F447453

General Info

Members Datasets Scaffolds Average Seq Length
454 337 908 192

Family's Representative Sequence

Representative Sequence 3300048923|Ga0496120_0058143|Ga0496120_0058143_398_1060
Length 220
Sequence MYYYDRNSIARASRFCGRGDKRACKEAELARYDKGYRDTTRRHILDVASAQFRESGIAAVGLAGIMSEAGLTNGAFYTHFESKEDLVRAVLLDALERREQRHKDNLANGVALETTIRDYLSPRHRDRAATGCPTAALASEIARHPKATRDAFTGKMSDILALVAAQMPDGSAAERRRRAISVYATMVGALQLSRAVNDRQLSEEILENAVEAALTLANGP

Samples

Sample ID Description Type Environment
1 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
62 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
65 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
100 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
109 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
110 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
123 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
124 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
125 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
138 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
139 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
148 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
165 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
173 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
183 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
220 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
221 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
222 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
223 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
224 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
225 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
226 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
227 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
228 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
229 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
230 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
231 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
232 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
233 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
234 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
235 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
236 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
237 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
238 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
239 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
240 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
241 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
242 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
243 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
244 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
245 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
246 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
247 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
248 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
249 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
250 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
251 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
252 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
253 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
254 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
255 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
256 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
257 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
258 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
259 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
260 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
261 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
262 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
263 2922368715
264 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
265 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
266 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
267 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
268 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
269 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
270 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
271 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
272 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
273 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
274 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
275 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
276 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
277 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
278 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
279 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
280 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
281 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
282 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
283 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
284 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
285 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
286 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
287 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
288 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
289 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
290 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
291 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
292 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
293 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
294 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
295 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
296 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
297 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
298 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
299 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
300 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
301 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
302 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
303 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
304 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
305 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
306 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
307 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
308 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
309 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
310 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
311 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
312 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
313 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
314 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
315 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
316 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
317 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
318 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
319 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
320 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
321 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
322 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
323 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
324 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
325 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
326 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
327 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
328 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
329 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
330 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
331 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
332 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
333 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
334 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
335 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
336 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
337 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.13
Metatranscriptomes 0
Isolates 19.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.78
Nodule 18.06
Rhizoplane 5.29
Rhizosphere 53.96
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496120_0058143 3300048923 Bacteria 2173
2 JGI25153J46596_10008166 3300003215 Bacteria 5042
3 rootH2_10104247 3300003320 Bacteria 2618
4 rootL2_10206909 3300003322 Bacteria 1096
5 rootL2_10251737 3300003322 Bacteria 1592
6 rootH1_10245649 3300003323 Bacteria 2959
7 JGI25160J50197_1000639 3300003354 Bacteria 19529
8 Ga0065165_1001514 3300005262 Bacteria 24527
9 Ga0070658_10002020 3300005327 Bacteria 17020
10 Ga0070658_10095423 3300005327 Bacteria 2455
11 Ga0070683_100385876 3300005329 Bacteria 1335
12 Ga0070670_100539242 3300005331 Bacteria 1040
13 Ga0068868_100934351 3300005338 Bacteria 790
14 Ga0070661_100088190 3300005344 Bacteria 2296
15 Ga0070692_10236873 3300005345 Bacteria 1086
16 Ga0070668_100166512 3300005347 Bacteria 1792
17 Ga0070659_100331085 3300005366 Bacteria 1274
18 Ga0070667_100350824 3300005367 Bacteria 1336
19 Ga0070713_101078155 3300005436 Bacteria 776
20 Ga0070663_100100126 3300005455 Bacteria 2161
21 Ga0070698_100331485 3300005471 Bacteria 1453
22 Ga0070684_100411280 3300005535 Bacteria 1248
23 Ga0068853_100096604 3300005539 Bacteria 2607
24 Ga0068853_100193507 3300005539 Bacteria 1849
25 Ga0070693_100211039 3300005547 Bacteria 1267
26 Ga0070665_100017463 3300005548 Bacteria 7204
27 Ga0070665_100061308 3300005548 Bacteria 3770
28 Ga0070665_100145337 3300005548 Bacteria 2375
29 Ga0070665_100329401 3300005548 Bacteria 1531
30 Ga0068855_101048492 3300005563 Bacteria 855
31 Ga0068857_100422402 3300005577 Bacteria 1243
32 Ga0068856_100035819 3300005614 Bacteria 4865
33 Ga0068856_100978070 3300005614 Bacteria 865
34 Ga0068852_100000659 3300005616 Bacteria 22613
35 Ga0068852_100466456 3300005616 Bacteria 1253
36 Ga0068852_101479109 3300005616 Bacteria 701
37 Ga0068851_10292619 3300005834 Bacteria 934
38 Ga0068862_100664330 3300005844 Bacteria 1006
39 Ga0068862_100723895 3300005844 Bacteria 966
40 Ga0070717_10000741 3300006028 Bacteria 21261
41 Ga0075363_100020265 3300006048 Bacteria 3333
42 Ga0075364_10037278 3300006051 Bacteria 3147
43 Ga0075367_10094629 3300006178 Bacteria 1821
44 Ga0075369_10024275 3300006186 Bacteria 2511
45 Ga0075370_10045151 3300006353 Bacteria 2491
46 Ga0099794_10194946 3300007265 Bacteria 1037
47 Ga0099795_10039275 3300007788 Bacteria 1674
48 Ga0105240_10004352 3300009093 Bacteria 21620
49 Ga0105240_10191330 3300009093 Bacteria 2406
50 Ga0105240_10211306 3300009093 Bacteria 2267
51 Ga0105245_10102234 3300009098 Bacteria 2654
52 Ga0105245_10127526 3300009098 Bacteria 2384
53 Ga0105245_10365919 3300009098 Bacteria 1432
54 Ga0105247_10225296 3300009101 Bacteria 1271
55 Ga0105243_10257595 3300009148 Bacteria 1561
56 Ga0105243_10326663 3300009148 Bacteria 1400
57 Ga0105241_10019284 3300009174 Bacteria 5030
58 Ga0105241_10058864 3300009174 Bacteria 2951
59 Ga0105241_10908233 3300009174 Bacteria 818
60 Ga0105248_10069556 3300009177 Bacteria 3952
61 Ga0105248_10783577 3300009177 Bacteria 1076
62 Ga0105237_10002008 3300009545 Bacteria 25903
63 Ga0105237_10135488 3300009545 Bacteria 2457
64 Ga0105237_10218740 3300009545 Bacteria 1905
65 Ga0105238_10004293 3300009551 Bacteria 14146
66 Ga0105238_10104871 3300009551 Bacteria 2808
67 Ga0105238_10434203 3300009551 Bacteria 1309
68 Ga0105249_11014818 3300009553 Bacteria 899
69 Ga0099796_10068341 3300010159 Bacteria 1276
70 Ga0105239_10024054 3300010375 Bacteria 6710
71 Ga0105239_10123138 3300010375 Bacteria 2881
72 Ga0105239_10167807 3300010375 Bacteria 2455
73 Ga0105239_10250582 3300010375 Bacteria 1989
74 Ga0105239_10441283 3300010375 Unclassified 1476
75 Ga0105246_10261932 3300011119 Bacteria 1378
76 Ga0105246_10305819 3300011119 Bacteria 1286
77 Ga0157369_10328513 3300013105 Bacteria 1589
78 Ga0157369_10491483 3300013105 Bacteria 1270
79 Ga0157374_10041636 3300013296 Bacteria 4234
80 Ga0157374_10084818 3300013296 Bacteria 3011
81 Ga0157374_11001228 3300013296 Bacteria 855
82 Ga0157378_10155815 3300013297 Bacteria 2132
83 Ga0163162_10871334 3300013306 Bacteria 1015
84 Ga0157375_10274871 3300013308 Bacteria 1847
85 Ga0163163_10241124 3300014325 Bacteria 1857
86 Ga0163163_11660187 3300014325 Bacteria 700
87 Ga0182008_10474537 3300014497 Bacteria 684
88 Ga0157379_10670694 3300014968 Unclassified 972
89 Ga0157376_11464127 3300014969 Bacteria 715
90 Ga0182007_10151758 3300015262 Bacteria 788
91 Ga0163161_10291601 3300017792 Bacteria 1283
92 Ga0214544_1003798 3300021320 Bacteria 30812
93 Ga0209677_100425 3300025253 Bacteria 25052
94 Ga0209148_1000303 3300025254 Bacteria 70843
95 Ga0209233_1006678 3300025261 Bacteria 3700
96 Ga0209455_1005024 3300025272 Bacteria 4190
97 Ga0209673_1052381 3300025273 Bacteria 1071
98 Ga0209564_1007716 3300025295 Bacteria 5479
99 Ga0209758_1003188 3300025297 Bacteria 15320
100 Ga0209758_1003443 3300025297 Bacteria 14393
101 Ga0209256_1040830 3300025299 Bacteria 1182
102 Ga0207426_1000237 3300025302 Bacteria 124707
103 Ga0207426_1001374 3300025302 Bacteria 20609
104 Ga0207426_1050499 3300025302 Bacteria 1240
105 Ga0207647_10023088 3300025904 Bacteria 4119
106 Ga0207647_10188250 3300025904 Bacteria 1196
107 Ga0207705_10022360 3300025909 Bacteria 4509
108 Ga0207654_10032509 3300025911 Bacteria 2884
109 Ga0207654_10429982 3300025911 Bacteria 923
110 Ga0207695_10000006 3300025913 Bacteria 1135309
111 Ga0207695_10197674 3300025913 Bacteria 1926
112 Ga0207671_10002154 3300025914 Bacteria 21445
113 Ga0207657_10171480 3300025919 Bacteria 1757
114 Ga0207649_10037086 3300025920 Bacteria 2942
115 Ga0207649_10162616 3300025920 Bacteria 1548
116 Ga0207694_10035644 3300025924 Bacteria 3818
117 Ga0207694_10285457 3300025924 Bacteria 1356
118 Ga0207700_10838078 3300025928 Bacteria 823
119 Ga0207644_10050646 3300025931 Bacteria 2978
120 Ga0207690_10690321 3300025932 Bacteria 839
121 Ga0207709_10368233 3300025935 Bacteria 1090
122 Ga0207665_10367894 3300025939 Bacteria 1088
123 Ga0207661_10711825 3300025944 Bacteria 924
124 Ga0207667_10157964 3300025949 Bacteria 2333
125 Ga0207667_10332632 3300025949 Bacteria 1551
126 Ga0207668_10323461 3300025972 Bacteria 1281
127 Ga0207668_10362501 3300025972 Bacteria 1215
128 Ga0207640_10505831 3300025981 Bacteria 1007
129 Ga0207677_10216086 3300026023 Bacteria 1534
130 Ga0207703_10522285 3300026035 Bacteria 1117
131 Ga0207639_10106268 3300026041 Bacteria 2278
132 Ga0207678_10538400 3300026067 Bacteria 1020
133 Ga0207702_10281009 3300026078 Bacteria 1574
134 Ga0207702_10960121 3300026078 Bacteria 848
135 Ga0207674_10519065 3300026116 Bacteria 1151
136 Ga0207675_100105353 3300026118 Bacteria 2658
137 Ga0207698_10578869 3300026142 Bacteria 1104
138 Ga0207698_10918677 3300026142 Bacteria 883
139 Ga0268266_10000043 3300028379 Bacteria 316604
140 Ga0268266_10048901 3300028379 Bacteria 3625
141 Ga0268266_10177196 3300028379 Bacteria 1939
142 Ga0268265_10457067 3300028380 Bacteria 1194
143 Ga0268264_10588099 3300028381 Bacteria 1096
144 Ga0265334_10009488 3300028573 Bacteria 4117
145 Ga0265330_10028213 3300031235 Bacteria 2531
146 Ga0265330_10109511 3300031235 Bacteria 1180
147 Ga0265332_10063628 3300031238 Bacteria 1576
148 Ga0265328_10039035 3300031239 Bacteria 1752
149 Ga0265328_10078796 3300031239 Bacteria 1214
150 Ga0265325_10007516 3300031241 Bacteria 6515
151 Ga0265339_10023439 3300031249 Bacteria 3568
152 Ga0265339_10297491 3300031249 Bacteria 770
153 Ga0265316_10042428 3300031344 Bacteria 3636
154 Ga0307508_10199118 3300031616 Bacteria 1604
155 Ga0265314_10091802 3300031711 Bacteria 1975
156 Ga0307510_10096626 3300033180 Bacteria 2769
157 Ga0307510_10267792 3300033180 Bacteria 1186
158 Ga0373934_0000949 3300035086 Bacteria 10502
159 Ga0373923_0002287 3300035111 Bacteria 5848
160 Ga0373936_0137747 3300035113 Bacteria 1052
161 Ga0373953_0000212 3300035117 Bacteria 15800
162 Ga0373954_0002468 3300035118 Bacteria 7758
163 Ga0373956_0008777 3300035119 Bacteria 4094
164 Ga0373957_0001175 3300035120 Bacteria 6968
165 Ga0373955_0000746 3300035172 Bacteria 13994
166 Ga0373924_0041789 3300035410 Bacteria 1879
167 Ga0373933_0003913 3300035724 Bacteria 8217
168 Ga0373937_0018618 3300036401 Bacteria 6203
169 Ga0395900_0029519 3300037418 Bacteria 5625
170 Ga0436364_0552336 3300037853 Bacteria 813
171 Ga0451833_0104717 3300041491 Bacteria 1035
172 Ga0451841_0052677 3300041498 Bacteria 693
173 Ga0466969_0119489 3300044656 Bacteria 1228
174 Ga0466972_0000054 3300044658 Bacteria 111745
175 Ga0466966_0001292 3300044684 Bacteria 16038
176 Ga0466961_0000009 3300044693 Bacteria 139001
177 Ga0466968_0075913 3300044735 Bacteria 1470
178 Ga0466970_0212053 3300044765 Bacteria 1079
179 Ga0466957_0089468 3300044842 Bacteria 1927
180 Ga0466959_0006275 3300045049 Bacteria 8214
181 Ga0466959_0483113 3300045049 Bacteria 838
182 Ga0466967_0049672 3300045976 Bacteria 3669
183 Ga0466967_0621590 3300045976 Bacteria 1067
184 Ga0495592_0090620 3300046454 Bacteria 2193
185 Ga0495629_0000655 3300046459 Bacteria 27984
186 Ga0495638_0001053 3300046460 Bacteria 27149
187 Ga0495651_0029160 3300046462 Bacteria 4303
188 Ga0495651_0119276 3300046462 Bacteria 1940
189 Ga0495653_0009420 3300046463 Bacteria 7990
190 Ga0495650_0090738 3300046471 Bacteria 1163
191 Ga0495605_0121834 3300046474 Bacteria 1182
192 Ga0495585_0077174 3300046492 Bacteria 1809
193 Ga0495606_0046457 3300046507 Bacteria 2870
194 Ga0495606_0072489 3300046507 Bacteria 2164
195 Ga0495606_0129779 3300046507 Bacteria 1499
196 Ga0495606_0393792 3300046507 Bacteria 723
197 Ga0495608_0002085 3300046511 Bacteria 14405
198 Ga0495608_0082868 3300046511 Bacteria 2082
199 Ga0495610_0139064 3300046512 Bacteria 1047
200 Ga0495618_0066319 3300046514 Bacteria 2295
201 Ga0495618_0080848 3300046514 Bacteria 2074
202 Ga0495620_0056123 3300046515 Bacteria 1658
203 Ga0495628_0007622 3300046516 Bacteria 9352
204 Ga0495631_0261020 3300046518 Bacteria 738
205 Ga0495632_0095718 3300046519 Bacteria 1403
206 Ga0495643_0050511 3300046522 Bacteria 2239
207 Ga0495643_0132863 3300046522 Bacteria 1248
208 Ga0495648_0095827 3300046524 Bacteria 1650
209 Ga0495648_0193260 3300046524 Bacteria 1025
210 Ga0495652_0003985 3300046529 Bacteria 14303
211 Ga0495652_0045685 3300046529 Bacteria 3763
212 Ga0495652_0178604 3300046529 Bacteria 1631
213 Ga0495652_0378255 3300046529 Bacteria 1008
214 Ga0495654_0284373 3300046530 Bacteria 679
215 Ga0495640_0004949 3300046533 Bacteria 10592
216 Ga0495640_0038564 3300046533 Bacteria 3360
217 Ga0495587_0012313 3300046536 Bacteria 5390
218 Ga0495587_0384474 3300046536 Bacteria 780
219 Ga0495609_0217272 3300046538 Bacteria 795
220 Ga0495609_0232530 3300046538 Bacteria 763
221 Ga0495645_0019048 3300046543 Bacteria 4941
222 Ga0495622_0029269 3300046557 Bacteria 2574
223 Ga0495622_0036671 3300046557 Bacteria 2285
224 Ga0495622_0049737 3300046557 Bacteria 1946
225 Ga0495667_0003203 3300046559 Bacteria 10970
226 Ga0495668_0179112 3300046616 Bacteria 1161
227 Ga0495668_0333785 3300046616 Bacteria 832
228 Ga0495634_0010233 3300046642 Bacteria 6877
229 Ga0495634_0039167 3300046642 Bacteria 3229
230 Ga0495611_0092961 3300046648 Bacteria 1395
231 Ga0495625_0000909 3300046660 Bacteria 39875
232 Ga0495625_0087143 3300046660 Bacteria 2165
233 Ga0495635_0000380 3300046663 Bacteria 28177
234 Ga0495635_0018937 3300046663 Bacteria 4805
235 Ga0495661_0287436 3300046665 Bacteria 827
236 Ga0495588_0037511 3300046674 Bacteria 2463
237 Ga0495588_0515762 3300046674 Bacteria 626
238 Ga0495657_0012622 3300046675 Bacteria 6268
239 Ga0495599_0069166 3300046678 Bacteria 2203
240 Ga0495623_0245695 3300046679 Bacteria 1009
241 Ga0495646_0030545 3300046680 Bacteria 3364
242 Ga0495646_0450737 3300046680 Bacteria 664
243 Ga0495613_0019838 3300046689 Bacteria 5011
244 Ga0495624_0034862 3300046690 Bacteria 3252
245 Ga0495624_0587012 3300046690 Bacteria 664
246 Ga0495671_0330340 3300046692 Bacteria 732
247 Ga0495649_0019604 3300046694 Bacteria 3800
248 Ga0495600_0015130 3300046809 Bacteria 4873
249 Ga0495600_0015580 3300046809 Bacteria 4810
250 Ga0495581_0074359 3300047315 Bacteria 1966
251 Ga0495604_0018964 3300047317 Bacteria 5508
252 Ga0495604_0019378 3300047317 Bacteria 5445
253 Ga0495674_0744056 3300047319 Bacteria 766
254 Ga0495674_0754927 3300047319 Unclassified 760
255 Ga0495676_0114850 3300047321 Bacteria 1969
256 Ga0495680_0117861 3300047322 Bacteria 1962
257 Ga0495687_004652 3300047443 Bacteria 9162
258 Ga0495687_006023 3300047443 Bacteria 7556
259 Ga0495687_067790 3300047443 Bacteria 1443
260 Ga0495675_0006538 3300047444 Bacteria 7135
261 Ga0495677_0208783 3300047445 Bacteria 760
262 Ga0495673_0123984 3300047469 Bacteria 1021
263 Ga0495684_0000294 3300047471 Bacteria 40596
264 Ga0495593_0002223 3300047673 Bacteria 11637
265 Ga0495593_0042856 3300047673 Bacteria 2428
266 Ga0495602_0094151 3300048088 Bacteria 2476
267 Ga0495602_0306299 3300048088 Bacteria 1161
268 Ga0495602_0480007 3300048088 Bacteria 872
269 Ga0495626_0045127 3300048091 Bacteria 2059
270 Ga0496100_0061344 3300048903 Bacteria 2478
271 Ga0496100_0499194 3300048903 Bacteria 937
272 Ga0496101_0065951 3300048904 Bacteria 2640
273 Ga0496101_0185339 3300048904 Bacteria 1604
274 Ga0496103_0018843 3300048906 Bacteria 4143
275 Ga0496104_0036761 3300048907 Bacteria 4578
276 Ga0496104_0040694 3300048907 Bacteria 4357
277 Ga0496104_0074590 3300048907 Bacteria 3229
278 Ga0496104_0681038 3300048907 Bacteria 936
279 Ga0496105_0026568 3300048908 Bacteria 4724
280 Ga0496105_0063997 3300048908 Bacteria 3034
281 Ga0496105_0789938 3300048908 Bacteria 722
282 Ga0496106_0346503 3300048909 Bacteria 1193
283 Ga0496107_0530616 3300048910 Bacteria 872
284 Ga0496108_0231588 3300048911 Bacteria 1606
285 Ga0496110_0455978 3300048913 Bacteria 1165
286 Ga0496112_0037758 3300048915 Bacteria 4715
287 Ga0496112_0539137 3300048915 Bacteria 1101
288 Ga0496113_0040708 3300048916 Bacteria 3426
289 Ga0496113_0056611 3300048916 Bacteria 2944
290 Ga0496114_0169910 3300048917 Bacteria 1900
291 Ga0496115_0133427 3300048918 Bacteria 2047
292 Ga0496115_0329651 3300048918 Bacteria 1247
293 Ga0496115_0624840 3300048918 Unclassified 854
294 Ga0496116_0032442 3300048919 Bacteria 3722
295 Ga0496117_0032126 3300048920 Bacteria 3994
296 Ga0496117_0270011 3300048920 Bacteria 917
297 Ga0496118_0022177 3300048921 Bacteria 5562
298 Ga0496118_0382172 3300048921 Bacteria 738
299 Ga0496119_0040845 3300048922 Bacteria 2961
300 Ga0496119_0273115 3300048922 Bacteria 843
301 Ga0496120_0008680 3300048923 Bacteria 7325
302 Ga0496121_0000303 3300048924 Bacteria 102261
303 Ga0496121_0031615 3300048924 Bacteria 4831
304 Ga0496121_0054515 3300048924 Bacteria 3339
305 Ga0496121_0059665 3300048924 Bacteria 3144
306 Ga0496121_0073404 3300048924 Bacteria 2742
307 Ga0496121_0190670 3300048924 Bacteria 1470
308 Ga0496121_0241701 3300048924 Bacteria 1258
309 Ga0496121_0242023 3300048924 Bacteria 1256
310 Ga0496121_0246543 3300048924 Bacteria 1241
311 Ga0496121_0259120 3300048924 Bacteria 1202
312 Ga0496124_0514348 3300048927 Bacteria 799
313 Ga0496125_0119885 3300048928 Bacteria 1880
314 Ga0496126_0030371 3300048929 Bacteria 5119
315 Ga0496126_0187409 3300048929 Bacteria 1754
316 Ga0496126_0282952 3300048929 Bacteria 1373
317 Ga0496126_0376172 3300048929 Bacteria 1157
318 Ga0496126_0377839 3300048929 Bacteria 1154
319 Ga0495682_0064166 3300049460 Bacteria 1324
320 Ga0501047_0069848 3300049581 Bacteria 3382
321 Ga0501035_0140838 3300049822 Bacteria 2097
322 Ga0501044_0006781 3300049823 Bacteria 12624
323 nmdc:mga03n38_19763_c1 3300050490 Bacteria 2681
324 nmdc:mga00v17_486579_c1 3300050491 Bacteria 800
325 nmdc:mga00v17_87720_c1 3300050491 Bacteria 1950
326 nmdc:mga0yw44_121767_c1 3300050492 Bacteria 1681
327 nmdc:mga0yw44_181136_c1 3300050492 Bacteria 1387
328 nmdc:mga0sz30_132032_c1 3300050516 Bacteria 1101
329 nmdc:mga0sz30_19316_c1 3300050516 Bacteria 2738
330 Ga0495601_0012893 3300053077 Bacteria 5018
331 Ga0495595_0001272 3300053084 Bacteria 9823
332 Ga0495619_0006977 3300053085 Bacteria 7148
333 Ga0500578_0087744 3300053086 Bacteria 1976
334 Ga0500643_000097 3300053087 Bacteria 92120
335 Ga0500583_0019588 3300053092 Bacteria 2777
336 Ga0500566_0000546 3300053094 Bacteria 21089
337 Ga0500566_0116211 3300053094 Bacteria 1448
338 Ga0500640_012397 3300053095 Bacteria 3501
339 Ga0500556_0120134 3300053104 Bacteria 1024
340 Ga0500557_000018 3300053105 Bacteria 95477
341 Ga0500562_067019 3300053108 Bacteria 968
342 Ga0500569_017085 3300053109 Bacteria 1849
343 Ga0500607_172354 3300053121 Bacteria 972
344 Ga0500608_068638 3300053122 Bacteria 1687
345 Ga0500642_0000069 3300053130 Bacteria 55916
346 Ga0500642_0127617 3300053130 Bacteria 1191
347 Ga0500559_0011960 3300053136 Bacteria 3698
348 Ga0500559_0098003 3300053136 Bacteria 1348
349 Ga0500564_061091 3300053138 Bacteria 1709
350 Ga0500579_210956 3300053143 Bacteria 697
351 Ga0500616_0008836 3300053153 Bacteria 6196
352 Ga0500619_140801 3300053154 Bacteria 821
353 Ga0500620_080177 3300053155 Bacteria 1130
354 Ga0500622_0029500 3300053156 Bacteria 2885
355 Ga0500627_0054327 3300053158 Bacteria 1752
356 Ga0500633_0097617 3300053160 Bacteria 1079
357 Ga0500638_102515 3300053162 Bacteria 1332
358 Ga0500636_0002143 3300053177 Bacteria 10898
359 Ga0500636_0156413 3300053177 Bacteria 1247
360 Ga0500625_000518 3300053729 Bacteria 10621
361 Ga0500599_001583 3300053736 Bacteria 2641
362 Ga0500601_000647 3300053737 Bacteria 4791
363 Ga0500661_002314 3300055283 Bacteria 3600
364 2508693855 2508501042 Bacteria 8719808
365 2511399932 2511231028 Bacteria 8046582
366 2513650438 2513237095 Bacteria 8976980
367 2524437873 2524023205 Bacteria 8918781
368 2528856842 2528768022 Bacteria 10457665
369 2745082249 2744054633 Bacteria 8678936
370 2818238460 2816332527 Bacteria 8933356
371 2824662759 2824661429 Bacteria 9877870
372 2841961899 2841957949 Bacteria 8652217
373 2844316622 2844315083 Bacteria 8138177
374 2874633828 2874628541 Bacteria 8630250
375 2876770603 2876761206 Bacteria 10111113
376 2879101795 2879099564 Bacteria 10442239
377 2888381208 2888378607 Bacteria 9652610
378 2903731312 2903727486 Bacteria 8281579
379 2906603889 2906602504 Bacteria 8295279
380 2922370831
381 2929619215 2929615660 Bacteria 9193770
382 2929628290 2929624759 Bacteria 9339455
383 2932785524 2932784394 Bacteria 9704911
384 2932797040 2932794094 Bacteria 7915132
385 2932807336 2932801729 Bacteria 7987968
386 2932816560 2932809354 Bacteria 9135765
387 2932822153 2932818245 Bacteria 9955613
388 2932830602 2932828146 Bacteria 9745859
389 2933581136 2933577622 Bacteria 9116884
390 2935620627 2935616580 Bacteria 9032984
391 2935639721 2935638405 Bacteria 10015038
392 2935650362 2935648319 Bacteria 8801166
393 2935658509 2935656913 Bacteria 8965014
394 2935667441 2935665750 Bacteria 9571747
395 2935677500 2935675223 Bacteria 9928132
396 2935690557 2935684952 Bacteria 9590419
397 2935697112 2935694250 Bacteria 9291695
398 2935705181 2935703347 Bacteria 10242284
399 2935717747 2935713505 Bacteria 9608509
400 2935727103 2935722832 Bacteria 9608746
401 2935735873 2935732158 Bacteria 9706831
402 2935744856 2935741537 Bacteria 9707219
403 2935755566 2935750917 Bacteria 9590372
404 2935761918 2935760218 Bacteria 9817913
405 2935774573 2935769743 Bacteria 7878163
406 2935781860 2935777560 Bacteria 8077691
407 2935789412 2935785616 Bacteria 7962367
408 2935797545 2935793552 Bacteria 8012592
409 2935803418 2935801545 Bacteria 9301974
410 2935819566 2935810662 Bacteria 9401221
411 2935829204 2935827899 Bacteria 10038562
412 2935846717 2935837841 Bacteria 9454360
413 2935858435 2935855204 Bacteria 9035059
414 2935867144 2935864058 Bacteria 9784707
415 2935877274 2935873716 Bacteria 9632195
416 2935884537 2935883170 Bacteria 7964738
417 2935961688 2935959822 Bacteria 7869783
418 2935986072 2935984226 Bacteria 8302647
419 2935995106 2935992306 Bacteria 9802711
420 2936003977 2936002035 Bacteria 9362176
421 2936013079 2936011229 Bacteria 8801034
422 2936021834 2936019824 Bacteria 8804134
423 2936030372 2936028420 Bacteria 8965941
424 2936037927 2936037263 Bacteria 9446081
425 2936048028 2936046547 Bacteria 8903709
426 2936058028 2936055302 Bacteria 8785755
427 2940561153 2940556831 Bacteria 9590747
428 2941533406 2941531003 Bacteria 7653939
429 2941547000 2941538514 Bacteria 9402094
430 3005596228 3005594810 Bacteria 8716512
431 3005712278 3005710791 Bacteria 7622528
432 3005719402 3005718088 Bacteria 8283608
433 8016516815 8016511872 Bacteria 9921665
434 8016524153 8016522445 Bacteria 8156687
435 8016537698 8016530956 Bacteria 8155261
436 8016541977 8016539877 Bacteria 8155419
437 8016551306 8016548790 Bacteria 8155074
438 8016559696 8016557553 Bacteria 8154380
439 8016567354 8016566248 Bacteria 8158151
440 8016580063 8016575299 Bacteria 8154085
441 8016597635 8016595262 Bacteria 8149947
442 8016604681 8016603502 Bacteria 8731218
443 8016620330 8016613128 Bacteria 8794220
444 8016629646 8016622563 Bacteria 7999408
445 8017059751 8017057580 Bacteria 10023680
446 8019537373 8019530166 Bacteria 8155624
447 8019539091 8019538911 Bacteria 7872763
448 8019548584 8019547302 Bacteria 7996444
449 8019579228 8019576017 Bacteria 10049540
450 8019597285 8019586578 Bacteria 10212056
451 8019604408 8019597564 Bacteria 10041141
452 8019614131 8019608314 Bacteria 10042931
453 8055749528 8055742211 Bacteria 9226248
454 8056973745 8056967851 Bacteria 9038162
455 Ga0496120_0058143
456 JGI25153J46596_10008166
457 rootH2_10104247
458 rootL2_10206909
459 rootL2_10251737
460 rootH1_10245649
461 JGI25160J50197_1000639
462 Ga0065165_1001514
463 Ga0070658_10002020
464 Ga0070658_10095423
465 Ga0070683_100385876
466 Ga0070670_100539242
467 Ga0068868_100934351
468 Ga0070661_100088190
469 Ga0070692_10236873
470 Ga0070668_100166512
471 Ga0070659_100331085
472 Ga0070667_100350824
473 Ga0070713_101078155
474 Ga0070663_100100126
475 Ga0070698_100331485
476 Ga0070684_100411280
477 Ga0068853_100096604
478 Ga0068853_100193507
479 Ga0070693_100211039
480 Ga0070665_100017463
481 Ga0070665_100061308
482 Ga0070665_100145337
483 Ga0070665_100329401
484 Ga0068855_101048492
485 Ga0068857_100422402
486 Ga0068856_100035819
487 Ga0068856_100978070
488 Ga0068852_100000659
489 Ga0068852_100466456
490 Ga0068852_101479109
491 Ga0068851_10292619
492 Ga0068862_100664330
493 Ga0068862_100723895
494 Ga0070717_10000741
495 Ga0075363_100020265
496 Ga0075364_10037278
497 Ga0075367_10094629
498 Ga0075369_10024275
499 Ga0075370_10045151
500 Ga0099794_10194946
501 Ga0099795_10039275
502 Ga0105240_10004352
503 Ga0105240_10191330
504 Ga0105240_10211306
505 Ga0105245_10102234
506 Ga0105245_10127526
507 Ga0105245_10365919
508 Ga0105247_10225296
509 Ga0105243_10257595
510 Ga0105243_10326663
511 Ga0105241_10019284
512 Ga0105241_10058864
513 Ga0105241_10908233
514 Ga0105248_10069556
515 Ga0105248_10783577
516 Ga0105237_10002008
517 Ga0105237_10135488
518 Ga0105237_10218740
519 Ga0105238_10004293
520 Ga0105238_10104871
521 Ga0105238_10434203
522 Ga0105249_11014818
523 Ga0099796_10068341
524 Ga0105239_10024054
525 Ga0105239_10123138
526 Ga0105239_10167807
527 Ga0105239_10250582
528 Ga0105239_10441283
529 Ga0105246_10261932
530 Ga0105246_10305819
531 Ga0157369_10328513
532 Ga0157369_10491483
533 Ga0157374_10041636
534 Ga0157374_10084818
535 Ga0157374_11001228
536 Ga0157378_10155815
537 Ga0163162_10871334
538 Ga0157375_10274871
539 Ga0163163_10241124
540 Ga0163163_11660187
541 Ga0182008_10474537
542 Ga0157379_10670694
543 Ga0157376_11464127
544 Ga0182007_10151758
545 Ga0163161_10291601
546 Ga0214544_1003798
547 Ga0209677_100425
548 Ga0209148_1000303
549 Ga0209233_1006678
550 Ga0209455_1005024
551 Ga0209673_1052381
552 Ga0209564_1007716
553 Ga0209758_1003188
554 Ga0209758_1003443
555 Ga0209256_1040830
556 Ga0207426_1000237
557 Ga0207426_1001374
558 Ga0207426_1050499
559 Ga0207647_10023088
560 Ga0207647_10188250
561 Ga0207705_10022360
562 Ga0207654_10032509
563 Ga0207654_10429982
564 Ga0207695_10000006
565 Ga0207695_10197674
566 Ga0207671_10002154
567 Ga0207657_10171480
568 Ga0207649_10037086
569 Ga0207649_10162616
570 Ga0207694_10035644
571 Ga0207694_10285457
572 Ga0207700_10838078
573 Ga0207644_10050646
574 Ga0207690_10690321
575 Ga0207709_10368233
576 Ga0207665_10367894
577 Ga0207661_10711825
578 Ga0207667_10157964
579 Ga0207667_10332632
580 Ga0207668_10323461
581 Ga0207668_10362501
582 Ga0207640_10505831
583 Ga0207677_10216086
584 Ga0207703_10522285
585 Ga0207639_10106268
586 Ga0207678_10538400
587 Ga0207702_10281009
588 Ga0207702_10960121
589 Ga0207674_10519065
590 Ga0207675_100105353
591 Ga0207698_10578869
592 Ga0207698_10918677
593 Ga0268266_10000043
594 Ga0268266_10048901
595 Ga0268266_10177196
596 Ga0268265_10457067
597 Ga0268264_10588099
598 Ga0265334_10009488
599 Ga0265330_10028213
600 Ga0265330_10109511
601 Ga0265332_10063628
602 Ga0265328_10039035
603 Ga0265328_10078796
604 Ga0265325_10007516
605 Ga0265339_10023439
606 Ga0265339_10297491
607 Ga0265316_10042428
608 Ga0307508_10199118
609 Ga0265314_10091802
610 Ga0307510_10096626
611 Ga0307510_10267792
612 Ga0373934_0000949
613 Ga0373923_0002287
614 Ga0373936_0137747
615 Ga0373953_0000212
616 Ga0373954_0002468
617 Ga0373956_0008777
618 Ga0373957_0001175
619 Ga0373955_0000746
620 Ga0373924_0041789
621 Ga0373933_0003913
622 Ga0373937_0018618
623 Ga0395900_0029519
624 Ga0436364_0552336
625 Ga0451833_0104717
626 Ga0451841_0052677
627 Ga0466969_0119489
628 Ga0466972_0000054
629 Ga0466966_0001292
630 Ga0466961_0000009
631 Ga0466968_0075913
632 Ga0466970_0212053
633 Ga0466957_0089468
634 Ga0466959_0006275
635 Ga0466959_0483113
636 Ga0466967_0049672
637 Ga0466967_0621590
638 Ga0495592_0090620
639 Ga0495629_0000655
640 Ga0495638_0001053
641 Ga0495651_0029160
642 Ga0495651_0119276
643 Ga0495653_0009420
644 Ga0495650_0090738
645 Ga0495605_0121834
646 Ga0495585_0077174
647 Ga0495606_0046457
648 Ga0495606_0072489
649 Ga0495606_0129779
650 Ga0495606_0393792
651 Ga0495608_0002085
652 Ga0495608_0082868
653 Ga0495610_0139064
654 Ga0495618_0066319
655 Ga0495618_0080848
656 Ga0495620_0056123
657 Ga0495628_0007622
658 Ga0495631_0261020
659 Ga0495632_0095718
660 Ga0495643_0050511
661 Ga0495643_0132863
662 Ga0495648_0095827
663 Ga0495648_0193260
664 Ga0495652_0003985
665 Ga0495652_0045685
666 Ga0495652_0178604
667 Ga0495652_0378255
668 Ga0495654_0284373
669 Ga0495640_0004949
670 Ga0495640_0038564
671 Ga0495587_0012313
672 Ga0495587_0384474
673 Ga0495609_0217272
674 Ga0495609_0232530
675 Ga0495645_0019048
676 Ga0495622_0029269
677 Ga0495622_0036671
678 Ga0495622_0049737
679 Ga0495667_0003203
680 Ga0495668_0179112
681 Ga0495668_0333785
682 Ga0495634_0010233
683 Ga0495634_0039167
684 Ga0495611_0092961
685 Ga0495625_0000909
686 Ga0495625_0087143
687 Ga0495635_0000380
688 Ga0495635_0018937
689 Ga0495661_0287436
690 Ga0495588_0037511
691 Ga0495588_0515762
692 Ga0495657_0012622
693 Ga0495599_0069166
694 Ga0495623_0245695
695 Ga0495646_0030545
696 Ga0495646_0450737
697 Ga0495613_0019838
698 Ga0495624_0034862
699 Ga0495624_0587012
700 Ga0495671_0330340
701 Ga0495649_0019604
702 Ga0495600_0015130
703 Ga0495600_0015580
704 Ga0495581_0074359
705 Ga0495604_0018964
706 Ga0495604_0019378
707 Ga0495674_0744056
708 Ga0495674_0754927
709 Ga0495676_0114850
710 Ga0495680_0117861
711 Ga0495687_004652
712 Ga0495687_006023
713 Ga0495687_067790
714 Ga0495675_0006538
715 Ga0495677_0208783
716 Ga0495673_0123984
717 Ga0495684_0000294
718 Ga0495593_0002223
719 Ga0495593_0042856
720 Ga0495602_0094151
721 Ga0495602_0306299
722 Ga0495602_0480007
723 Ga0495626_0045127
724 Ga0496100_0061344
725 Ga0496100_0499194
726 Ga0496101_0065951
727 Ga0496101_0185339
728 Ga0496103_0018843
729 Ga0496104_0036761
730 Ga0496104_0040694
731 Ga0496104_0074590
732 Ga0496104_0681038
733 Ga0496105_0026568
734 Ga0496105_0063997
735 Ga0496105_0789938
736 Ga0496106_0346503
737 Ga0496107_0530616
738 Ga0496108_0231588
739 Ga0496110_0455978
740 Ga0496112_0037758
741 Ga0496112_0539137
742 Ga0496113_0040708
743 Ga0496113_0056611
744 Ga0496114_0169910
745 Ga0496115_0133427
746 Ga0496115_0329651
747 Ga0496115_0624840
748 Ga0496116_0032442
749 Ga0496117_0032126
750 Ga0496117_0270011
751 Ga0496118_0022177
752 Ga0496118_0382172
753 Ga0496119_0040845
754 Ga0496119_0273115
755 Ga0496120_0008680
756 Ga0496121_0000303
757 Ga0496121_0031615
758 Ga0496121_0054515
759 Ga0496121_0059665
760 Ga0496121_0073404
761 Ga0496121_0190670
762 Ga0496121_0241701
763 Ga0496121_0242023
764 Ga0496121_0246543
765 Ga0496121_0259120
766 Ga0496124_0514348
767 Ga0496125_0119885
768 Ga0496126_0030371
769 Ga0496126_0187409
770 Ga0496126_0282952
771 Ga0496126_0376172
772 Ga0496126_0377839
773 Ga0495682_0064166
774 Ga0501047_0069848
775 Ga0501035_0140838
776 Ga0501044_0006781
777 nmdc:mga03n38_19763_c1
778 nmdc:mga00v17_486579_c1
779 nmdc:mga00v17_87720_c1
780 nmdc:mga0yw44_121767_c1
781 nmdc:mga0yw44_181136_c1
782 nmdc:mga0sz30_132032_c1
783 nmdc:mga0sz30_19316_c1
784 Ga0495601_0012893
785 Ga0495595_0001272
786 Ga0495619_0006977
787 Ga0500578_0087744
788 Ga0500643_000097
789 Ga0500583_0019588
790 Ga0500566_0000546
791 Ga0500566_0116211
792 Ga0500640_012397
793 Ga0500556_0120134
794 Ga0500557_000018
795 Ga0500562_067019
796 Ga0500569_017085
797 Ga0500607_172354
798 Ga0500608_068638
799 Ga0500642_0000069
800 Ga0500642_0127617
801 Ga0500559_0011960
802 Ga0500559_0098003
803 Ga0500564_061091
804 Ga0500579_210956
805 Ga0500616_0008836
806 Ga0500619_140801
807 Ga0500620_080177
808 Ga0500622_0029500
809 Ga0500627_0054327
810 Ga0500633_0097617
811 Ga0500638_102515
812 Ga0500636_0002143
813 Ga0500636_0156413
814 Ga0500625_000518
815 Ga0500599_001583
816 Ga0500601_000647
817 Ga0500661_002314
818 2508693855
819 2511399932
820 2513650438
821 2524437873
822 2528856842
823 2745082249
824 2818238460
825 2824662759
826 2841961899
827 2844316622
828 2874633828
829 2876770603
830 2879101795
831 2888381208
832 2903731312
833 2906603889
834 2922370831
835 2929619215
836 2929628290
837 2932785524
838 2932797040
839 2932807336
840 2932816560
841 2932822153
842 2932830602
843 2933581136
844 2935620627
845 2935639721
846 2935650362
847 2935658509
848 2935667441
849 2935677500
850 2935690557
851 2935697112
852 2935705181
853 2935717747
854 2935727103
855 2935735873
856 2935744856
857 2935755566
858 2935761918
859 2935774573
860 2935781860
861 2935789412
862 2935797545
863 2935803418
864 2935819566
865 2935829204
866 2935846717
867 2935858435
868 2935867144
869 2935877274
870 2935884537
871 2935961688
872 2935986072
873 2935995106
874 2936003977
875 2936013079
876 2936021834
877 2936030372
878 2936037927
879 2936048028
880 2936058028
881 2940561153
882 2941533406
883 2941547000
884 3005596228
885 3005712278
886 3005719402
887 8016516815
888 8016524153
889 8016537698
890 8016541977
891 8016551306
892 8016559696
893 8016567354
894 8016580063
895 8016597635
896 8016604681
897 8016620330
898 8016629646
899 8017059751
900 8019537373
901 8019539091
902 8019548584
903 8019579228
904 8019597285
905 8019604408
906 8019614131
907 8055749528
908 8056973745

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

44

90

0.99

PF16925

TetR_C_13

Tetracyclin repressor-like, C-terminal domain

110

209

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zui-assembly1.cif.gz_A crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid 0.8565 12 92
4l62-assembly1.cif.gz_C crystal structure of pseudomonas aeruginosa transcriptional regulator pa2196 bound to its operator dna 0.8544 9 185
2fd5-assembly1.cif.gz_A-2 the crystal structure of a transcriptional regulator from pseudomonas aeruginosa pao1 0.851 10 182
2fd5-assembly1.cif.gz_A-2 the crystal structure of a transcriptional regulator from pseudomonas aeruginosa pao1 0.8163 10 182
4l62-assembly1.cif.gz_C crystal structure of pseudomonas aeruginosa transcriptional regulator pa2196 bound to its operator dna 0.7993 9 185
ID Description Score Start End Superfamily
2eh3A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9815 12 58 1.10.10.60
3mvpA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9706 11 52 1.10.10.60
2raeA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9619 12 52 1.10.10.60
3br5D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9576 15 58 1.10.10.60
1jtyA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9561 12 58 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1I3X0X3-F1-model_v4 DNA-binding transcriptional regulator, AcrR family 0.9824 4 189 GO:0003677
GO:0006355
AF-A0A5D3KGK8-F1-model_v4 TetR family transcriptional regulator 0.9816 4 189 GO:0003677
GO:0006355
AF-A0A7S9H1I9-F1-model_v4 TetR family transcriptional regulator 0.9776 3 189 GO:0003677
GO:0006355
AF-A0A4Q6G8A7-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9728 6 187 GO:0003677
GO:0006355
AF-A0A1H4WWQ8-F1-model_v4 Transcriptional regulator, TetR family 0.9696 6 187 GO:0003677
GO:0006355

Map