_10592842 3300031344 Bacteria 786
317 Ga0265313_10061096 3300031595 Bacteria 1765
318 Ga0265314_10003567 3300031711 Bacteria 14993
319 Ga0265342_10000693 3300031712 Bacteria 35319
320 Ga0373934_0238947 3300035086 Unclassified 750
321 Ga0373923_0138835 3300035111 Unclassified 1098
322 Ga0373923_0268314 3300035111 Unclassified 802
323 Ga0373954_0145440 3300035118 Unclassified 1157
324 Ga0373956_0244750 3300035119 Bacteria 852
325 Ga0373955_0155659 3300035172 Bacteria 1346
326 Ga0373955_0271682 3300035172 Bacteria 1019
327 Ga0373955_0456238 3300035172 Unclassified 779
328 Ga0373931_0183833 3300035691 Bacteria 1240
329 Ga0373927_0287051 3300035695 Bacteria 1083
330 Ga0373927_0672578 3300035695 Bacteria 684
331 Ga0373933_0047589 3300035724 Bacteria 2551
332 Ga0373933_0065707 3300035724 Bacteria 2197
333 Ga0373933_0069968 3300035724 Bacteria 2134
334 Ga0373937_0003714 3300036401 Bacteria 12895
335 Ga0373937_0005941 3300036401 Bacteria 10506
336 Ga0373937_0022836 3300036401 Bacteria 5627
337 Ga0373937_0053195 3300036401 Bacteria 3714
338 Ga0436364_0297312 3300037853 Bacteria 1283
339 Ga0436365_0078938 3300039437 Bacteria 593
340 Ga0436360_0547596 3300039438 Bacteria 3692
341 Ga0436361_0930701 3300039447 Bacteria 961
342 Ga0436363_0024633 3300039450 Bacteria 3499
343 Ga0436363_1705037 3300039450 Bacteria 2841
344 Ga0436362_0062386 3300039453 Bacteria 901
345 Ga0436362_0812836 3300039453 Unclassified 2018
346 Ga0436362_1302242 3300039453 Unclassified 595
347 Ga0466970_0848006 3300044765 Bacteria 536
348 Ga0466959_0065824 3300045049 Unclassified 2630
349 Ga0451576_0762942 3300045051 Bacteria 1016
350 Ga0466967_0186022 3300045976 Unclassified 1961
351 Ga0495629_0145586 3300046459 Unclassified 1648
352 Ga0495651_0186009 3300046462 Bacteria 1466
353 Ga0495580_0003847 3300046472 Bacteria 12702
354 Ga0495580_0818290 3300046472 Bacteria 603
355 Ga0495587_0053419 3300046536 Unclassified 2382
356 Ga0495657_0035930 3300046675 Unclassified 3430
357 Ga0495613_0089657 3300046689 Bacteria 2228
358 Ga0495602_0346477 3300048088 Unclassified 1073
359 Ga0495602_0497887 3300048088 Unclassified 852
360 Ga0496100_0010972 3300048903 Bacteria 5141
361 Ga0496100_0079998 3300048903 Bacteria 2204
362 Ga0496100_0851116 3300048903 Bacteria 715
363 Ga0496101_0014774 3300048904 Bacteria 5252
364 Ga0496101_0033455 3300048904 Unclassified 3626
365 Ga0496102_0003433 3300048905 Bacteria 13430
366 Ga0496103_0114531 3300048906 Bacteria 1714
367 Ga0496104_0027577 3300048907 Bacteria 5257
368 Ga0496104_0045639 3300048907 Bacteria 4123
369 Ga0496105_0053892 3300048908 Bacteria 3322
370 Ga0496105_0165115 3300048908 Bacteria 1817
371 Ga0496106_0013590 3300048909 Bacteria 6010
372 Ga0496106_0020391 3300048909 Bacteria 4919
373 Ga0496107_0001614 3300048910 Bacteria 14042
374 Ga0496108_0471603 3300048911 Bacteria 1097
375 Ga0496109_0800240 3300048912 Unclassified 881
376 Ga0496110_0131670 3300048913 Bacteria 2259
377 Ga0496114_0059536 3300048917 Bacteria 3191
378 Ga0496114_0088735 3300048917 Bacteria 2623
379 Ga0496114_1154014 3300048917 Unclassified 660
380 Ga0496115_0007435 3300048918 Bacteria 8060
381 Ga0496115_0046492 3300048918 Bacteria 3469
382 Ga0496115_0170562 3300048918 Bacteria 1800
383 Ga0496115_0236192 3300048918 Unclassified 1507
384 Ga0496115_0462379 3300048918 Bacteria 1024
385 Ga0501031_0104764 3300049568 Unclassified 1846
386 Ga0501033_0073275 3300049570 Bacteria 2514
387 Ga0501036_0007240 3300049572 Bacteria 9034
388 Ga0501036_0013913 3300049572 Bacteria 6692
389 Ga0501037_0089460 3300049573 Bacteria 2228
390 Ga0501037_0329664 3300049573 Bacteria 1056
391 Ga0501038_0286493 3300049574 Bacteria 1295
392 Ga0501039_0004386 3300049575 Bacteria 10639
393 Ga0501039_0109695 3300049575 Unclassified 2157
394 Ga0501040_0007311 3300049576 Bacteria 7157
395 Ga0501040_0097069 3300049576 Bacteria 2052
396 Ga0501040_0165802 3300049576 Unclassified 1563
397 Ga0501041_0008618 3300049577 Bacteria 6007
398 Ga0501042_0006885 3300049578 Bacteria 7417
399 Ga0501042_0040095 3300049578 Bacteria 3329
400 Ga0501042_0280525 3300049578 Bacteria 1203
401 Ga0501043_0023153 3300049579 Bacteria 4873
402 Ga0501043_0190544 3300049579 Bacteria 1595
403 Ga0501046_0038931 3300049580 Unclassified 3812
404 Ga0501046_0059254 3300049580 Bacteria 3000
405 Ga0501046_0120618 3300049580 Bacteria 1995
406 Ga0501048_0005837 3300049582 Bacteria 9364
407 Ga0501048_0300724 3300049582 Bacteria 1141
408 Ga0501067_0433408 3300049583 Unclassified 734
409 Ga0501068_0394459 3300049584 Bacteria 892
410 Ga0501068_0450428 3300049584 Unclassified 832
411 Ga0501069_0113455 3300049585 Bacteria 1545
412 Ga0501070_0486273 3300049586 Unclassified 993
413 Ga0501071_0004921 3300049587 Bacteria 8524
414 Ga0501071_0018675 3300049587 Unclassified 4806
415 Ga0501072_0005406 3300049588 Bacteria 9726
416 Ga0501072_0118167 3300049588 Unclassified 2112
417 Ga0501072_0715697 3300049588 Bacteria 786
418 Ga0501073_0770997 3300049589 Unclassified 663
419 Ga0501074_0035336 3300049590 Bacteria 3621
420 Ga0501074_0041602 3300049590 Unclassified 3327
421 Ga0501075_0003694 3300049591 Bacteria 10274
422 Ga0501075_0058453 3300049591 Bacteria 2904
423 Ga0501076_0001161 3300049592 Bacteria 17439
424 Ga0501076_0038322 3300049592 Unclassified 3763
425 Ga0501076_0088001 3300049592 Unclassified 2496
426 Ga0501077_0006066 3300049593 Bacteria 7375
427 Ga0501077_0681856 3300049593 Bacteria 660
428 Ga0501079_0004165 3300049741 Bacteria 10715
429 Ga0501079_0099952 3300049741 Unclassified 2249
430 Ga0501079_0137004 3300049741 Unclassified 1906
431 Ga0501080_0011548 3300049742 Bacteria 8088
432 Ga0501080_0161917 3300049742 Unclassified 2066
433 Ga0501080_0763419 3300049742 Bacteria 850
434 Ga0501081_0001023 3300049743 Bacteria 16707
435 Ga0501081_0012752 3300049743 Bacteria 5529
436 Ga0501083_0037217 3300049744 Unclassified 3315
437 Ga0501083_0096633 3300049744 Unclassified 1949
438 Ga0501035_0318000 3300049822 Bacteria 1308
439 Ga0501045_0000631 3300049824 Bacteria 22221
440 Ga0501045_0072684 3300049824 Unclassified 2532
441 Ga0501045_0140316 3300049824 Unclassified 1797
442 nmdc:mga05p37_133153_c1 3300050507 Unclassified 3049
443 nmdc:mga05p37_312218_c1 3300050507 Bacteria 1863
444 nmdc:mga05p37_776570_c1 3300050507 Bacteria 1052
445 nmdc:mga08y16_854570_c1 3300050511 Unclassified 899
446 Ga0495619_0960040 3300053085 Bacteria 573
447 Ga0501084_0001645 3300054114 Bacteria 17764
448 Ga0501084_0007467 3300054114 Bacteria 9012
449 Ga0501084_0012361 3300054114 Bacteria 7073
450 Ga0501082_0001706 3300060353 Bacteria 19391
451 Ga0501082_0012905 3300060353 Bacteria 7182
452 Ga0501082_0433343 3300060353 Bacteria 1148
453 Ga0530510_0002666 3300061734 Bacteria 12265
454 Ga0530510_0141323 3300061734 Unclassified 1774
455 Ga0436363_0329238
456 JGI25405J52794_10046934
457 Ga0065704_10372184
458 Ga0065715_10000762
459 Ga0065715_10062580
460 Ga0070676_10003493
461 Ga0070690_100004458
462 Ga0070690_100032809
463 Ga0070677_10295208
464 Ga0068869_100026785
465 Ga0068869_100739590
466 Ga0070680_100076767
467 Ga0070682_101255890
468 Ga0068868_100795883
469 Ga0068868_101990338
470 Ga0070660_100669666
471 Ga0070660_101410923
472 Ga0070691_10019405
473 Ga0070661_100931974
474 Ga0070668_100125633
475 Ga0070668_101109085
476 Ga0070669_100039099
477 Ga0070669_100090512
478 Ga0070669_100284709
479 Ga0070675_100224021
480 Ga0070671_100046506
481 Ga0070671_100927214
482 Ga0070674_100000122
483 Ga0070674_100002931
484 Ga0070673_100089275
485 Ga0070688_100776211
486 Ga0070667_100010375
487 Ga0070709_10028182
488 Ga0070709_10090272
489 Ga0070709_10325149
490 Ga0070709_10453556
491 Ga0070709_11600421
492 Ga0070714_100330540
493 Ga0070714_100344158
494 Ga0070714_100417080
495 Ga0070713_100000463
496 Ga0070713_100233598
497 Ga0070713_100426373
498 Ga0070713_100663942
499 Ga0070713_100748324
500 Ga0070710_10331615
501 Ga0070710_10332692
502 Ga0070711_100005724
503 Ga0070711_100065707
504 Ga0070711_100086119
505 Ga0070711_100142217
506 Ga0070711_100269702
507 Ga0070711_100889582
508 Ga0070711_101135698
509 Ga0070705_100021443
510 Ga0070705_100054007
511 Ga0070705_101436698
512 Ga0070700_100873655
513 Ga0070694_100006701
514 Ga0070708_100395652
515 Ga0070708_100464422
516 Ga0070708_100642441
517 Ga0070663_100097100
518 Ga0070678_100010504
519 Ga0070662_100019144
520 Ga0070662_100085760
521 Ga0070662_100190074
522 Ga0068867_100006784
523 Ga0070685_10102691
524 Ga0070706_100070919
525 Ga0070707_100019163
526 Ga0070707_100053046
527 Ga0070698_100020845
528 Ga0070699_100026245
529 Ga0070679_100463859
530 Ga0070684_101405975
531 Ga0070697_100039547
532 Ga0070697_100124086
533 Ga0068853_100045511
534 Ga0068853_101051799
535 Ga0070672_100006835
536 Ga0070672_100462058
537 Ga0070695_100182254
538 Ga0070696_100075141
539 Ga0070696_100105897
540 Ga0070665_100794325
541 Ga0070665_100805063
542 Ga0070704_101516792
543 Ga0070704_101545722
544 Ga0068855_100090849
545 Ga0068855_100417428
546 Ga0070664_100853136
547 Ga0068854_100031139
548 Ga0068856_100359866
549 Ga0068856_101653841
550 Ga0070702_100002809
551 Ga0068852_100085268
552 Ga0068859_100697970
553 Ga0068864_100773511
554 Ga0068866_10415315
555 Ga0068861_100171472
556 Ga0068858_100081549
557 Ga0068858_100528197
558 Ga0068858_100781002
559 Ga0068860_100152405
560 Ga0068860_100383775
561 Ga0068860_100544621
562 Ga0068860_102042645
563 Ga0068862_100165817
564 Ga0081455_10000920
565 Ga0081540_1010850
566 Ga0081540_1032059
567 Ga0070717_10050649
568 Ga0070717_10143913
569 Ga0070717_10293906
570 Ga0070717_10409733
571 Ga0070717_10552545
572 Ga0070717_10560011
573 Ga0070717_10685112
574 Ga0070715_10043002
575 Ga0070715_10126109
576 Ga0070715_10194038
577 Ga0070716_100015912
578 Ga0070716_100070529
579 Ga0070716_100212855
580 Ga0070716_100633463
581 Ga0070712_100001174
582 Ga0070712_100001549
583 Ga0070712_100366750
584 Ga0070712_100958531
585 Ga0097621_100830896
586 Ga0068871_100098223
587 Ga0068871_100688623
588 Ga0068871_101016678
589 Ga0068871_101531176
590 Ga0075434_100863064
591 Ga0068865_100000836
592 Ga0068865_100091234
593 Ga0097620_100064369
594 Ga0097620_100359624
595 Ga0097620_100697961
596 Ga0099795_10080569
597 Ga0105240_10012016
598 Ga0105240_10074506
599 Ga0105240_10180284
600 Ga0111539_10349126
601 Ga0111539_11239245
602 Ga0105245_10017463
603 Ga0105245_10051587
604 Ga0105245_10908228
605 Ga0105247_10146241
606 Ga0114129_10153813
607 Ga0114129_10349097
608 Ga0114129_10375253
609 Ga0105243_10081301
610 Ga0105243_10589385
611 Ga0105241_10080194
612 Ga0105241_10414688
613 Ga0105248_10022430
614 Ga0105248_10160392
615 Ga0105248_10742925
616 Ga0105248_10798613
617 Ga0105248_12719142
618 Ga0105237_10509443
619 Ga0105237_10703745
620 Ga0105238_10053578
621 Ga0105238_10859903
622 Ga0105239_10002419
623 Ga0105239_10037905
624 Ga0105239_10186595
625 Ga0105239_11183572
626 Ga0157373_10772989
627 Ga0157371_10098910
628 Ga0157369_11019441
629 Ga0157369_11775762
630 Ga0157374_10110665
631 Ga0157374_10125278
632 Ga0157374_10171719
633 Ga0157374_10265586
634 Ga0157378_10013603
635 Ga0157378_10033488
636 Ga0157378_10161563
637 Ga0157378_10642917
638 Ga0163162_10045207
639 Ga0157372_10231438
640 Ga0157372_10607804
641 Ga0157375_10137903
642 Ga0157379_10440273
643 Ga0157379_10798118
644 Ga0157379_10866959
645 Ga0157376_10029591
646 Ga0157376_10199469
647 Ga0157376_10272223
648 Ga0163161_10053712
649 Ga0213874_10028812
650 Ga0228598_1002617
651 Ga0207666_1001211
652 Ga0207697_10000987
653 Ga0207656_10054736
654 Ga0207692_10032422
655 Ga0207692_10036565
656 Ga0207692_10187263
657 Ga0207642_10540894
658 Ga0207688_10001855
659 Ga0207647_10022404
660 Ga0207685_10157875
661 Ga0207699_10011604
662 Ga0207699_10024127
663 Ga0207699_10046404
664 Ga0207699_10089873
665 Ga0207699_10167968
666 Ga0207645_10000408
667 Ga0207645_10002727
668 Ga0207684_10007014
669 Ga0207684_10064050
670 Ga0207684_10180990
671 Ga0207684_10368732
672 Ga0207684_10867131
673 Ga0207654_10071219
674 Ga0207654_10124768
675 Ga0207695_10002957
676 Ga0207695_10107291
677 Ga0207693_10000005
678 Ga0207693_10007694
679 Ga0207693_10011252
680 Ga0207693_10033315
681 Ga0207693_10670707
682 Ga0207693_10772714
683 Ga0207663_10004118
684 Ga0207663_10019614
685 Ga0207663_10039342
686 Ga0207663_10089974
687 Ga0207663_10489569
688 Ga0207652_10383618
689 Ga0207646_10030790
690 Ga0207646_10035848
691 Ga0207646_10123684
692 Ga0207646_10241045
693 Ga0207646_10342359
694 Ga0207681_10103213
695 Ga0207681_10139407
696 Ga0207681_10217657
697 Ga0207694_10003512
698 Ga0207694_10063677
699 Ga0207659_10879957
700 Ga0207687_10130398
701 Ga0207687_10206601
702 Ga0207687_10688836
703 Ga0207687_11487879
704 Ga0207700_10009249
705 Ga0207700_10482026
706 Ga0207700_10852039
707 Ga0207664_10057266
708 Ga0207664_10250894
709 Ga0207664_10334057
710 Ga0207664_10611307
711 Ga0207664_10623729
712 Ga0207644_10199521
713 Ga0207644_10268302
714 Ga0207644_10805855
715 Ga0207706_10005023
716 Ga0207706_10254168
717 Ga0207706_10892332
718 Ga0207686_10002585
719 Ga0207709_10023264
720 Ga0207670_10554740
721 Ga0207669_10003451
722 Ga0207669_10006760
723 Ga0207704_10081880
724 Ga0207665_10046081
725 Ga0207665_10054167
726 Ga0207665_10088375
727 Ga0207665_10296377
728 Ga0207691_10264415
729 Ga0207711_10020536
730 Ga0207711_10039950
731 Ga0207711_10705918
732 Ga0207711_10884345
733 Ga0207689_10030427
734 Ga0207679_10278704
735 Ga0207667_10476347
736 Ga0207667_10572790
737 Ga0207651_10110526
738 Ga0207712_11594700
739 Ga0207668_11100034
740 Ga0207640_10119420
741 Ga0207658_10027807
742 Ga0207703_10338656
743 Ga0207703_10626336
744 Ga0207703_10775926
745 Ga0207639_10207360
746 Ga0207678_10099573
747 Ga0207678_10141368
748 Ga0207678_10362969
749 Ga0207708_11304781
750 Ga0207648_10000067
751 Ga0207676_10959411
752 Ga0207675_100083222
753 Ga0207675_100228582
754 Ga0207683_10467189
755 Ga0207698_10067145
756 Ga0268266_10194955
757 Ga0268265_10165972
758 Ga0268264_10056741
759 Ga0268264_10160908
760 Ga0268264_10451069
761 Ga0265334_10052347
762 Ga0265338_10140416
763 Ga0265770_1000093
764 Ga0265760_10000085
765 Ga0265760_10106402
766 Ga0265760_10321076
767 Ga0265339_10000046
768 Ga0265316_10001769
769 Ga0265316_10054267
770 Ga0265316_10592842
771 Ga0265313_10061096
772 Ga0265314_10003567
773 Ga0265342_10000693
774 Ga0373934_0238947
775 Ga0373923_0138835
776 Ga0373923_0268314
777 Ga0373954_0145440
778 Ga0373956_0244750
779 Ga0373955_0155659
780 Ga0373955_0271682
781 Ga0373955_0456238
782 Ga0373931_0183833
783 Ga0373927_0287051
784 Ga0373927_0672578
785 Ga0373933_0047589
786 Ga0373933_0065707
787 Ga0373933_0069968
788 Ga0373937_0003714
789 Ga0373937_0005941
790 Ga0373937_0022836
791 Ga0373937_0053195
792 Ga0436364_0297312
793 Ga0436365_0078938
794 Ga0436360_0547596
795 Ga0436361_0930701
796 Ga0436363_0024633
797 Ga0436363_1705037
798 Ga0436362_0062386
799 Ga0436362_0812836
800 Ga0436362_1302242
801 Ga0466970_0848006
802 Ga0466959_0065824
803 Ga0451576_0762942
804 Ga0466967_0186022
805 Ga0495629_0145586
806 Ga0495651_0186009
807 Ga0495580_0003847
808 Ga0495580_0818290
809 Ga0495587_0053419
810 Ga0495657_0035930
811 Ga0495613_0089657
812 Ga0495602_0346477
813 Ga0495602_0497887
814 Ga0496100_0010972
815 Ga0496100_0079998
816 Ga0496100_0851116
817 Ga0496101_0014774
818 Ga0496101_0033455
819 Ga0496102_0003433
820 Ga0496103_0114531
821 Ga0496104_0027577
822 Ga0496104_0045639
823 Ga0496105_0053892
824 Ga0496105_0165115
825 Ga0496106_0013590
826 Ga0496106_0020391
827 Ga0496107_0001614
828 Ga0496108_0471603
829 Ga0496109_0800240
830 Ga0496110_0131670
831 Ga0496114_0059536
832 Ga0496114_0088735
833 Ga0496114_1154014
834 Ga0496115_0007435
835 Ga0496115_0046492
836 Ga0496115_0170562
837 Ga0496115_0236192
838 Ga0496115_0462379
839 Ga0501031_0104764
840 Ga0501033_0073275
841 Ga0501036_0007240
842 Ga0501036_0013913
843 Ga0501037_0089460
844 Ga0501037_0329664
845 Ga0501038_0286493
846 Ga0501039_0004386
847 Ga0501039_0109695
848 Ga0501040_0007311
849 Ga0501040_0097069
850 Ga0501040_0165802
851 Ga0501041_0008618
852 Ga0501042_0006885
853 Ga0501042_0040095
854 Ga0501042_0280525
855 Ga0501043_0023153
856 Ga0501043_0190544
857 Ga0501046_0038931
858 Ga0501046_0059254
859 Ga0501046_0120618
860 Ga0501048_0005837
861 Ga0501048_0300724
862 Ga0501067_0433408
863 Ga0501068_0394459
864 Ga0501068_0450428
865 Ga0501069_0113455
866 Ga0501070_0486273
867 Ga0501071_0004921
868 Ga0501071_0018675
869 Ga0501072_0005406
870 Ga0501072_0118167
871 Ga0501072_0715697
872 Ga0501073_0770997
873 Ga0501074_0035336
874 Ga0501074_0041602
875 Ga0501075_0003694
876 Ga0501075_0058453
877 Ga0501076_0001161
878 Ga0501076_0038322
879 Ga0501076_0088001
880 Ga0501077_0006066
881 Ga0501077_0681856
882 Ga0501079_0004165
883 Ga0501079_0099952
884 Ga0501079_0137004
885 Ga0501080_0011548
886 Ga0501080_0161917
887 Ga0501080_0763419
888 Ga0501081_0001023
889 Ga0501081_0012752
890 Ga0501083_0037217
891 Ga0501083_0096633
892 Ga0501035_0318000
893 Ga0501045_0000631
894 Ga0501045_0072684
895 Ga0501045_0140316
896 nmdc:mga05p37_133153_c1
897 nmdc:mga05p37_312218_c1
898 nmdc:mga05p37_776570_c1
899 nmdc:mga08y16_854570_c1
900 Ga0495619_0960040
901 Ga0501084_0001645
902 Ga0501084_0007467
903 Ga0501084_0012361
904 Ga0501082_0001706
905 Ga0501082_0012905
906 Ga0501082_0433343
907 Ga0530510_0002666
908 Ga0530510_0141323

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02635

DsrE

DsrE/DsrF-like family

67

182

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pnx-assembly2.cif.gz_E crystal structure of a putative sulfurtransferase dsre (swol_2425) from syntrophomonas wolfei str. goettingen at 1.92 a resolution 0.7698 30 149
3mc3-assembly1.cif.gz_A crystal structure of dsre/dsrf-like family protein (np_342589.1) from sulfolobus solfataricus at 1.49 a resolution 0.7565 30 149
2qs7-assembly2.cif.gz_D crystal structure of a putative oxidoreductase of the dsre/dsrf-like family (sso1126) from sulfolobus solfataricus p2 at 2.09 a resolution 0.75 30 149
3mc3-assembly1.cif.gz_A crystal structure of dsre/dsrf-like family protein (np_342589.1) from sulfolobus solfataricus at 1.49 a resolution 0.7459 30 149
2pd2-assembly1.cif.gz_A crystal structure of (st0148) conserved hypothetical from sulfolobus tokodaii strain7 0.7443 30 149
ID Description Score Start End Superfamily
af_Q58396_1_114_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8488 31 149 3.40.1260.10
af_Q58396_1_114_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.842 31 149 3.40.1260.10
af_Q58170_143_270_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.801 20 140 3.40.1260.10
af_P0AB52_1_117_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.7801 30 149 3.40.1260.10
af_P0AB52_1_117_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.7686 30 149 3.40.1260.10
ID Description Score Start End GO Terms
AF-A0A2V6DBH3-F1-model_v4 Sulfur reduction protein DsrE 0.9935 49 149
AF-A0A2V5QZS4-F1-model_v4 Uncharacterized protein 0.9856 77 149
AF-A0A2V6DBH3-F1-model_v4 Sulfur reduction protein DsrE 0.9838 49 149
AF-A0A2V5QQY8-F1-model_v4 Uncharacterized protein 0.9609 77 149
AF-A0A2V5QZS4-F1-model_v4 Uncharacterized protein 0.9597 77 149

Map