F447560

General Info

Members Datasets Scaffolds Average Seq Length
455 204 910 222

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10967690|Ga0105240_109676901
Length 249
Sequence MNEHRASPHVASLPYRSIATTTAPSSPMHPVRIAPSILSADFATLRDDIAMCEAGGADWIHVDVMDGRFVPNLTFGAKVIDAVRRSTTLPIDVHLMVVEPEQYFDDFAKAGATGLTIHAEVAPHLQRQLSRIRELGCRAGVALNPSTPLDMVREVIDDVDLLLIMTVNPGFGGQQFIPASLDKLRRARRLLDETKSQANLEIDGGVSRDTILACRRAGADAFVAGNAIFSARDPKAEIAALRLAAAEPV

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
164 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
165 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.2
Rhizosphere 97.36
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10967690 3300009093 Bacteria 912
2 Ga0058862_12857762 3300004803 Bacteria 2474
3 Ga0070658_10000609 3300005327 Bacteria 31011
4 Ga0070658_10003341 3300005327 Bacteria 13233
5 Ga0070658_10006051 3300005327 Bacteria 9813
6 Ga0070658_10034370 3300005327 Bacteria 4079
7 Ga0070658_10118083 3300005327 Bacteria 2202
8 Ga0070658_10179417 3300005327 Bacteria 1782
9 Ga0070658_10188759 3300005327 Bacteria 1737
10 Ga0070658_10232565 3300005327 Bacteria 1561
11 Ga0070676_10007795 3300005328 Bacteria 5753
12 Ga0070683_100000808 3300005329 Bacteria 23168
13 Ga0070683_100001847 3300005329 Bacteria 16521
14 Ga0070683_100006682 3300005329 Bacteria 9684
15 Ga0070683_100013319 3300005329 Bacteria 7170
16 Ga0070683_100037373 3300005329 Bacteria 4445
17 Ga0070683_100090115 3300005329 Bacteria 2879
18 Ga0070683_100119547 3300005329 Bacteria 2489
19 Ga0070683_100131920 3300005329 Bacteria 2365
20 Ga0070683_100644230 3300005329 Bacteria 1014
21 Ga0070683_100786035 3300005329 Bacteria 912
22 Ga0070690_100043877 3300005330 Bacteria 2837
23 Ga0070670_100035390 3300005331 Bacteria 4299
24 Ga0070670_100171479 3300005331 Bacteria 1882
25 Ga0070670_100307418 3300005331 Bacteria 1387
26 Ga0070670_100482932 3300005331 Bacteria 1100
27 Ga0068869_100648978 3300005334 Bacteria 896
28 Ga0070680_100000021 3300005336 Bacteria 81631
29 Ga0070680_100000286 3300005336 Bacteria 33685
30 Ga0070680_100015110 3300005336 Bacteria 6045
31 Ga0070680_100024915 3300005336 Bacteria 4782
32 Ga0070680_100111490 3300005336 Bacteria 2277
33 Ga0070680_100125308 3300005336 Bacteria 2146
34 Ga0070680_100247907 3300005336 Bacteria 1506
35 Ga0070680_100348590 3300005336 Bacteria 1259
36 Ga0070682_100000385 3300005337 Bacteria 29420
37 Ga0070682_100061817 3300005337 Bacteria 2371
38 Ga0070682_100082944 3300005337 Bacteria 2079
39 Ga0070682_100157923 3300005337 Bacteria 1563
40 Ga0068868_100446145 3300005338 Bacteria 1125
41 Ga0070660_100002512 3300005339 Bacteria 12576
42 Ga0070660_100036024 3300005339 Bacteria 3746
43 Ga0070660_100047669 3300005339 Bacteria 3289
44 Ga0070660_100168954 3300005339 Bacteria 1766
45 Ga0070660_100352689 3300005339 Bacteria 1212
46 Ga0070660_100357337 3300005339 Bacteria 1203
47 Ga0070691_10010369 3300005341 Bacteria 4251
48 Ga0070687_100015865 3300005343 Bacteria 3417
49 Ga0070661_100003786 3300005344 Bacteria 10424
50 Ga0070661_100020989 3300005344 Bacteria 4663
51 Ga0070661_100061204 3300005344 Bacteria 2763
52 Ga0070661_100291524 3300005344 Bacteria 1268
53 Ga0070661_100504703 3300005344 Bacteria 968
54 Ga0070668_100024159 3300005347 Bacteria 4603
55 Ga0070668_100216983 3300005347 Bacteria 1576
56 Ga0070668_100472895 3300005347 Bacteria 1081
57 Ga0070669_100014249 3300005353 Bacteria 5656
58 Ga0070675_100001146 3300005354 Bacteria 19122
59 Ga0070675_100117213 3300005354 Bacteria 2260
60 Ga0070675_100127531 3300005354 Bacteria 2166
61 Ga0070671_100133649 3300005355 Bacteria 2090
62 Ga0070674_100081148 3300005356 Bacteria 2317
63 Ga0070674_100153035 3300005356 Bacteria 1742
64 Ga0070674_100311226 3300005356 Bacteria 1259
65 Ga0070673_100268882 3300005364 Bacteria 1491
66 Ga0070673_100279891 3300005364 Bacteria 1463
67 Ga0070688_100001561 3300005365 Bacteria 11437
68 Ga0070659_100083782 3300005366 Bacteria 2549
69 Ga0070659_100487135 3300005366 Bacteria 1050
70 Ga0070667_100632138 3300005367 Bacteria 988
71 Ga0070714_100007190 3300005435 Bacteria 8640
72 Ga0070714_100044539 3300005435 Bacteria 3757
73 Ga0070714_100062353 3300005435 Bacteria 3204
74 Ga0070713_100022996 3300005436 Bacteria 4827
75 Ga0070701_10173323 3300005438 Bacteria 1258
76 Ga0070708_100000184 3300005445 Bacteria 45171
77 Ga0070663_100037007 3300005455 Bacteria 3394
78 Ga0070663_100190969 3300005455 Bacteria 1594
79 Ga0070663_100255585 3300005455 Bacteria 1388
80 Ga0070662_100426836 3300005457 Bacteria 1097
81 Ga0070681_10000349 3300005458 Bacteria 37198
82 Ga0070681_10003731 3300005458 Bacteria 14294
83 Ga0070681_10004940 3300005458 Bacteria 12818
84 Ga0070681_10013838 3300005458 Bacteria 8030
85 Ga0070681_10207582 3300005458 Bacteria 1875
86 Ga0070681_10336921 3300005458 Bacteria 1418
87 Ga0070681_10409041 3300005458 Bacteria 1268
88 Ga0070681_10409702 3300005458 Bacteria 1267
89 Ga0068867_100012909 3300005459 Bacteria 5911
90 Ga0070685_10003725 3300005466 Bacteria 7719
91 Ga0070706_100321593 3300005467 Bacteria 1443
92 Ga0070707_100004384 3300005468 Bacteria 13212
93 Ga0070698_100016406 3300005471 Bacteria 7819
94 Ga0070699_100003793 3300005518 Bacteria 13355
95 Ga0070699_100148217 3300005518 Bacteria 2074
96 Ga0070679_100000151 3300005530 Bacteria 56102
97 Ga0070679_100003260 3300005530 Bacteria 14839
98 Ga0070679_100006652 3300005530 Bacteria 10778
99 Ga0070679_100007661 3300005530 Bacteria 10107
100 Ga0070679_100010762 3300005530 Bacteria 8686
101 Ga0070679_100039574 3300005530 Bacteria 4685
102 Ga0070679_100128054 3300005530 Bacteria 2520
103 Ga0070679_100260246 3300005530 Bacteria 1690
104 Ga0070679_100440716 3300005530 Bacteria 1247
105 Ga0070679_100444213 3300005530 Bacteria 1242
106 Ga0070684_100002472 3300005535 Bacteria 13605
107 Ga0070684_100005075 3300005535 Bacteria 10055
108 Ga0070684_100032761 3300005535 Bacteria 4433
109 Ga0070684_100036370 3300005535 Bacteria 4219
110 Ga0070684_100038936 3300005535 Bacteria 4087
111 Ga0070684_100716772 3300005535 Bacteria 933
112 Ga0068853_100012267 3300005539 Bacteria 6969
113 Ga0068853_100036352 3300005539 Bacteria 4187
114 Ga0068853_100055167 3300005539 Bacteria 3425
115 Ga0070672_100100998 3300005543 Bacteria 2340
116 Ga0070672_100261883 3300005543 Bacteria 1458
117 Ga0070672_100384078 3300005543 Bacteria 1201
118 Ga0070696_100000539 3300005546 Bacteria 24051
119 Ga0070696_100536184 3300005546 Bacteria 936
120 Ga0070693_100032618 3300005547 Bacteria 2866
121 Ga0070693_100198019 3300005547 Bacteria 1303
122 Ga0070665_100038213 3300005548 Bacteria 4826
123 Ga0068855_100083559 3300005563 Bacteria 3698
124 Ga0068855_100170895 3300005563 Bacteria 2462
125 Ga0068855_100226970 3300005563 Bacteria 2093
126 Ga0068855_100414025 3300005563 Bacteria 1475
127 Ga0068855_100476334 3300005563 Bacteria 1359
128 Ga0070664_100005835 3300005564 Bacteria 9934
129 Ga0070664_100027221 3300005564 Bacteria 4750
130 Ga0070664_100059171 3300005564 Bacteria 3259
131 Ga0070664_100092351 3300005564 Bacteria 2621
132 Ga0070664_100100348 3300005564 Bacteria 2517
133 Ga0070664_100347255 3300005564 Bacteria 1349
134 Ga0070664_100534167 3300005564 Bacteria 1083
135 Ga0068857_100007907 3300005577 Bacteria 9173
136 Ga0068857_100030041 3300005577 Bacteria 4795
137 Ga0068854_100027898 3300005578 Bacteria 3895
138 Ga0068854_100038538 3300005578 Bacteria 3362
139 Ga0068854_100073410 3300005578 Bacteria 2507
140 Ga0068856_100028142 3300005614 Bacteria 5485
141 Ga0068856_100119077 3300005614 Bacteria 2641
142 Ga0068856_100674962 3300005614 Bacteria 1054
143 Ga0070702_100074351 3300005615 Bacteria 2016
144 Ga0070702_100171679 3300005615 Bacteria 1411
145 Ga0068852_100108443 3300005616 Bacteria 2520
146 Ga0068852_100126535 3300005616 Bacteria 2347
147 Ga0068852_100210699 3300005616 Bacteria 1843
148 Ga0068852_100911806 3300005616 Bacteria 896
149 Ga0068859_100021527 3300005617 Bacteria 6471
150 Ga0068859_100122670 3300005617 Bacteria 2665
151 Ga0068859_100741311 3300005617 Bacteria 1071
152 Ga0068864_100017420 3300005618 Bacteria 5989
153 Ga0068866_10018025 3300005718 Bacteria 3187
154 Ga0068863_100096771 3300005841 Bacteria 2802
155 Ga0068858_100225537 3300005842 Bacteria 1775
156 Ga0068860_100416093 3300005843 Bacteria 1332
157 Ga0068862_100081279 3300005844 Bacteria 2811
158 Ga0081539_10010429 3300005985 Bacteria 7548
159 Ga0070717_10261354 3300006028 Bacteria 1532
160 Ga0097621_100470237 3300006237 Bacteria 1135
161 Ga0075430_100032018 3300006846 Bacteria 4463
162 Ga0075430_100351732 3300006846 Bacteria 1217
163 Ga0075431_100161950 3300006847 Bacteria 2300
164 Ga0075431_100323739 3300006847 Unclassified 1554
165 Ga0068865_100014302 3300006881 Bacteria 5040
166 Ga0075436_100003051 3300006914 Bacteria 11478
167 Ga0075436_100059257 3300006914 Bacteria 2645
168 Ga0097620_100021527 3300006931 Bacteria 6471
169 Ga0097620_100122668 3300006931 Bacteria 2665
170 Ga0097620_100741277 3300006931 Bacteria 1071
171 Ga0105240_10005345 3300009093 Bacteria 19156
172 Ga0105240_10052255 3300009093 Bacteria 5138
173 Ga0105240_10557579 3300009093 Bacteria 1267
174 Ga0105240_11016792 3300009093 Bacteria 886
175 Ga0105245_10351442 3300009098 Bacteria 1461
176 Ga0105245_10656320 3300009098 Bacteria 1079
177 Ga0114129_10339327 3300009147 Bacteria 1993
178 Ga0105243_10053833 3300009148 Bacteria 3193
179 Ga0105241_10069413 3300009174 Bacteria 2732
180 Ga0105241_10569088 3300009174 Bacteria 1020
181 Ga0105242_10006416 3300009176 Bacteria 9059
182 Ga0105248_10370363 3300009177 Bacteria 1613
183 Ga0105237_10017475 3300009545 Bacteria 7435
184 Ga0105238_10008280 3300009551 Bacteria 10399
185 Ga0105249_10000027 3300009553 Bacteria 231352
186 Ga0105249_10072537 3300009553 Bacteria 3183
187 Ga0105246_10655146 3300011119 Bacteria 915
188 Ga0157373_10002494 3300013100 Bacteria 14016
189 Ga0157373_10101222 3300013100 Bacteria 2027
190 Ga0157371_10124992 3300013102 Bacteria 1829
191 Ga0157371_10294113 3300013102 Bacteria 1175
192 Ga0157371_10391349 3300013102 Bacteria 1016
193 Ga0157370_10001812 3300013104 Bacteria 26345
194 Ga0157370_10002331 3300013104 Bacteria 22960
195 Ga0157370_10007295 3300013104 Bacteria 12064
196 Ga0157370_10042840 3300013104 Bacteria 4359
197 Ga0157370_10044457 3300013104 Bacteria 4269
198 Ga0157370_10051322 3300013104 Bacteria 3940
199 Ga0157370_10257121 3300013104 Bacteria 1614
200 Ga0157369_10026741 3300013105 Bacteria 6400
201 Ga0157369_10031682 3300013105 Bacteria 5819
202 Ga0157369_10037226 3300013105 Bacteria 5327
203 Ga0157369_10166332 3300013105 Bacteria 2326
204 Ga0157369_10174543 3300013105 Bacteria 2263
205 Ga0157369_10441744 3300013105 Bacteria 1347
206 Ga0157369_10527111 3300013105 Bacteria 1222
207 Ga0157374_10043211 3300013296 Bacteria 4162
208 Ga0157378_10147543 3300013297 Bacteria 2189
209 Ga0157372_10003953 3300013307 Bacteria 15914
210 Ga0157372_10006880 3300013307 Bacteria 12100
211 Ga0157372_10007324 3300013307 Bacteria 11746
212 Ga0157372_10034056 3300013307 Bacteria 5597
213 Ga0157372_10044072 3300013307 Bacteria 4943
214 Ga0157372_10044936 3300013307 Bacteria 4896
215 Ga0157372_10229363 3300013307 Bacteria 2153
216 Ga0157372_10672021 3300013307 Bacteria 1206
217 Ga0157375_10442126 3300013308 Bacteria 1466
218 Ga0157375_11368222 3300013308 Bacteria 833
219 Ga0182008_10003345 3300014497 Bacteria 9735
220 Ga0157377_10093975 3300014745 Bacteria 1776
221 Ga0157376_10051091 3300014969 Bacteria 3433
222 Ga0163161_10590460 3300017792 Bacteria 914
223 Ga0197907_10774144 3300020069 Bacteria 2259
224 Ga0206356_11115348 3300020070 Bacteria 3231
225 Ga0206354_10033046 3300020081 Bacteria 1889
226 Ga0207656_10125400 3300025321 Bacteria 1199
227 Ga0207642_10007282 3300025899 Bacteria 3728
228 Ga0207680_10164635 3300025903 Bacteria 1490
229 Ga0207645_10136533 3300025907 Bacteria 1597
230 Ga0207645_10447309 3300025907 Bacteria 872
231 Ga0207643_10019427 3300025908 Bacteria 3724
232 Ga0207643_10045047 3300025908 Bacteria 2491
233 Ga0207643_10051793 3300025908 Bacteria 2331
234 Ga0207705_10002432 3300025909 Bacteria 14360
235 Ga0207705_10034862 3300025909 Bacteria 3599
236 Ga0207705_10039136 3300025909 Bacteria 3397
237 Ga0207705_10077203 3300025909 Bacteria 2423
238 Ga0207705_10217938 3300025909 Bacteria 1449
239 Ga0207705_10516387 3300025909 Bacteria 928
240 Ga0207705_10604786 3300025909 Bacteria 852
241 Ga0207705_10617698 3300025909 Bacteria 843
242 Ga0207684_10544238 3300025910 Bacteria 993
243 Ga0207707_10000871 3300025912 Bacteria 29492
244 Ga0207707_10002094 3300025912 Bacteria 18051
245 Ga0207707_10003778 3300025912 Bacteria 13419
246 Ga0207707_10005616 3300025912 Bacteria 10970
247 Ga0207707_10014449 3300025912 Bacteria 6876
248 Ga0207707_10016868 3300025912 Bacteria 6361
249 Ga0207707_10194984 3300025912 Bacteria 1767
250 Ga0207707_10521161 3300025912 Bacteria 1012
251 Ga0207695_10008985 3300025913 Bacteria 12434
252 Ga0207695_10011789 3300025913 Bacteria 10551
253 Ga0207695_10366194 3300025913 Bacteria 1328
254 Ga0207671_10316343 3300025914 Bacteria 1235
255 Ga0207660_10000239 3300025917 Bacteria 35581
256 Ga0207660_10001736 3300025917 Bacteria 14605
257 Ga0207660_10009246 3300025917 Bacteria 6378
258 Ga0207660_10016236 3300025917 Bacteria 4927
259 Ga0207660_10019250 3300025917 Bacteria 4561
260 Ga0207660_10025692 3300025917 Bacteria 4001
261 Ga0207660_10032984 3300025917 Bacteria 3578
262 Ga0207660_10237281 3300025917 Bacteria 1435
263 Ga0207660_10325326 3300025917 Bacteria 1228
264 Ga0207662_10007498 3300025918 Bacteria 5940
265 Ga0207662_10027917 3300025918 Bacteria 3259
266 Ga0207657_10002488 3300025919 Bacteria 19923
267 Ga0207657_10008513 3300025919 Bacteria 10401
268 Ga0207657_10015065 3300025919 Bacteria 7510
269 Ga0207657_10061224 3300025919 Bacteria 3228
270 Ga0207657_10080168 3300025919 Bacteria 2745
271 Ga0207657_10118059 3300025919 Bacteria 2184
272 Ga0207657_10267607 3300025919 Bacteria 1359
273 Ga0207649_10003199 3300025920 Bacteria 8976
274 Ga0207649_10011687 3300025920 Bacteria 4850
275 Ga0207649_10025479 3300025920 Bacteria 3448
276 Ga0207649_10066677 3300025920 Bacteria 2283
277 Ga0207649_10118946 3300025920 Bacteria 1778
278 Ga0207652_10000449 3300025921 Bacteria 42477
279 Ga0207652_10012447 3300025921 Bacteria 6875
280 Ga0207652_10033522 3300025921 Bacteria 4325
281 Ga0207652_10043896 3300025921 Bacteria 3807
282 Ga0207652_10131005 3300025921 Bacteria 2237
283 Ga0207652_10176440 3300025921 Bacteria 1919
284 Ga0207652_10234110 3300025921 Bacteria 1655
285 Ga0207652_10299259 3300025921 Bacteria 1452
286 Ga0207646_10002245 3300025922 Bacteria 22996
287 Ga0207694_10002198 3300025924 Bacteria 16030
288 Ga0207694_10058934 3300025924 Bacteria 2986
289 Ga0207650_10012364 3300025925 Bacteria 5894
290 Ga0207650_10103403 3300025925 Bacteria 2196
291 Ga0207650_10160363 3300025925 Bacteria 1782
292 Ga0207650_10330334 3300025925 Bacteria 1250
293 Ga0207687_10259595 3300025927 Bacteria 1385
294 Ga0207664_10017135 3300025929 Bacteria 5302
295 Ga0207664_10028859 3300025929 Bacteria 4220
296 Ga0207644_10125757 3300025931 Bacteria 1957
297 Ga0207690_10009538 3300025932 Bacteria 5765
298 Ga0207690_10050967 3300025932 Bacteria 2766
299 Ga0207690_10115128 3300025932 Bacteria 1943
300 Ga0207690_10302407 3300025932 Bacteria 1252
301 Ga0207686_10023342 3300025934 Bacteria 3571
302 Ga0207669_10025418 3300025937 Bacteria 3201
303 Ga0207704_10058926 3300025938 Bacteria 2367
304 Ga0207691_10037145 3300025940 Bacteria 4511
305 Ga0207691_10135268 3300025940 Bacteria 2174
306 Ga0207691_10211197 3300025940 Bacteria 1686
307 Ga0207691_10376463 3300025940 Bacteria 1212
308 Ga0207689_10047686 3300025942 Bacteria 3535
309 Ga0207661_10007263 3300025944 Bacteria 7880
310 Ga0207661_10013475 3300025944 Bacteria 5973
311 Ga0207661_10029925 3300025944 Bacteria 4187
312 Ga0207661_10034863 3300025944 Bacteria 3917
313 Ga0207661_10048108 3300025944 Bacteria 3387
314 Ga0207661_10069231 3300025944 Bacteria 2876
315 Ga0207661_10229062 3300025944 Bacteria 1645
316 Ga0207661_10709485 3300025944 Bacteria 925
317 Ga0207661_10773152 3300025944 Bacteria 884
318 Ga0207679_10003452 3300025945 Bacteria 9757
319 Ga0207679_10010612 3300025945 Bacteria 5935
320 Ga0207679_10018778 3300025945 Bacteria 4638
321 Ga0207679_10043252 3300025945 Bacteria 3243
322 Ga0207679_10072995 3300025945 Bacteria 2594
323 Ga0207679_10088724 3300025945 Bacteria 2385
324 Ga0207679_10164111 3300025945 Bacteria 1822
325 Ga0207679_10164165 3300025945 Bacteria 1822
326 Ga0207679_10262608 3300025945 Bacteria 1473
327 Ga0207667_10122936 3300025949 Bacteria 2674
328 Ga0207667_10374307 3300025949 Bacteria 1451
329 Ga0207667_10404274 3300025949 Bacteria 1390
330 Ga0207712_10000100 3300025961 Bacteria 97244
331 Ga0207668_10017349 3300025972 Bacteria 4509
332 Ga0207668_10204151 3300025972 Bacteria 1576
333 Ga0207668_10221249 3300025972 Bacteria 1520
334 Ga0207640_10001951 3300025981 Bacteria 11103
335 Ga0207703_10072802 3300026035 Bacteria 2841
336 Ga0207703_10967112 3300026035 Bacteria 816
337 Ga0207639_10015272 3300026041 Bacteria 5413
338 Ga0207639_10022501 3300026041 Bacteria 4540
339 Ga0207639_10159547 3300026041 Bacteria 1899
340 Ga0207678_10030078 3300026067 Bacteria 4742
341 Ga0207678_10389344 3300026067 Bacteria 1206
342 Ga0207702_10110913 3300026078 Bacteria 2439
343 Ga0207702_10226274 3300026078 Bacteria 1745
344 Ga0207641_10111677 3300026088 Bacteria 2424
345 Ga0207648_10030060 3300026089 Bacteria 4816
346 Ga0207676_10035466 3300026095 Bacteria 3786
347 Ga0207676_10046200 3300026095 Bacteria 3368
348 Ga0207674_10001954 3300026116 Bacteria 26122
349 Ga0207674_10056931 3300026116 Bacteria 3966
350 Ga0207698_10042299 3300026142 Bacteria 3402
351 Ga0207698_10124080 3300026142 Bacteria 2192
352 Ga0207698_10151172 3300026142 Bacteria 2015
353 Ga0207698_10406098 3300026142 Bacteria 1303
354 Ga0207698_10523584 3300026142 Bacteria 1157
355 Ga0207698_11121307 3300026142 Bacteria 800
356 Ga0268266_10908300 3300028379 Bacteria 852
357 Ga0268265_10057605 3300028380 Bacteria 2962
358 Ga0268264_10176516 3300028381 Bacteria 1936
359 Ga0268264_10370750 3300028381 Bacteria 1368
360 Ga0307408_100065722 3300031548 Bacteria 2661
361 Ga0307408_100137776 3300031548 Bacteria 1912
362 Ga0307408_100149172 3300031548 Bacteria 1844
363 Ga0307408_100560689 3300031548 Bacteria 1009
364 Ga0307405_10009381 3300031731 Bacteria 5014
365 Ga0307410_10007229 3300031852 Bacteria 6061
366 Ga0307410_10038576 3300031852 Bacteria 3130
367 Ga0307406_10413438 3300031901 Bacteria 1073
368 Ga0307406_10939384 3300031901 Bacteria 738
369 Ga0307407_10002693 3300031903 Bacteria 7042
370 Ga0307412_10008749 3300031911 Bacteria 5793
371 Ga0307412_10065719 3300031911 Bacteria 2456
372 Ga0307409_100057731 3300031995 Bacteria 3009
373 Ga0307416_100001271 3300032002 Bacteria 13573
374 Ga0307416_100119043 3300032002 Bacteria 2348
375 Ga0307416_100446743 3300032002 Bacteria 1344
376 Ga0307414_10066343 3300032004 Bacteria 2579
377 Ga0307414_10156769 3300032004 Bacteria 1803
378 Ga0307411_10003653 3300032005 Bacteria 7197
379 Ga0307411_10473825 3300032005 Bacteria 1053
380 Ga0307415_100003418 3300032126 Bacteria 8076
381 Ga0307415_100036146 3300032126 Bacteria 3234
382 Ga0307415_100359182 3300032126 Bacteria 1229
383 Ga0307415_100393935 3300032126 Bacteria 1180
384 Ga0373926_0010264 3300035083 Bacteria 3137
385 Ga0373954_0041383 3300035118 Bacteria 2148
386 Ga0373956_0005050 3300035119 Bacteria 5287
387 Ga0373956_0107908 3300035119 Bacteria 1295
388 Ga0373946_0203587 3300035171 Bacteria 949
389 Ga0373927_0001094 3300035695 Bacteria 20614
390 Ga0373927_0260979 3300035695 Bacteria 1139
391 Ga0373933_0001069 3300035724 Bacteria 16491
392 Ga0373947_0153777 3300035725 Bacteria 1483
393 Ga0373937_0003709 3300036401 Bacteria 12901
394 Ga0373925_0023369 3300037068 Bacteria 4511
395 Ga0395899_0044292 3300037312 Bacteria 3317
396 Ga0395900_0179546 3300037418 Bacteria 2152
397 Ga0395898_0429220 3300037466 Bacteria 1259
398 Ga0395905_0082216 3300037471 Bacteria 3018
399 Ga0395901_0007335 3300038443 Bacteria 11128
400 Ga0436365_0250284 3300039437 Bacteria 10352
401 Ga0436365_1364692 3300039437 Bacteria 6163
402 Ga0450923_059529 3300042125 Bacteria 831
403 Ga0450896_021102 3300042133 Bacteria 956
404 Ga0466966_0016396 3300044684 Bacteria 4896
405 Ga0466959_0008873 3300045049 Bacteria 7127
406 Ga0451576_0687388 3300045051 Bacteria 1075
407 Ga0495592_0305324 3300046454 Bacteria 1033
408 Ga0495629_0065134 3300046459 Bacteria 2544
409 Ga0495651_0017594 3300046462 Bacteria 5534
410 Ga0495580_0080337 3300046472 Bacteria 2273
411 Ga0495582_0071075 3300046473 Bacteria 1926
412 Ga0495639_0024813 3300046475 Bacteria 2640
413 Ga0495664_0069144 3300046477 Bacteria 2108
414 Ga0495608_0157518 3300046511 Bacteria 1445
415 Ga0495652_0097973 3300046529 Bacteria 2384
416 Ga0495586_0012508 3300046535 Bacteria 4503
417 Ga0495587_0000282 3300046536 Bacteria 35998
418 Ga0495587_0015394 3300046536 Bacteria 4778
419 Ga0495621_0025264 3300046539 Bacteria 1994
420 Ga0495645_0000080 3300046543 Bacteria 66039
421 Ga0495667_0011127 3300046559 Bacteria 6088
422 Ga0495667_0028624 3300046559 Unclassified 3753
423 Ga0495623_0002040 3300046679 Bacteria 13570
424 Ga0495623_0030392 3300046679 Bacteria 3475
425 Ga0495613_0057895 3300046689 Bacteria 2845
426 Ga0495613_0241240 3300046689 Bacteria 1264
427 Ga0495674_0392100 3300047319 Bacteria 1122
428 Ga0495675_0011847 3300047444 Bacteria 5480
429 Ga0495675_0024957 3300047444 Bacteria 3813
430 Ga0495675_0082528 3300047444 Bacteria 2024
431 Ga0495684_0037823 3300047471 Bacteria 3702
432 Ga0495615_0014953 3300048090 Bacteria 1650
433 Ga0496107_0209398 3300048910 Bacteria 1450
434 Ga0496108_0387108 3300048911 Bacteria 1221
435 Ga0496108_0390673 3300048911 Bacteria 1215
436 Ga0496109_0137079 3300048912 Bacteria 2287
437 Ga0496109_0195318 3300048912 Bacteria 1902
438 Ga0496112_0002879 3300048915 Bacteria 13997
439 Ga0496112_0173293 3300048915 Bacteria 2123
440 Ga0496112_0729495 3300048915 Bacteria 918
441 Ga0496113_0228870 3300048916 Bacteria 1482
442 Ga0496114_0132195 3300048917 Bacteria 2156
443 Ga0501036_0566798 3300049572 Bacteria 943
444 Ga0501071_0183377 3300049587 Bacteria 1569
445 Ga0501080_0406323 3300049742 Bacteria 1225
446 Ga0501081_0123284 3300049743 Bacteria 1848
447 nmdc:mga09592_7744_c1 3300050508 Bacteria 8732
448 nmdc:mga0qj67_409475_c1 3300050509 Bacteria 1094
449 nmdc:mga06r32_798969_c1 3300050510 Bacteria 904
450 nmdc:mga08x19_382752_c1 3300050514 Bacteria 985
451 nmdc:mga08x19_6372_c1 3300050514 Bacteria 6987
452 nmdc:mga08x19_7349_c1 3300050514 Bacteria 6545
453 Ga0495601_0201242 3300053077 Bacteria 1301
454 Ga0495612_0076308 3300053078 Bacteria 1404
455 Ga0530510_0544891 3300061734 Bacteria 881
456 Ga0105240_10967690
457 Ga0058862_12857762
458 Ga0070658_10000609
459 Ga0070658_10003341
460 Ga0070658_10006051
461 Ga0070658_10034370
462 Ga0070658_10118083
463 Ga0070658_10179417
464 Ga0070658_10188759
465 Ga0070658_10232565
466 Ga0070676_10007795
467 Ga0070683_100000808
468 Ga0070683_100001847
469 Ga0070683_100006682
470 Ga0070683_100013319
471 Ga0070683_100037373
472 Ga0070683_100090115
473 Ga0070683_100119547
474 Ga0070683_100131920
475 Ga0070683_100644230
476 Ga0070683_100786035
477 Ga0070690_100043877
478 Ga0070670_100035390
479 Ga0070670_100171479
480 Ga0070670_100307418
481 Ga0070670_100482932
482 Ga0068869_100648978
483 Ga0070680_100000021
484 Ga0070680_100000286
485 Ga0070680_100015110
486 Ga0070680_100024915
487 Ga0070680_100111490
488 Ga0070680_100125308
489 Ga0070680_100247907
490 Ga0070680_100348590
491 Ga0070682_100000385
492 Ga0070682_100061817
493 Ga0070682_100082944
494 Ga0070682_100157923
495 Ga0068868_100446145
496 Ga0070660_100002512
497 Ga0070660_100036024
498 Ga0070660_100047669
499 Ga0070660_100168954
500 Ga0070660_100352689
501 Ga0070660_100357337
502 Ga0070691_10010369
503 Ga0070687_100015865
504 Ga0070661_100003786
505 Ga0070661_100020989
506 Ga0070661_100061204
507 Ga0070661_100291524
508 Ga0070661_100504703
509 Ga0070668_100024159
510 Ga0070668_100216983
511 Ga0070668_100472895
512 Ga0070669_100014249
513 Ga0070675_100001146
514 Ga0070675_100117213
515 Ga0070675_100127531
516 Ga0070671_100133649
517 Ga0070674_100081148
518 Ga0070674_100153035
519 Ga0070674_100311226
520 Ga0070673_100268882
521 Ga0070673_100279891
522 Ga0070688_100001561
523 Ga0070659_100083782
524 Ga0070659_100487135
525 Ga0070667_100632138
526 Ga0070714_100007190
527 Ga0070714_100044539
528 Ga0070714_100062353
529 Ga0070713_100022996
530 Ga0070701_10173323
531 Ga0070708_100000184
532 Ga0070663_100037007
533 Ga0070663_100190969
534 Ga0070663_100255585
535 Ga0070662_100426836
536 Ga0070681_10000349
537 Ga0070681_10003731
538 Ga0070681_10004940
539 Ga0070681_10013838
540 Ga0070681_10207582
541 Ga0070681_10336921
542 Ga0070681_10409041
543 Ga0070681_10409702
544 Ga0068867_100012909
545 Ga0070685_10003725
546 Ga0070706_100321593
547 Ga0070707_100004384
548 Ga0070698_100016406
549 Ga0070699_100003793
550 Ga0070699_100148217
551 Ga0070679_100000151
552 Ga0070679_100003260
553 Ga0070679_100006652
554 Ga0070679_100007661
555 Ga0070679_100010762
556 Ga0070679_100039574
557 Ga0070679_100128054
558 Ga0070679_100260246
559 Ga0070679_100440716
560 Ga0070679_100444213
561 Ga0070684_100002472
562 Ga0070684_100005075
563 Ga0070684_100032761
564 Ga0070684_100036370
565 Ga0070684_100038936
566 Ga0070684_100716772
567 Ga0068853_100012267
568 Ga0068853_100036352
569 Ga0068853_100055167
570 Ga0070672_100100998
571 Ga0070672_100261883
572 Ga0070672_100384078
573 Ga0070696_100000539
574 Ga0070696_100536184
575 Ga0070693_100032618
576 Ga0070693_100198019
577 Ga0070665_100038213
578 Ga0068855_100083559
579 Ga0068855_100170895
580 Ga0068855_100226970
581 Ga0068855_100414025
582 Ga0068855_100476334
583 Ga0070664_100005835
584 Ga0070664_100027221
585 Ga0070664_100059171
586 Ga0070664_100092351
587 Ga0070664_100100348
588 Ga0070664_100347255
589 Ga0070664_100534167
590 Ga0068857_100007907
591 Ga0068857_100030041
592 Ga0068854_100027898
593 Ga0068854_100038538
594 Ga0068854_100073410
595 Ga0068856_100028142
596 Ga0068856_100119077
597 Ga0068856_100674962
598 Ga0070702_100074351
599 Ga0070702_100171679
600 Ga0068852_100108443
601 Ga0068852_100126535
602 Ga0068852_100210699
603 Ga0068852_100911806
604 Ga0068859_100021527
605 Ga0068859_100122670
606 Ga0068859_100741311
607 Ga0068864_100017420
608 Ga0068866_10018025
609 Ga0068863_100096771
610 Ga0068858_100225537
611 Ga0068860_100416093
612 Ga0068862_100081279
613 Ga0081539_10010429
614 Ga0070717_10261354
615 Ga0097621_100470237
616 Ga0075430_100032018
617 Ga0075430_100351732
618 Ga0075431_100161950
619 Ga0075431_100323739
620 Ga0068865_100014302
621 Ga0075436_100003051
622 Ga0075436_100059257
623 Ga0097620_100021527
624 Ga0097620_100122668
625 Ga0097620_100741277
626 Ga0105240_10005345
627 Ga0105240_10052255
628 Ga0105240_10557579
629 Ga0105240_11016792
630 Ga0105245_10351442
631 Ga0105245_10656320
632 Ga0114129_10339327
633 Ga0105243_10053833
634 Ga0105241_10069413
635 Ga0105241_10569088
636 Ga0105242_10006416
637 Ga0105248_10370363
638 Ga0105237_10017475
639 Ga0105238_10008280
640 Ga0105249_10000027
641 Ga0105249_10072537
642 Ga0105246_10655146
643 Ga0157373_10002494
644 Ga0157373_10101222
645 Ga0157371_10124992
646 Ga0157371_10294113
647 Ga0157371_10391349
648 Ga0157370_10001812
649 Ga0157370_10002331
650 Ga0157370_10007295
651 Ga0157370_10042840
652 Ga0157370_10044457
653 Ga0157370_10051322
654 Ga0157370_10257121
655 Ga0157369_10026741
656 Ga0157369_10031682
657 Ga0157369_10037226
658 Ga0157369_10166332
659 Ga0157369_10174543
660 Ga0157369_10441744
661 Ga0157369_10527111
662 Ga0157374_10043211
663 Ga0157378_10147543
664 Ga0157372_10003953
665 Ga0157372_10006880
666 Ga0157372_10007324
667 Ga0157372_10034056
668 Ga0157372_10044072
669 Ga0157372_10044936
670 Ga0157372_10229363
671 Ga0157372_10672021
672 Ga0157375_10442126
673 Ga0157375_11368222
674 Ga0182008_10003345
675 Ga0157377_10093975
676 Ga0157376_10051091
677 Ga0163161_10590460
678 Ga0197907_10774144
679 Ga0206356_11115348
680 Ga0206354_10033046
681 Ga0207656_10125400
682 Ga0207642_10007282
683 Ga0207680_10164635
684 Ga0207645_10136533
685 Ga0207645_10447309
686 Ga0207643_10019427
687 Ga0207643_10045047
688 Ga0207643_10051793
689 Ga0207705_10002432
690 Ga0207705_10034862
691 Ga0207705_10039136
692 Ga0207705_10077203
693 Ga0207705_10217938
694 Ga0207705_10516387
695 Ga0207705_10604786
696 Ga0207705_10617698
697 Ga0207684_10544238
698 Ga0207707_10000871
699 Ga0207707_10002094
700 Ga0207707_10003778
701 Ga0207707_10005616
702 Ga0207707_10014449
703 Ga0207707_10016868
704 Ga0207707_10194984
705 Ga0207707_10521161
706 Ga0207695_10008985
707 Ga0207695_10011789
708 Ga0207695_10366194
709 Ga0207671_10316343
710 Ga0207660_10000239
711 Ga0207660_10001736
712 Ga0207660_10009246
713 Ga0207660_10016236
714 Ga0207660_10019250
715 Ga0207660_10025692
716 Ga0207660_10032984
717 Ga0207660_10237281
718 Ga0207660_10325326
719 Ga0207662_10007498
720 Ga0207662_10027917
721 Ga0207657_10002488
722 Ga0207657_10008513
723 Ga0207657_10015065
724 Ga0207657_10061224
725 Ga0207657_10080168
726 Ga0207657_10118059
727 Ga0207657_10267607
728 Ga0207649_10003199
729 Ga0207649_10011687
730 Ga0207649_10025479
731 Ga0207649_10066677
732 Ga0207649_10118946
733 Ga0207652_10000449
734 Ga0207652_10012447
735 Ga0207652_10033522
736 Ga0207652_10043896
737 Ga0207652_10131005
738 Ga0207652_10176440
739 Ga0207652_10234110
740 Ga0207652_10299259
741 Ga0207646_10002245
742 Ga0207694_10002198
743 Ga0207694_10058934
744 Ga0207650_10012364
745 Ga0207650_10103403
746 Ga0207650_10160363
747 Ga0207650_10330334
748 Ga0207687_10259595
749 Ga0207664_10017135
750 Ga0207664_10028859
751 Ga0207644_10125757
752 Ga0207690_10009538
753 Ga0207690_10050967
754 Ga0207690_10115128
755 Ga0207690_10302407
756 Ga0207686_10023342
757 Ga0207669_10025418
758 Ga0207704_10058926
759 Ga0207691_10037145
760 Ga0207691_10135268
761 Ga0207691_10211197
762 Ga0207691_10376463
763 Ga0207689_10047686
764 Ga0207661_10007263
765 Ga0207661_10013475
766 Ga0207661_10029925
767 Ga0207661_10034863
768 Ga0207661_10048108
769 Ga0207661_10069231
770 Ga0207661_10229062
771 Ga0207661_10709485
772 Ga0207661_10773152
773 Ga0207679_10003452
774 Ga0207679_10010612
775 Ga0207679_10018778
776 Ga0207679_10043252
777 Ga0207679_10072995
778 Ga0207679_10088724
779 Ga0207679_10164111
780 Ga0207679_10164165
781 Ga0207679_10262608
782 Ga0207667_10122936
783 Ga0207667_10374307
784 Ga0207667_10404274
785 Ga0207712_10000100
786 Ga0207668_10017349
787 Ga0207668_10204151
788 Ga0207668_10221249
789 Ga0207640_10001951
790 Ga0207703_10072802
791 Ga0207703_10967112
792 Ga0207639_10015272
793 Ga0207639_10022501
794 Ga0207639_10159547
795 Ga0207678_10030078
796 Ga0207678_10389344
797 Ga0207702_10110913
798 Ga0207702_10226274
799 Ga0207641_10111677
800 Ga0207648_10030060
801 Ga0207676_10035466
802 Ga0207676_10046200
803 Ga0207674_10001954
804 Ga0207674_10056931
805 Ga0207698_10042299
806 Ga0207698_10124080
807 Ga0207698_10151172
808 Ga0207698_10406098
809 Ga0207698_10523584
810 Ga0207698_11121307
811 Ga0268266_10908300
812 Ga0268265_10057605
813 Ga0268264_10176516
814 Ga0268264_10370750
815 Ga0307408_100065722
816 Ga0307408_100137776
817 Ga0307408_100149172
818 Ga0307408_100560689
819 Ga0307405_10009381
820 Ga0307410_10007229
821 Ga0307410_10038576
822 Ga0307406_10413438
823 Ga0307406_10939384
824 Ga0307407_10002693
825 Ga0307412_10008749
826 Ga0307412_10065719
827 Ga0307409_100057731
828 Ga0307416_100001271
829 Ga0307416_100119043
830 Ga0307416_100446743
831 Ga0307414_10066343
832 Ga0307414_10156769
833 Ga0307411_10003653
834 Ga0307411_10473825
835 Ga0307415_100003418
836 Ga0307415_100036146
837 Ga0307415_100359182
838 Ga0307415_100393935
839 Ga0373926_0010264
840 Ga0373954_0041383
841 Ga0373956_0005050
842 Ga0373956_0107908
843 Ga0373946_0203587
844 Ga0373927_0001094
845 Ga0373927_0260979
846 Ga0373933_0001069
847 Ga0373947_0153777
848 Ga0373937_0003709
849 Ga0373925_0023369
850 Ga0395899_0044292
851 Ga0395900_0179546
852 Ga0395898_0429220
853 Ga0395905_0082216
854 Ga0395901_0007335
855 Ga0436365_0250284
856 Ga0436365_1364692
857 Ga0450923_059529
858 Ga0450896_021102
859 Ga0466966_0016396
860 Ga0466959_0008873
861 Ga0451576_0687388
862 Ga0495592_0305324
863 Ga0495629_0065134
864 Ga0495651_0017594
865 Ga0495580_0080337
866 Ga0495582_0071075
867 Ga0495639_0024813
868 Ga0495664_0069144
869 Ga0495608_0157518
870 Ga0495652_0097973
871 Ga0495586_0012508
872 Ga0495587_0000282
873 Ga0495587_0015394
874 Ga0495621_0025264
875 Ga0495645_0000080
876 Ga0495667_0011127
877 Ga0495667_0028624
878 Ga0495623_0002040
879 Ga0495623_0030392
880 Ga0495613_0057895
881 Ga0495613_0241240
882 Ga0495674_0392100
883 Ga0495675_0011847
884 Ga0495675_0024957
885 Ga0495675_0082528
886 Ga0495684_0037823
887 Ga0495615_0014953
888 Ga0496107_0209398
889 Ga0496108_0387108
890 Ga0496108_0390673
891 Ga0496109_0137079
892 Ga0496109_0195318
893 Ga0496112_0002879
894 Ga0496112_0173293
895 Ga0496112_0729495
896 Ga0496113_0228870
897 Ga0496114_0132195
898 Ga0501036_0566798
899 Ga0501071_0183377
900 Ga0501080_0406323
901 Ga0501081_0123284
902 nmdc:mga09592_7744_c1
903 nmdc:mga0qj67_409475_c1
904 nmdc:mga06r32_798969_c1
905 nmdc:mga08x19_382752_c1
906 nmdc:mga08x19_6372_c1
907 nmdc:mga08x19_7349_c1
908 Ga0495601_0201242
909 Ga0495612_0076308
910 Ga0530510_0544891

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00834

Ribul_P_3_epim

Ribulose-phosphate 3 epimerase family

32

229

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b1w-assembly2.cif.gz_K-3 crystal structure of plastidial ribulose epimerase rpe1 from the model alga chlamydomonas reinhardtii 0.9909 2 214
1rpx-assembly1.cif.gz_A d-ribulose-5-phosphate 3-epimerase from solanum tuberosum chloroplasts 0.9895 2 217
1tqj-assembly1.cif.gz_B crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9835 3 217
1tqj-assembly1.cif.gz_E crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9834 3 217
7sbj-assembly1.cif.gz_C crystal structure of ribulose-phosphate 3-epimerase from stenotrophomonas maltophilia k279a 0.9833 5 218
ID Description Score Start End Superfamily
1tqjD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9831 3 217 3.20.20.70
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9802 1 217 3.20.20.70
af_Q58093_1_217_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9787 4 218 3.20.20.70
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9741 4 220 3.20.20.70
af_A0A1D6PJ99_41_293_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9667 2 208 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A1Q7GP24-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9902 9 218 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A1Q7VCL4-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9901 4 216 GO:0004750
GO:0005975
GO:0006098
GO:0046872
AF-A0A3A4WSM3-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9898 4 219 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A532D558-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9888 1 218 GO:0000049
GO:0004750
GO:0004826
GO:0005524
GO:0005737
GO:0005975
GO:0006098
GO:0006432
GO:0046872
AF-A0A349LF31-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9885 4 179 GO:0004750
GO:0005975
GO:0006098

Map