F447414

General Info

Members Datasets Scaffolds Average Seq Length
454 259 908 164

Family's Representative Sequence

Representative Sequence 3300031911|Ga0307412_10068926|Ga0307412_100689264
Length 192
Sequence MWARRGRNVPRPVRAPPRAPYFLSPITLMAEITLDLRGRPKAEAYAELAEHVGHVLEGVDDPIAGMATVSALLHHGFGHLWTGFYRVVEPGRLLRVGPYQGTLGCLEIAFGRGVCGTAAAEGRTVVVEDVNAFPGHITCDARSASEIVVPVWGADGGLLAVLDIDSSVPAAFDEEDRVGLERLVAWFATALR

Samples

Sample ID Description Type Environment
1 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
148 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
149 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
150 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
151 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
152 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
218 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
229 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
230 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
231 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
232 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
233 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
234 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
235 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
236 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
237 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
238 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
239 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
240 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
241 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
242 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
243 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
244 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
245 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
246 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
247 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
255 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 0.66
Rhizosphere 98.24
Stem 0
Stem Tuber 0
Unclassified 22.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307412_10068926 3300031911 Bacteria 2406
2 MBSR1b_contig_234465 2162886012 Unclassified 2696
3 rootH2_10119781 3300003320 Bacteria 1542
4 Ga0058861_12029262 3300004800 Bacteria 1888
5 Ga0065704_10220987 3300005289 Bacteria 1074
6 Ga0065712_10111836 3300005290 Bacteria 1810
7 Ga0065715_10094607 3300005293 Bacteria 4293
8 Ga0065715_10218059 3300005293 Bacteria 1284
9 Ga0070658_10024256 3300005327 Bacteria 4866
10 Ga0070658_10049958 3300005327 Bacteria 3389
11 Ga0070658_10110825 3300005327 Unclassified 2273
12 Ga0070658_10503072 3300005327 Unclassified 1047
13 Ga0070683_100008849 3300005329 Bacteria 8569
14 Ga0070683_100014305 3300005329 Bacteria 6939
15 Ga0070683_100107195 3300005329 Bacteria 2634
16 Ga0070683_100782704 3300005329 Unclassified 914
17 Ga0070690_100061231 3300005330 Bacteria 2424
18 Ga0070670_100171389 3300005331 Bacteria 1882
19 Ga0070680_100000046 3300005336 Bacteria 63865
20 Ga0070680_100000169 3300005336 Bacteria 41532
21 Ga0070680_100031255 3300005336 Bacteria 4280
22 Ga0070680_100039382 3300005336 Bacteria 3825
23 Ga0070682_100000899 3300005337 Bacteria 17364
24 Ga0070682_100808891 3300005337 Bacteria 762
25 Ga0068868_100491898 3300005338 Bacteria 1073
26 Ga0068868_100615599 3300005338 Bacteria 963
27 Ga0070660_100120344 3300005339 Bacteria 2095
28 Ga0070660_100339643 3300005339 Bacteria 1236
29 Ga0070660_100563104 3300005339 Unclassified 951
30 Ga0070689_100064680 3300005340 Unclassified 2847
31 Ga0070689_100305843 3300005340 Bacteria 1324
32 Ga0070691_10111228 3300005341 Unclassified 1370
33 Ga0070687_100090378 3300005343 Bacteria 1692
34 Ga0070661_100001361 3300005344 Bacteria 17079
35 Ga0070661_100015384 3300005344 Bacteria 5400
36 Ga0070661_100463656 3300005344 Unclassified 1009
37 Ga0070692_10022581 3300005345 Bacteria 3074
38 Ga0070692_10190198 3300005345 Bacteria 1195
39 Ga0070692_10227173 3300005345 Bacteria 1106
40 Ga0070673_100156357 3300005364 Bacteria 1935
41 Ga0070673_100507938 3300005364 Bacteria 1091
42 Ga0070673_100551745 3300005364 Unclassified 1047
43 Ga0070659_100005204 3300005366 Bacteria 9337
44 Ga0070659_100047285 3300005366 Unclassified 3374
45 Ga0070703_10072463 3300005406 Unclassified 1154
46 Ga0070709_10090314 3300005434 Bacteria 2019
47 Ga0070714_100072871 3300005435 Bacteria 2974
48 Ga0070713_100608881 3300005436 Bacteria 1038
49 Ga0070710_10797959 3300005437 Unclassified 674
50 Ga0070711_100205184 3300005439 Bacteria 1523
51 Ga0070700_101256823 3300005441 Bacteria 620
52 Ga0070663_100103613 3300005455 Bacteria 2127
53 Ga0070663_100114008 3300005455 Bacteria 2035
54 Ga0070662_100537616 3300005457 Unclassified 978
55 Ga0070681_10019659 3300005458 Bacteria 6763
56 Ga0070681_10186977 3300005458 Bacteria 1992
57 Ga0070681_10267863 3300005458 Bacteria 1620
58 Ga0070681_10373486 3300005458 Unclassified 1336
59 Ga0070681_11041978 3300005458 Unclassified 738
60 Ga0068867_100029370 3300005459 Bacteria 3961
61 Ga0068867_100714226 3300005459 Unclassified 886
62 Ga0070707_100065757 3300005468 Bacteria 3484
63 Ga0070707_100557406 3300005468 Bacteria 1108
64 Ga0070698_100024608 3300005471 Bacteria 6281
65 Ga0070698_100674732 3300005471 Unclassified 975
66 Ga0070699_100004521 3300005518 Bacteria 12309
67 Ga0070699_100005932 3300005518 Bacteria 10668
68 Ga0070699_100476717 3300005518 Bacteria 1132
69 Ga0070679_100000080 3300005530 Bacteria 72275
70 Ga0070679_100000192 3300005530 Bacteria 49686
71 Ga0070679_100104444 3300005530 Bacteria 2819
72 Ga0070679_100394377 3300005530 Bacteria 1330
73 Ga0070679_100497378 3300005530 Unclassified 1163
74 Ga0070679_100683911 3300005530 Bacteria 969
75 Ga0070679_100827142 3300005530 Unclassified 869
76 Ga0070679_100959811 3300005530 Unclassified 799
77 Ga0070679_101240832 3300005530 Bacteria 691
78 Ga0070679_101958515 3300005530 Unclassified 535
79 Ga0070684_100006505 3300005535 Bacteria 9046
80 Ga0070684_100112809 3300005535 Unclassified 2439
81 Ga0068853_100070798 3300005539 Bacteria 3036
82 Ga0068853_100601319 3300005539 Archaea 1044
83 Ga0070686_100164960 3300005544 Bacteria 1563
84 Ga0070695_100860128 3300005545 Bacteria 730
85 Ga0070696_100000387 3300005546 Bacteria 27071
86 Ga0070696_101419305 3300005546 Bacteria 592
87 Ga0070693_100180311 3300005547 Unclassified 1359
88 Ga0070665_100073330 3300005548 Bacteria 3429
89 Ga0070704_100230685 3300005549 Bacteria 1510
90 Ga0068855_100056484 3300005563 Bacteria 4606
91 Ga0068855_100063697 3300005563 Bacteria 4302
92 Ga0070664_100072691 3300005564 Bacteria 2950
93 Ga0068857_100641259 3300005577 Bacteria 1006
94 Ga0068854_100084992 3300005578 Bacteria 2342
95 Ga0068854_100415111 3300005578 Unclassified 1117
96 Ga0068856_100310988 3300005614 Bacteria 1593
97 Ga0070702_100104043 3300005615 Bacteria 1747
98 Ga0068852_100905048 3300005616 Unclassified 899
99 Ga0068864_100194105 3300005618 Bacteria 1862
100 Ga0068864_100570179 3300005618 Unclassified 1096
101 Ga0068864_101616266 3300005618 Bacteria 652
102 Ga0068866_10764983 3300005718 Bacteria 668
103 Ga0068861_100580446 3300005719 Bacteria 1026
104 Ga0068851_10135647 3300005834 Bacteria 1334
105 Ga0068863_101636947 3300005841 Unclassified 653
106 Ga0068860_100067394 3300005843 Bacteria 3401
107 Ga0081539_10029337 3300005985 Bacteria 3438
108 Ga0070717_10007339 3300006028 Bacteria 8182
109 Ga0070717_10349284 3300006028 Bacteria 1322
110 Ga0070715_10089861 3300006163 Unclassified 1411
111 Ga0070716_100347112 3300006173 Unclassified 1049
112 Ga0097621_101686578 3300006237 Unclassified 603
113 Ga0075428_100252572 3300006844 Bacteria 1900
114 Ga0075431_100050244 3300006847 Bacteria 4300
115 Ga0075434_100489793 3300006871 Unclassified 1250
116 Ga0068865_100234299 3300006881 Unclassified 1442
117 Ga0075435_100281386 3300007076 Unclassified 1420
118 Ga0111539_11517358 3300009094 Bacteria 777
119 Ga0105241_10000031 3300009174 Bacteria 121342
120 Ga0105241_10477309 3300009174 Bacteria 1108
121 Ga0105248_10376571 3300009177 Bacteria 1598
122 Ga0105248_10595520 3300009177 Bacteria 1247
123 Ga0105246_10160334 3300011119 Bacteria 1713
124 Ga0105246_10301780 3300011119 Unclassified 1293
125 Ga0157373_10011848 3300013100 Bacteria 6406
126 Ga0157373_10023419 3300013100 Bacteria 4477
127 Ga0157373_10137094 3300013100 Bacteria 1721
128 Ga0157373_10545736 3300013100 Unclassified 840
129 Ga0157371_10082670 3300013102 Bacteria 2274
130 Ga0157370_10012367 3300013104 Bacteria 8856
131 Ga0157370_10328753 3300013104 Bacteria 1410
132 Ga0157370_11050462 3300013104 Unclassified 737
133 Ga0157369_10144411 3300013105 Unclassified 2516
134 Ga0157374_10063177 3300013296 Bacteria 3472
135 Ga0157374_11068545 3300013296 Unclassified 827
136 Ga0157374_11192395 3300013296 Unclassified 783
137 Ga0157378_10555617 3300013297 Unclassified 1154
138 Ga0163162_10619137 3300013306 Bacteria 1208
139 Ga0157372_10005616 3300013307 Bacteria 13338
140 Ga0157372_10045656 3300013307 Bacteria 4861
141 Ga0157372_10217773 3300013307 Bacteria 2213
142 Ga0157372_10297929 3300013307 Bacteria 1876
143 Ga0157372_10406256 3300013307 Bacteria 1587
144 Ga0157375_10008780 3300013308 Bacteria 8857
145 Ga0157375_10818646 3300013308 Bacteria 1079
146 Ga0182008_10036862 3300014497 Bacteria 2447
147 Ga0206353_10506143 3300020082 Bacteria 655
148 Ga0213876_10002521 3300021384 Bacteria 10731
149 Ga0207656_10110060 3300025321 Bacteria 1272
150 Ga0207680_10092029 3300025903 Bacteria 1931
151 Ga0207699_10160175 3300025906 Bacteria 1497
152 Ga0207699_10164263 3300025906 Bacteria 1480
153 Ga0207645_10048860 3300025907 Bacteria 2702
154 Ga0207705_10043828 3300025909 Bacteria 3214
155 Ga0207705_10098767 3300025909 Bacteria 2145
156 Ga0207654_10000031 3300025911 Bacteria 121592
157 Ga0207654_10067383 3300025911 Bacteria 2114
158 Ga0207707_10000145 3300025912 Bacteria 73692
159 Ga0207707_10000291 3300025912 Bacteria 53460
160 Ga0207707_10062298 3300025912 Unclassified 3245
161 Ga0207707_10281150 3300025912 Bacteria 1441
162 Ga0207707_10946765 3300025912 Unclassified 709
163 Ga0207695_10001150 3300025913 Bacteria 45914
164 Ga0207663_10039695 3300025916 Bacteria 2855
165 Ga0207660_10000293 3300025917 Bacteria 33032
166 Ga0207660_10001150 3300025917 Bacteria 17663
167 Ga0207660_10023053 3300025917 Unclassified 4201
168 Ga0207660_10152184 3300025917 Bacteria 1778
169 Ga0207660_10455182 3300025917 Bacteria 1035
170 Ga0207657_10062066 3300025919 Bacteria 3201
171 Ga0207657_10115527 3300025919 Bacteria 2212
172 Ga0207657_10126808 3300025919 Bacteria 2096
173 Ga0207649_10133891 3300025920 Unclassified 1687
174 Ga0207649_10291145 3300025920 Bacteria 1191
175 Ga0207649_10414215 3300025920 Unclassified 1011
176 Ga0207652_10000247 3300025921 Bacteria 56128
177 Ga0207652_10001846 3300025921 Bacteria 18378
178 Ga0207652_10004621 3300025921 Bacteria 11157
179 Ga0207652_10125074 3300025921 Unclassified 2290
180 Ga0207652_10780339 3300025921 Unclassified 849
181 Ga0207652_11357041 3300025921 Bacteria 614
182 Ga0207646_10055761 3300025922 Bacteria 3533
183 Ga0207646_10791706 3300025922 Unclassified 845
184 Ga0207694_11063375 3300025924 Bacteria 685
185 Ga0207659_10767029 3300025926 Unclassified 828
186 Ga0207687_10752367 3300025927 Unclassified 829
187 Ga0207644_10471214 3300025931 Bacteria 1033
188 Ga0207690_10018462 3300025932 Bacteria 4278
189 Ga0207690_10143483 3300025932 Bacteria 1762
190 Ga0207706_10417775 3300025933 Unclassified 1162
191 Ga0207706_10823174 3300025933 Bacteria 788
192 Ga0207670_10014133 3300025936 Unclassified 4729
193 Ga0207691_10080518 3300025940 Unclassified 2929
194 Ga0207691_11200562 3300025940 Unclassified 629
195 Ga0207711_10381584 3300025941 Bacteria 1308
196 Ga0207661_10016821 3300025944 Bacteria 5400
197 Ga0207661_10168034 3300025944 Bacteria 1908
198 Ga0207661_10564203 3300025944 Bacteria 1043
199 Ga0207679_10067205 3300025945 Bacteria 2689
200 Ga0207667_10103103 3300025949 Unclassified 2943
201 Ga0207667_10224895 3300025949 Bacteria 1922
202 Ga0207651_10446846 3300025960 Unclassified 1108
203 Ga0207651_10492732 3300025960 Unclassified 1058
204 Ga0207640_10000895 3300025981 Bacteria 16871
205 Ga0207639_10290832 3300026041 Bacteria 1441
206 Ga0207639_10375333 3300026041 Bacteria 1276
207 Ga0207639_10552227 3300026041 Archaea 1058
208 Ga0207678_10132913 3300026067 Bacteria 2123
209 Ga0207708_10194306 3300026075 Bacteria 1617
210 Ga0207702_10631554 3300026078 Bacteria 1052
211 Ga0207648_10576457 3300026089 Unclassified 1035
212 Ga0207648_10816191 3300026089 Unclassified 869
213 Ga0207676_10452449 3300026095 Bacteria 1211
214 Ga0207676_10749084 3300026095 Bacteria 950
215 Ga0207698_10017474 3300026142 Bacteria 4867
216 Ga0207698_10093639 3300026142 Bacteria 2467
217 Ga0209969_1002266 3300027360 Bacteria 2651
218 Ga0209969_1004685 3300027360 Bacteria 1911
219 Ga0209967_1032297 3300027364 Unclassified 785
220 Ga0209981_1004760 3300027378 Bacteria 1791
221 Ga0209996_1002203 3300027395 Bacteria 2401
222 Ga0209984_1001356 3300027424 Bacteria 2645
223 Ga0210000_1002559 3300027462 Bacteria 2593
224 Ga0210000_1002568 3300027462 Bacteria 2590
225 Ga0209995_1000109 3300027471 Bacteria 12884
226 Ga0209999_1000063 3300027543 Bacteria 12120
227 Ga0209999_1000110 3300027543 Bacteria 10136
228 Ga0210002_1002567 3300027617 Bacteria 2625
229 Ga0209983_1002153 3300027665 Bacteria 4338
230 Ga0209971_1002823 3300027682 Bacteria 4150
231 Ga0209971_1022980 3300027682 Bacteria 1486
232 Ga0209966_1000462 3300027695 Bacteria 11109
233 Ga0209966_1011055 3300027695 Bacteria 1638
234 Ga0209998_10000026 3300027717 Bacteria 60645
235 Ga0209974_10000165 3300027876 Bacteria 20120
236 Ga0268264_10013811 3300028381 Bacteria 6642
237 Ga0307408_100026037 3300031548 Bacteria 4011
238 Ga0307408_100278088 3300031548 Unclassified 1393
239 Ga0307408_101860773 3300031548 Bacteria 576
240 Ga0265314_10235236 3300031711 Bacteria 1060
241 Ga0307405_10003342 3300031731 Bacteria 7348
242 Ga0307405_10055454 3300031731 Bacteria 2480
243 Ga0307405_10087226 3300031731 Bacteria 2056
244 Ga0307405_10301218 3300031731 Unclassified 1216
245 Ga0307413_10000952 3300031824 Bacteria 10358
246 Ga0307413_10002253 3300031824 Bacteria 7786
247 Ga0307413_10042197 3300031824 Bacteria 2678
248 Ga0307413_10088528 3300031824 Bacteria 2009
249 Ga0307413_10241078 3300031824 Unclassified 1335
250 Ga0307410_10002519 3300031852 Bacteria 8859
251 Ga0307410_10041057 3300031852 Bacteria 3049
252 Ga0307410_10121735 3300031852 Bacteria 1904
253 Ga0307410_10268630 3300031852 Unclassified 1333
254 Ga0307410_10364658 3300031852 Bacteria 1158
255 Ga0307410_10380215 3300031852 Unclassified 1136
256 Ga0307410_10708340 3300031852 Unclassified 849
257 Ga0307406_10001692 3300031901 Bacteria 12112
258 Ga0307406_10012484 3300031901 Bacteria 4843
259 Ga0307406_10016465 3300031901 Bacteria 4297
260 Ga0307406_10255845 3300031901 Bacteria 1322
261 Ga0307407_10000508 3300031903 Bacteria 12021
262 Ga0307407_10017516 3300031903 Bacteria 3597
263 Ga0307407_10051285 3300031903 Bacteria 2364
264 Ga0307407_10058309 3300031903 Bacteria 2244
265 Ga0307407_10099175 3300031903 Unclassified 1804
266 Ga0307407_10117850 3300031903 Bacteria 1678
267 Ga0307407_10158995 3300031903 Bacteria 1477
268 Ga0307407_10328986 3300031903 Bacteria 1075
269 Ga0307407_10393574 3300031903 Unclassified 992
270 Ga0307412_10007603 3300031911 Bacteria 6152
271 Ga0307412_10126891 3300031911 Bacteria 1846
272 Ga0307412_10152352 3300031911 Bacteria 1708
273 Ga0307412_10213491 3300031911 Unclassified 1474
274 Ga0307412_10311812 3300031911 Unclassified 1248
275 Ga0307409_100000906 3300031995 Bacteria 13737
276 Ga0307409_100004450 3300031995 Bacteria 7874
277 Ga0307409_100016184 3300031995 Bacteria 4926
278 Ga0307409_100028621 3300031995 Bacteria 3973
279 Ga0307409_100044426 3300031995 Bacteria 3346
280 Ga0307409_100076832 3300031995 Bacteria 2679
281 Ga0307409_101099679 3300031995 Bacteria 816
282 Ga0307416_100000749 3300032002 Bacteria 16988
283 Ga0307416_100004112 3300032002 Bacteria 8710
284 Ga0307416_100027306 3300032002 Bacteria 4224
285 Ga0307416_100077686 3300032002 Unclassified 2789
286 Ga0307416_100080717 3300032002 Unclassified 2747
287 Ga0307416_100137765 3300032002 Bacteria 2212
288 Ga0307416_100204654 3300032002 Bacteria 1876
289 Ga0307416_100440870 3300032002 Bacteria 1352
290 Ga0307416_102684427 3300032002 Unclassified 595
291 Ga0307414_10014782 3300032004 Bacteria 4691
292 Ga0307414_10041509 3300032004 Bacteria 3117
293 Ga0307414_10852057 3300032004 Unclassified 833
294 Ga0307414_10853862 3300032004 Bacteria 833
295 Ga0307411_10001711 3300032005 Bacteria 9215
296 Ga0307411_10002243 3300032005 Bacteria 8440
297 Ga0307411_10010325 3300032005 Bacteria 4970
298 Ga0307411_10074306 3300032005 Bacteria 2316
299 Ga0307411_10170740 3300032005 Bacteria 1639
300 Ga0307411_10682555 3300032005 Bacteria 893
301 Ga0307411_11340195 3300032005 Bacteria 653
302 Ga0307415_100007509 3300032126 Bacteria 5968
303 Ga0307415_100057199 3300032126 Bacteria 2678
304 Ga0307415_100075712 3300032126 Unclassified 2383
305 Ga0307415_100125432 3300032126 Bacteria 1934
306 Ga0307415_100126981 3300032126 Bacteria 1924
307 Ga0307415_100222521 3300032126 Bacteria 1514
308 Ga0307415_100451538 3300032126 Bacteria 1111
309 Ga0307415_101404023 3300032126 Unclassified 665
310 Ga0307415_101548038 3300032126 Unclassified 635
311 Ga0373959_0060457 3300034820 Bacteria 837
312 Ga0373934_0000506 3300035086 Bacteria 13684
313 Ga0373944_0006613 3300035089 Bacteria 3079
314 Ga0373945_0003728 3300035116 Bacteria 4803
315 Ga0373953_0007584 3300035117 Bacteria 3642
316 Ga0373954_0002646 3300035118 Bacteria 7538
317 Ga0373956_0000240 3300035119 Bacteria 21690
318 Ga0373957_0014943 3300035120 Unclassified 2662
319 Ga0373943_0002262 3300035170 Bacteria 8738
320 Ga0373946_0168448 3300035171 Unclassified 1032
321 Ga0373924_0010613 3300035410 Bacteria 3405
322 Ga0373935_0002849 3300035692 Bacteria 9954
323 Ga0373935_0633950 3300035692 Unclassified 783
324 Ga0373927_0003500 3300035695 Bacteria 11238
325 Ga0373927_0171512 3300035695 Bacteria 1422
326 Ga0373933_0000091 3300035724 Bacteria 56608
327 Ga0373947_0000257 3300035725 Bacteria 29941
328 Ga0373937_0000104 3300036401 Bacteria 80334
329 Ga0373937_0153187 3300036401 Bacteria 2160
330 Ga0373937_0719315 3300036401 Bacteria 945
331 Ga0373925_0000876 3300037068 Bacteria 27492
332 Ga0436365_0214472 3300039437 Bacteria 19566
333 Ga0451577_0316132 3300042876 Bacteria 1416
334 Ga0451577_0407592 3300042876 Bacteria 1234
335 Ga0451577_1530614 3300042876 Bacteria 589
336 Ga0466961_0484850 3300044693 Bacteria 747
337 Ga0466963_0294816 3300044694 Bacteria 1140
338 Ga0466971_0052744 3300044719 Bacteria 1832
339 Ga0466970_0632728 3300044765 Bacteria 622
340 Ga0466957_0169430 3300044842 Bacteria 1422
341 Ga0466957_0879471 3300044842 Bacteria 640
342 Ga0466960_0582977 3300044901 Bacteria 662
343 Ga0466959_0040386 3300045049 Bacteria 3446
344 Ga0466959_0069565 3300045049 Bacteria 2550
345 Ga0466967_0019210 3300045976 Bacteria 5489
346 Ga0466967_0168743 3300045976 Bacteria 2058
347 Ga0495592_0001993 3300046454 Bacteria 14402
348 Ga0495603_0203247 3300046455 Unclassified 1145
349 Ga0495629_0077756 3300046459 Unclassified 2316
350 Ga0495629_0304949 3300046459 Bacteria 1090
351 Ga0495638_0114627 3300046460 Bacteria 1598
352 Ga0495651_0002399 3300046462 Bacteria 14466
353 Ga0495653_0000064 3300046463 Bacteria 92950
354 Ga0495580_0003769 3300046472 Bacteria 12832
355 Ga0495582_0002258 3300046473 Bacteria 10777
356 Ga0495639_0000281 3300046475 Bacteria 25099
357 Ga0495639_0106130 3300046475 Bacteria 1330
358 Ga0495662_0625821 3300046476 Unclassified 526
359 Ga0495664_0060476 3300046477 Bacteria 2255
360 Ga0495664_0110395 3300046477 Bacteria 1660
361 Ga0495594_0019105 3300046499 Bacteria 3640
362 Ga0495608_0000200 3300046511 Bacteria 42536
363 Ga0495618_0110863 3300046514 Bacteria 1757
364 Ga0495628_0000571 3300046516 Bacteria 33828
365 Ga0495630_0004824 3300046517 Bacteria 9458
366 Ga0495652_0002046 3300046529 Bacteria 21375
367 Ga0495652_0058535 3300046529 Bacteria 3262
368 Ga0495665_0000269 3300046531 Bacteria 26394
369 Ga0495665_0098270 3300046531 Bacteria 1537
370 Ga0495640_0254013 3300046533 Bacteria 1100
371 Ga0495586_0036071 3300046535 Bacteria 2654
372 Ga0495586_0060013 3300046535 Bacteria 2067
373 Ga0495587_0000557 3300046536 Bacteria 25724
374 Ga0495587_0033308 3300046536 Bacteria 3111
375 Ga0495587_0105163 3300046536 Bacteria 1624
376 Ga0495598_0021371 3300046537 Bacteria 1721
377 Ga0495645_0000675 3300046543 Bacteria 23469
378 Ga0495667_0000234 3300046559 Bacteria 36417
379 Ga0495667_0232720 3300046559 Unclassified 1175
380 Ga0495634_0218312 3300046642 Unclassified 1178
381 Ga0495635_0000027 3300046663 Bacteria 123782
382 Ga0495588_0000605 3300046674 Bacteria 16885
383 Ga0495657_0000129 3300046675 Bacteria 67136
384 Ga0495599_0000121 3300046678 Bacteria 52373
385 Ga0495623_0000470 3300046679 Bacteria 26614
386 Ga0495646_0004308 3300046680 Bacteria 8967
387 Ga0495658_0000078 3300046683 Bacteria 48561
388 Ga0495613_0006919 3300046689 Bacteria 8459
389 Ga0495613_0119985 3300046689 Bacteria 1888
390 Ga0495613_0568635 3300046689 Bacteria 757
391 Ga0495600_0000038 3300046809 Bacteria 77979
392 Ga0495581_0000461 3300047315 Bacteria 20789
393 Ga0495581_0036623 3300047315 Unclassified 2839
394 Ga0495604_0003741 3300047317 Bacteria 12120
395 Ga0495604_0168691 3300047317 Bacteria 1541
396 Ga0495636_0066521 3300047318 Bacteria 1532
397 Ga0495674_0000649 3300047319 Bacteria 32671
398 Ga0495680_0006631 3300047322 Bacteria 10720
399 Ga0495680_0443348 3300047322 Unclassified 890
400 Ga0495675_0005579 3300047444 Bacteria 7679
401 Ga0495675_0101416 3300047444 Bacteria 1801
402 Ga0495684_0000805 3300047471 Bacteria 25405
403 Ga0495684_0703914 3300047471 Unclassified 670
404 Ga0495593_0001622 3300047673 Bacteria 13313
405 Ga0495593_0048188 3300047673 Bacteria 2265
406 Ga0495602_0000377 3300048088 Bacteria 41583
407 Ga0495614_0000127 3300048089 Bacteria 26520
408 Ga0495615_0140663 3300048090 Bacteria 712
409 Ga0496107_0905155 3300048910 Bacteria 643
410 Ga0496109_0806261 3300048912 Bacteria 877
411 Ga0496112_0266420 3300048915 Unclassified 1662
412 Ga0496124_0532355 3300048927 Bacteria 780
413 Ga0501292_002627 3300049515 Bacteria 2333
414 Ga0501037_0387964 3300049573 Bacteria 959
415 Ga0501047_0040163 3300049581 Bacteria 4526
416 Ga0501047_0726433 3300049581 Bacteria 810
417 Ga0501067_0422890 3300049583 Unclassified 743
418 Ga0501069_0799741 3300049585 Bacteria 571
419 Ga0501202_001256 3300049652 Bacteria 4007
420 Ga0501202_123063 3300049652 Bacteria 654
421 Ga0501207_015129 3300049654 Unclassified 1185
422 Ga0501217_029281 3300049661 Unclassified 1346
423 Ga0501222_007756 3300049662 Unclassified 1431
424 Ga0501224_002674 3300049664 Bacteria 2448
425 Ga0501227_007788 3300049665 Bacteria 2297
426 Ga0501235_000603 3300049669 Bacteria 7245
427 Ga0501239_015643 3300049672 Unclassified 888
428 Ga0501249_002790 3300049679 Bacteria 3518
429 Ga0501249_077806 3300049679 Unclassified 778
430 Ga0501250_005039 3300049680 Bacteria 1342
431 Ga0501252_000513 3300049682 Unclassified 3014
432 Ga0501257_002165 3300049686 Unclassified 4114
433 Ga0501259_000945 3300049688 Bacteria 4794
434 Ga0501261_001301 3300049690 Bacteria 3062
435 Ga0501261_033896 3300049690 Bacteria 782
436 Ga0501221_000158 3300049704 Bacteria 9091
437 Ga0501225_0004013 3300049705 Bacteria 4404
438 Ga0501234_000454 3300049707 Bacteria 6200
439 Ga0501245_003597 3300049708 Bacteria 2110
440 Ga0501268_000036 3300049765 Bacteria 11024
441 Ga0501283_047802 3300049779 Bacteria 753
442 Ga0501035_0000637 3300049822 Bacteria 38663
443 Ga0501212_000092 3300049851 Bacteria 6798
444 nmdc:mga06r32_126941_c1 3300050510 Bacteria 2520
445 nmdc:mga0n895_453776_c1 3300050512 Unclassified 1294
446 nmdc:mga0rr50_818340_c1 3300050513 Unclassified 794
447 Ga0495601_0011009 3300053077 Bacteria 5404
448 Ga0495601_0077255 3300053077 Bacteria 2132
449 Ga0495612_0001647 3300053078 Bacteria 9191
450 Ga0495595_0167463 3300053084 Bacteria 1086
451 Ga0495619_0000293 3300053085 Bacteria 35547
452 Ga0500651_0009632 3300053093 Bacteria 5756
453 Ga0501084_1301818 3300054114 Unclassified 609
454 Ga0590077_054180 3300059426 Bacteria 903
455 Ga0307412_10068926
456 MBSR1b_contig_234465
457 rootH2_10119781
458 Ga0058861_12029262
459 Ga0065704_10220987
460 Ga0065712_10111836
461 Ga0065715_10094607
462 Ga0065715_10218059
463 Ga0070658_10024256
464 Ga0070658_10049958
465 Ga0070658_10110825
466 Ga0070658_10503072
467 Ga0070683_100008849
468 Ga0070683_100014305
469 Ga0070683_100107195
470 Ga0070683_100782704
471 Ga0070690_100061231
472 Ga0070670_100171389
473 Ga0070680_100000046
474 Ga0070680_100000169
475 Ga0070680_100031255
476 Ga0070680_100039382
477 Ga0070682_100000899
478 Ga0070682_100808891
479 Ga0068868_100491898
480 Ga0068868_100615599
481 Ga0070660_100120344
482 Ga0070660_100339643
483 Ga0070660_100563104
484 Ga0070689_100064680
485 Ga0070689_100305843
486 Ga0070691_10111228
487 Ga0070687_100090378
488 Ga0070661_100001361
489 Ga0070661_100015384
490 Ga0070661_100463656
491 Ga0070692_10022581
492 Ga0070692_10190198
493 Ga0070692_10227173
494 Ga0070673_100156357
495 Ga0070673_100507938
496 Ga0070673_100551745
497 Ga0070659_100005204
498 Ga0070659_100047285
499 Ga0070703_10072463
500 Ga0070709_10090314
501 Ga0070714_100072871
502 Ga0070713_100608881
503 Ga0070710_10797959
504 Ga0070711_100205184
505 Ga0070700_101256823
506 Ga0070663_100103613
507 Ga0070663_100114008
508 Ga0070662_100537616
509 Ga0070681_10019659
510 Ga0070681_10186977
511 Ga0070681_10267863
512 Ga0070681_10373486
513 Ga0070681_11041978
514 Ga0068867_100029370
515 Ga0068867_100714226
516 Ga0070707_100065757
517 Ga0070707_100557406
518 Ga0070698_100024608
519 Ga0070698_100674732
520 Ga0070699_100004521
521 Ga0070699_100005932
522 Ga0070699_100476717
523 Ga0070679_100000080
524 Ga0070679_100000192
525 Ga0070679_100104444
526 Ga0070679_100394377
527 Ga0070679_100497378
528 Ga0070679_100683911
529 Ga0070679_100827142
530 Ga0070679_100959811
531 Ga0070679_101240832
532 Ga0070679_101958515
533 Ga0070684_100006505
534 Ga0070684_100112809
535 Ga0068853_100070798
536 Ga0068853_100601319
537 Ga0070686_100164960
538 Ga0070695_100860128
539 Ga0070696_100000387
540 Ga0070696_101419305
541 Ga0070693_100180311
542 Ga0070665_100073330
543 Ga0070704_100230685
544 Ga0068855_100056484
545 Ga0068855_100063697
546 Ga0070664_100072691
547 Ga0068857_100641259
548 Ga0068854_100084992
549 Ga0068854_100415111
550 Ga0068856_100310988
551 Ga0070702_100104043
552 Ga0068852_100905048
553 Ga0068864_100194105
554 Ga0068864_100570179
555 Ga0068864_101616266
556 Ga0068866_10764983
557 Ga0068861_100580446
558 Ga0068851_10135647
559 Ga0068863_101636947
560 Ga0068860_100067394
561 Ga0081539_10029337
562 Ga0070717_10007339
563 Ga0070717_10349284
564 Ga0070715_10089861
565 Ga0070716_100347112
566 Ga0097621_101686578
567 Ga0075428_100252572
568 Ga0075431_100050244
569 Ga0075434_100489793
570 Ga0068865_100234299
571 Ga0075435_100281386
572 Ga0111539_11517358
573 Ga0105241_10000031
574 Ga0105241_10477309
575 Ga0105248_10376571
576 Ga0105248_10595520
577 Ga0105246_10160334
578 Ga0105246_10301780
579 Ga0157373_10011848
580 Ga0157373_10023419
581 Ga0157373_10137094
582 Ga0157373_10545736
583 Ga0157371_10082670
584 Ga0157370_10012367
585 Ga0157370_10328753
586 Ga0157370_11050462
587 Ga0157369_10144411
588 Ga0157374_10063177
589 Ga0157374_11068545
590 Ga0157374_11192395
591 Ga0157378_10555617
592 Ga0163162_10619137
593 Ga0157372_10005616
594 Ga0157372_10045656
595 Ga0157372_10217773
596 Ga0157372_10297929
597 Ga0157372_10406256
598 Ga0157375_10008780
599 Ga0157375_10818646
600 Ga0182008_10036862
601 Ga0206353_10506143
602 Ga0213876_10002521
603 Ga0207656_10110060
604 Ga0207680_10092029
605 Ga0207699_10160175
606 Ga0207699_10164263
607 Ga0207645_10048860
608 Ga0207705_10043828
609 Ga0207705_10098767
610 Ga0207654_10000031
611 Ga0207654_10067383
612 Ga0207707_10000145
613 Ga0207707_10000291
614 Ga0207707_10062298
615 Ga0207707_10281150
616 Ga0207707_10946765
617 Ga0207695_10001150
618 Ga0207663_10039695
619 Ga0207660_10000293
620 Ga0207660_10001150
621 Ga0207660_10023053
622 Ga0207660_10152184
623 Ga0207660_10455182
624 Ga0207657_10062066
625 Ga0207657_10115527
626 Ga0207657_10126808
627 Ga0207649_10133891
628 Ga0207649_10291145
629 Ga0207649_10414215
630 Ga0207652_10000247
631 Ga0207652_10001846
632 Ga0207652_10004621
633 Ga0207652_10125074
634 Ga0207652_10780339
635 Ga0207652_11357041
636 Ga0207646_10055761
637 Ga0207646_10791706
638 Ga0207694_11063375
639 Ga0207659_10767029
640 Ga0207687_10752367
641 Ga0207644_10471214
642 Ga0207690_10018462
643 Ga0207690_10143483
644 Ga0207706_10417775
645 Ga0207706_10823174
646 Ga0207670_10014133
647 Ga0207691_10080518
648 Ga0207691_11200562
649 Ga0207711_10381584
650 Ga0207661_10016821
651 Ga0207661_10168034
652 Ga0207661_10564203
653 Ga0207679_10067205
654 Ga0207667_10103103
655 Ga0207667_10224895
656 Ga0207651_10446846
657 Ga0207651_10492732
658 Ga0207640_10000895
659 Ga0207639_10290832
660 Ga0207639_10375333
661 Ga0207639_10552227
662 Ga0207678_10132913
663 Ga0207708_10194306
664 Ga0207702_10631554
665 Ga0207648_10576457
666 Ga0207648_10816191
667 Ga0207676_10452449
668 Ga0207676_10749084
669 Ga0207698_10017474
670 Ga0207698_10093639
671 Ga0209969_1002266
672 Ga0209969_1004685
673 Ga0209967_1032297
674 Ga0209981_1004760
675 Ga0209996_1002203
676 Ga0209984_1001356
677 Ga0210000_1002559
678 Ga0210000_1002568
679 Ga0209995_1000109
680 Ga0209999_1000063
681 Ga0209999_1000110
682 Ga0210002_1002567
683 Ga0209983_1002153
684 Ga0209971_1002823
685 Ga0209971_1022980
686 Ga0209966_1000462
687 Ga0209966_1011055
688 Ga0209998_10000026
689 Ga0209974_10000165
690 Ga0268264_10013811
691 Ga0307408_100026037
692 Ga0307408_100278088
693 Ga0307408_101860773
694 Ga0265314_10235236
695 Ga0307405_10003342
696 Ga0307405_10055454
697 Ga0307405_10087226
698 Ga0307405_10301218
699 Ga0307413_10000952
700 Ga0307413_10002253
701 Ga0307413_10042197
702 Ga0307413_10088528
703 Ga0307413_10241078
704 Ga0307410_10002519
705 Ga0307410_10041057
706 Ga0307410_10121735
707 Ga0307410_10268630
708 Ga0307410_10364658
709 Ga0307410_10380215
710 Ga0307410_10708340
711 Ga0307406_10001692
712 Ga0307406_10012484
713 Ga0307406_10016465
714 Ga0307406_10255845
715 Ga0307407_10000508
716 Ga0307407_10017516
717 Ga0307407_10051285
718 Ga0307407_10058309
719 Ga0307407_10099175
720 Ga0307407_10117850
721 Ga0307407_10158995
722 Ga0307407_10328986
723 Ga0307407_10393574
724 Ga0307412_10007603
725 Ga0307412_10126891
726 Ga0307412_10152352
727 Ga0307412_10213491
728 Ga0307412_10311812
729 Ga0307409_100000906
730 Ga0307409_100004450
731 Ga0307409_100016184
732 Ga0307409_100028621
733 Ga0307409_100044426
734 Ga0307409_100076832
735 Ga0307409_101099679
736 Ga0307416_100000749
737 Ga0307416_100004112
738 Ga0307416_100027306
739 Ga0307416_100077686
740 Ga0307416_100080717
741 Ga0307416_100137765
742 Ga0307416_100204654
743 Ga0307416_100440870
744 Ga0307416_102684427
745 Ga0307414_10014782
746 Ga0307414_10041509
747 Ga0307414_10852057
748 Ga0307414_10853862
749 Ga0307411_10001711
750 Ga0307411_10002243
751 Ga0307411_10010325
752 Ga0307411_10074306
753 Ga0307411_10170740
754 Ga0307411_10682555
755 Ga0307411_11340195
756 Ga0307415_100007509
757 Ga0307415_100057199
758 Ga0307415_100075712
759 Ga0307415_100125432
760 Ga0307415_100126981
761 Ga0307415_100222521
762 Ga0307415_100451538
763 Ga0307415_101404023
764 Ga0307415_101548038
765 Ga0373959_0060457
766 Ga0373934_0000506
767 Ga0373944_0006613
768 Ga0373945_0003728
769 Ga0373953_0007584
770 Ga0373954_0002646
771 Ga0373956_0000240
772 Ga0373957_0014943
773 Ga0373943_0002262
774 Ga0373946_0168448
775 Ga0373924_0010613
776 Ga0373935_0002849
777 Ga0373935_0633950
778 Ga0373927_0003500
779 Ga0373927_0171512
780 Ga0373933_0000091
781 Ga0373947_0000257
782 Ga0373937_0000104
783 Ga0373937_0153187
784 Ga0373937_0719315
785 Ga0373925_0000876
786 Ga0436365_0214472
787 Ga0451577_0316132
788 Ga0451577_0407592
789 Ga0451577_1530614
790 Ga0466961_0484850
791 Ga0466963_0294816
792 Ga0466971_0052744
793 Ga0466970_0632728
794 Ga0466957_0169430
795 Ga0466957_0879471
796 Ga0466960_0582977
797 Ga0466959_0040386
798 Ga0466959_0069565
799 Ga0466967_0019210
800 Ga0466967_0168743
801 Ga0495592_0001993
802 Ga0495603_0203247
803 Ga0495629_0077756
804 Ga0495629_0304949
805 Ga0495638_0114627
806 Ga0495651_0002399
807 Ga0495653_0000064
808 Ga0495580_0003769
809 Ga0495582_0002258
810 Ga0495639_0000281
811 Ga0495639_0106130
812 Ga0495662_0625821
813 Ga0495664_0060476
814 Ga0495664_0110395
815 Ga0495594_0019105
816 Ga0495608_0000200
817 Ga0495618_0110863
818 Ga0495628_0000571
819 Ga0495630_0004824
820 Ga0495652_0002046
821 Ga0495652_0058535
822 Ga0495665_0000269
823 Ga0495665_0098270
824 Ga0495640_0254013
825 Ga0495586_0036071
826 Ga0495586_0060013
827 Ga0495587_0000557
828 Ga0495587_0033308
829 Ga0495587_0105163
830 Ga0495598_0021371
831 Ga0495645_0000675
832 Ga0495667_0000234
833 Ga0495667_0232720
834 Ga0495634_0218312
835 Ga0495635_0000027
836 Ga0495588_0000605
837 Ga0495657_0000129
838 Ga0495599_0000121
839 Ga0495623_0000470
840 Ga0495646_0004308
841 Ga0495658_0000078
842 Ga0495613_0006919
843 Ga0495613_0119985
844 Ga0495613_0568635
845 Ga0495600_0000038
846 Ga0495581_0000461
847 Ga0495581_0036623
848 Ga0495604_0003741
849 Ga0495604_0168691
850 Ga0495636_0066521
851 Ga0495674_0000649
852 Ga0495680_0006631
853 Ga0495680_0443348
854 Ga0495675_0005579
855 Ga0495675_0101416
856 Ga0495684_0000805
857 Ga0495684_0703914
858 Ga0495593_0001622
859 Ga0495593_0048188
860 Ga0495602_0000377
861 Ga0495614_0000127
862 Ga0495615_0140663
863 Ga0496107_0905155
864 Ga0496109_0806261
865 Ga0496112_0266420
866 Ga0496124_0532355
867 Ga0501292_002627
868 Ga0501037_0387964
869 Ga0501047_0040163
870 Ga0501047_0726433
871 Ga0501067_0422890
872 Ga0501069_0799741
873 Ga0501202_001256
874 Ga0501202_123063
875 Ga0501207_015129
876 Ga0501217_029281
877 Ga0501222_007756
878 Ga0501224_002674
879 Ga0501227_007788
880 Ga0501235_000603
881 Ga0501239_015643
882 Ga0501249_002790
883 Ga0501249_077806
884 Ga0501250_005039
885 Ga0501252_000513
886 Ga0501257_002165
887 Ga0501259_000945
888 Ga0501261_001301
889 Ga0501261_033896
890 Ga0501221_000158
891 Ga0501225_0004013
892 Ga0501234_000454
893 Ga0501245_003597
894 Ga0501268_000036
895 Ga0501283_047802
896 Ga0501035_0000637
897 Ga0501212_000092
898 nmdc:mga06r32_126941_c1
899 nmdc:mga0n895_453776_c1
900 nmdc:mga0rr50_818340_c1
901 Ga0495601_0011009
902 Ga0495601_0077255
903 Ga0495612_0001647
904 Ga0495595_0167463
905 Ga0495619_0000293
906 Ga0500651_0009632
907 Ga0501084_1301818
908 Ga0590077_054180

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13185

GAF_2

GAF domain

65

192

0.83

PF01590

GAF

GAF domain

48

191

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rfb-assembly1.cif.gz_A structure of frmsr 0.9541 15 156
3ksf-assembly3.cif.gz_F structure of frmsr of staphylococcus aureus (reduced form) 0.9492 17 162
3ksg-assembly1.cif.gz_B structure of frmsr of staphylococcus aureus (complex with substrate) 0.9384 17 162
1f5m-assembly1.cif.gz_B structure of the gaf domain 0.9373 10 162
5hl6-assembly1.cif.gz_A crystal structure of a putative gaf sensor protein from burkholderia vietnamiensis 0.9352 11 162
ID Description Score Start End Superfamily
af_Q8MTJ7_3_158_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9595 6 161 3.30.450.40
af_P76129_130_253_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.9543 117 138 3.30.450.20
3rfbA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9541 15 156 3.30.450.40
af_Q8MTJ7_3_158_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9416 6 161 3.30.450.40
af_I1MX26_214_350_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.9363 117 138 3.30.450.20
ID Description Score Start End GO Terms
AF-A0A4Q6A9E3-F1-model_v4 deleted 0.9922 1 159
AF-A0A7W0W028-F1-model_v4 GAF domain-containing protein 0.9904 38 164 GO:0005829
GO:0033745
AF-A0A7Y4MA84-F1-model_v4 deleted 0.9881 1 161
AF-W0RCJ9-F1-model_v4 GAF domain protein 0.9854 1 161 GO:0005829
GO:0033745
AF-A0A7W0W028-F1-model_v4 GAF domain-containing protein 0.9827 38 164 GO:0005829
GO:0033745

Map