F447278

General Info

Members Datasets Scaffolds Average Seq Length
453 222 906 64

Family's Representative Sequence

Representative Sequence 3300049679|Ga0501249_006731|Ga0501249_006731_519_740
Length 73
Sequence MASPGKKAYPLRIDPALWEELQRLAARDLRSVNAEIEFLLREGLARRGVKMKDDKSNDEDVESGELPDGSTKT

Samples

Sample ID Description Type Environment
1 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
29 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
46 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
47 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
48 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
49 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
78 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
79 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
80 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
81 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
91 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
92 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
93 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
94 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
95 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
96 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
97 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
98 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
99 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
100 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
101 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
102 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
107 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
108 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
123 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
126 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
130 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
131 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
132 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
133 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
136 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
137 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
138 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
144 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
145 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
146 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
149 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
154 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
158 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
159 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
173 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
176 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
177 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
194 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
195 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
202 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
203 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
204 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
205 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
209 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
210 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
212 2643221645 Massilia sp. Root351 Isolate Unclassified
213 2643221664 Massilia sp. Root418 Isolate Unclassified
214 2643221684 Massilia sp. Root133 Isolate Unclassified
215 2738541280 Massilia sp. GV090 Isolate Unclassified
216 2738541300 Massilia sp. GV016 Isolate Unclassified
217 2738543018 Massilia sp. GV045 Isolate Unclassified
218 2738543030 Massilia sp. GV097 Isolate Unclassified
219 2857553236 Duganella sp. R-74557 Isolate Unclassified
220 2857558681 Duganella sp. R-74565 Isolate Unclassified
221 2904424332 Duganella sp. 1411 Isolate Rhizosphere
222 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.13
Metatranscriptomes 0.44
Isolates 2.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.06
Nodule 0.22
Rhizoplane 4.86
Rhizosphere 82.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501249_006731 3300049679 Bacteria 2368
2 JGI25158J39367_1005056 3300002739 Bacteria 1949
3 JGI25159J45721_1003893 3300002987 Bacteria 5104
4 rootL2_10143385 3300003322 Bacteria 2225
5 JGI25161J50226_1000542 3300003374 Bacteria 16111
6 Ga0055525_1000025 3300003759 Bacteria 347582
7 Ga0055542_1028482 3300003762 Bacteria 735
8 Ga0055526_1000514 3300003771 Bacteria 30863
9 Ga0055526_1046184 3300003771 Bacteria 1034
10 Ga0055537_1000098 3300003773 Bacteria 65302
11 Ga0055524_1024990 3300003775 Bacteria 1880
12 Ga0055534_1000009 3300003784 Bacteria 210256
13 Ga0055528_1000012 3300003790 Bacteria 182704
14 Ga0055543_1000760 3300004625 Bacteria 16149
15 Ga0055543_1012413 3300004625 Bacteria 1714
16 Ga0065165_1000051 3300005262 Bacteria 194844
17 Ga0065165_1003498 3300005262 Bacteria 10938
18 Ga0065165_1009472 3300005262 Bacteria 4362
19 Ga0070658_10256422 3300005327 Bacteria 1484
20 Ga0070658_10524302 3300005327 Bacteria 1024
21 Ga0070658_11510117 3300005327 Bacteria 582
22 Ga0070658_11588707 3300005327 Bacteria 567
23 Ga0070658_11610997 3300005327 Bacteria 562
24 Ga0070666_11185908 3300005335 Bacteria 569
25 Ga0070660_100015265 3300005339 Bacteria 5542
26 Ga0070660_100379049 3300005339 Bacteria 1167
27 Ga0070659_100090707 3300005366 Bacteria 2449
28 Ga0070663_100813119 3300005455 Bacteria 802
29 Ga0070663_101316059 3300005455 Bacteria 638
30 Ga0070662_100214420 3300005457 Bacteria 1533
31 Ga0070662_100282156 3300005457 Bacteria 1344
32 Ga0070662_100294257 3300005457 Bacteria 1317
33 Ga0068867_100629880 3300005459 Bacteria 939
34 Ga0068855_100035470 3300005563 Bacteria 5940
35 Ga0068855_100213646 3300005563 Bacteria 2166
36 Ga0070664_100234045 3300005564 Bacteria 1647
37 Ga0070664_102403498 3300005564 Bacteria 500
38 Ga0068857_102457908 3300005577 Bacteria 511
39 Ga0068856_100324739 3300005614 Bacteria 1556
40 Ga0068852_100333508 3300005616 Bacteria 1476
41 Ga0075362_10072624 3300006177 Bacteria 1574
42 Ga0079104_1004117 3300006946 Bacteria 6379
43 Ga0105244_10003601 3300009036 Bacteria 11001
44 Ga0105244_10297128 3300009036 Bacteria 748
45 Ga0105240_10750196 3300009093 Bacteria 1061
46 Ga0105243_12114403 3300009148 Bacteria 599
47 Ga0105241_10191084 3300009174 Bacteria 1704
48 Ga0105241_11056602 3300009174 Bacteria 762
49 Ga0105242_10240484 3300009176 Bacteria 1627
50 Ga0105242_10705786 3300009176 Bacteria 987
51 Ga0105242_11470153 3300009176 Bacteria 711
52 Ga0105248_10479800 3300009177 Bacteria 1401
53 Ga0105237_10980750 3300009545 Bacteria 852
54 Ga0105238_10338631 3300009551 Bacteria 1492
55 Ga0105239_10399044 3300010375 Bacteria 1556
56 Ga0105246_10353440 3300011119 Bacteria 1205
57 Ga0105246_12277374 3300011119 Bacteria 529
58 Ga0157371_10000060 3300013102 Bacteria 170456
59 Ga0157369_10451306 3300013105 Bacteria 1331
60 Ga0157374_10681251 3300013296 Bacteria 1041
61 Ga0157374_11843263 3300013296 Bacteria 630
62 Ga0157372_10672708 3300013307 Bacteria 1205
63 Ga0157372_10673428 3300013307 Bacteria 1204
64 Ga0157372_11421190 3300013307 Bacteria 800
65 Ga0157372_12147124 3300013307 Bacteria 642
66 Ga0157372_12657226 3300013307 Bacteria 574
67 Ga0163163_12495755 3300014325 Bacteria 575
68 Ga0182008_10182501 3300014497 Bacteria 1062
69 Ga0182006_1000054 3300015261 Bacteria 174021
70 Ga0182006_1049374 3300015261 Bacteria 1624
71 Ga0182006_1208317 3300015261 Bacteria 646
72 Ga0182007_10107553 3300015262 Bacteria 926
73 Ga0182007_10129612 3300015262 Bacteria 848
74 Ga0182007_10287233 3300015262 Bacteria 600
75 Ga0182005_1000012 3300015265 Bacteria 396944
76 Ga0209436_100099 3300025208 Bacteria 42519
77 Ga0209436_112786 3300025208 Bacteria 1409
78 Ga0209563_100003 3300025230 Bacteria 1932942
79 Ga0209677_107770 3300025253 Bacteria 2200
80 Ga0209148_1001884 3300025254 Bacteria 8677
81 Ga0209565_1000015 3300025263 Bacteria 494091
82 Ga0209673_1000017 3300025273 Bacteria 492994
83 Ga0209130_1000063 3300025284 Bacteria 198142
84 Ga0209130_1001327 3300025284 Bacteria 16820
85 Ga0209675_1000012 3300025291 Bacteria 494061
86 Ga0209564_1000016 3300025295 Bacteria 613131
87 Ga0209564_1038206 3300025295 Bacteria 1339
88 Ga0209256_1000593 3300025299 Bacteria 50391
89 Ga0207426_1116192 3300025302 Bacteria 668
90 Ga0207655_1030945 3300025728 Bacteria 2478
91 Ga0207705_10008590 3300025909 Bacteria 7445
92 Ga0207705_10734260 3300025909 Bacteria 767
93 Ga0207654_10097376 3300025911 Bacteria 1806
94 Ga0207695_10742496 3300025913 Bacteria 862
95 Ga0207671_10402673 3300025914 Bacteria 1088
96 Ga0207657_10021673 3300025919 Bacteria 6039
97 Ga0207657_10253278 3300025919 Bacteria 1403
98 Ga0207657_10284239 3300025919 Bacteria 1313
99 Ga0207649_10113539 3300025920 Bacteria 1814
100 Ga0207690_10043094 3300025932 Bacteria 2968
101 Ga0207706_10122474 3300025933 Bacteria 2287
102 Ga0207706_10316299 3300025933 Bacteria 1359
103 Ga0207706_10615991 3300025933 Bacteria 931
104 Ga0207686_10071301 3300025934 Bacteria 2235
105 Ga0207679_10073281 3300025945 Bacteria 2590
106 Ga0207679_10369299 3300025945 Bacteria 1255
107 Ga0207667_10014971 3300025949 Bacteria 8821
108 Ga0207667_10383648 3300025949 Bacteria 1432
109 Ga0207640_11157111 3300025981 Bacteria 686
110 Ga0207639_11861643 3300026041 Bacteria 563
111 Ga0207678_10448212 3300026067 Bacteria 1121
112 Ga0207702_11043670 3300026078 Bacteria 811
113 Ga0207674_11126314 3300026116 Bacteria 754
114 Ga0207698_10443745 3300026142 Bacteria 1251
115 Ga0207698_11613753 3300026142 Bacteria 664
116 Ga0316177_1065105 3300030731 Bacteria 1242
117 Ga0316178_1014113 3300030735 Bacteria 913
118 Ga0316180_1061982 3300030736 Bacteria 3369
119 Ga0316181_1085165 3300030744 Bacteria 1186
120 Ga0316181_1092946 3300030744 Bacteria 675
121 Ga0316182_1088262 3300030745 Bacteria 5540
122 Ga0316182_1220829 3300030745 Bacteria 599
123 Ga0307408_100000115 3300031548 Bacteria 88580
124 Ga0307408_100030755 3300031548 Bacteria 3731
125 Ga0307408_101035150 3300031548 Bacteria 758
126 Ga0307408_102055207 3300031548 Bacteria 550
127 Ga0307406_11688384 3300031901 Bacteria 561
128 Ga0307510_10473307 3300033180 Bacteria 694
129 Ga0395899_0009972 3300037312 Bacteria 7285
130 Ga0395899_0015599 3300037312 Bacteria 5793
131 Ga0395899_0015964 3300037312 Bacteria 5726
132 Ga0395899_0042960 3300037312 Bacteria 3372
133 Ga0395899_0190693 3300037312 Bacteria 1434
134 Ga0395899_0198965 3300037312 Bacteria 1398
135 Ga0395899_0336280 3300037312 Bacteria 1013
136 Ga0395899_0398420 3300037312 Bacteria 911
137 Ga0395899_0717455 3300037312 Bacteria 625
138 Ga0395900_0001651 3300037418 Bacteria 26103
139 Ga0395900_0040293 3300037418 Bacteria 4813
140 Ga0395900_0066863 3300037418 Bacteria 3693
141 Ga0395900_0117209 3300037418 Bacteria 2732
142 Ga0395900_0136346 3300037418 Bacteria 2514
143 Ga0395900_0277058 3300037418 Bacteria 1670
144 Ga0395900_0375594 3300037418 Bacteria 1390
145 Ga0395900_0380035 3300037418 Bacteria 1380
146 Ga0395900_0715228 3300037418 Bacteria 934
147 Ga0395900_1342690 3300037418 Bacteria 628
148 Ga0395898_0003616 3300037466 Bacteria 17209
149 Ga0395898_0060986 3300037466 Bacteria 3664
150 Ga0395898_0111766 3300037466 Bacteria 2618
151 Ga0395898_0260894 3300037466 Bacteria 1653
152 Ga0395898_0492134 3300037466 Bacteria 1166
153 Ga0395905_0030787 3300037471 Bacteria 5054
154 Ga0395905_0101509 3300037471 Bacteria 2700
155 Ga0395905_0304194 3300037471 Bacteria 1482
156 Ga0395905_0408833 3300037471 Bacteria 1252
157 Ga0395905_0774210 3300037471 Bacteria 862
158 Ga0395905_0788383 3300037471 Bacteria 853
159 Ga0395905_1147361 3300037471 Bacteria 680
160 Ga0395905_1658040 3300037471 Bacteria 544
161 Ga0395905_1815338 3300037471 Bacteria 515
162 Ga0395901_0000212 3300038443 Bacteria 73375
163 Ga0395901_0006637 3300038443 Bacteria 11691
164 Ga0395901_0074457 3300038443 Bacteria 3542
165 Ga0395901_0217719 3300038443 Bacteria 1996
166 Ga0395901_0296005 3300038443 Bacteria 1678
167 Ga0395901_0619258 3300038443 Bacteria 1089
168 Ga0395901_0676303 3300038443 Bacteria 1032
169 Ga0395901_0871002 3300038443 Bacteria 884
170 Ga0395901_1009956 3300038443 Bacteria 807
171 Ga0395901_1017081 3300038443 Bacteria 804
172 Ga0439433_0143336 3300041999 Bacteria 612
173 Ga0439448_0001989 3300042005 Bacteria 5465
174 Ga0439448_0002870 3300042005 Bacteria 4719
175 Ga0439448_0248527 3300042005 Bacteria 627
176 Ga0439449_0240098 3300042007 Bacteria 680
177 Ga0439450_014522 3300042008 Bacteria 1599
178 Ga0439450_030847 3300042008 Bacteria 1204
179 Ga0439455_0001953 3300042012 Bacteria 3634
180 Ga0439455_0018952 3300042012 Bacteria 1618
181 Ga0450911_038606 3300042115 Bacteria 619
182 Ga0450923_135349 3300042125 Bacteria 589
183 Ga0450904_000617 3300042139 Bacteria 6533
184 Ga0450906_014413 3300042145 Bacteria 1447
185 Ga0439458_0035450 3300042157 Bacteria 1199
186 Ga0439458_0046146 3300042157 Bacteria 1066
187 Ga0439458_0094442 3300042157 Bacteria 772
188 Ga0439458_0101782 3300042157 Bacteria 746
189 Ga0466969_0467808 3300044656 Bacteria 574
190 Ga0466972_0097447 3300044658 Bacteria 1393
191 Ga0466972_0218221 3300044658 Bacteria 892
192 Ga0466981_0279929 3300044669 Bacteria 1060
193 Ga0466965_0022307 3300044683 Bacteria 3053
194 Ga0466965_0031608 3300044683 Bacteria 2582
195 Ga0466965_0090731 3300044683 Bacteria 1554
196 Ga0466965_0128922 3300044683 Bacteria 1310
197 Ga0466966_0043982 3300044684 Bacteria 2860
198 Ga0466966_0063947 3300044684 Bacteria 2317
199 Ga0466966_0122513 3300044684 Bacteria 1596
200 Ga0466966_0146294 3300044684 Bacteria 1442
201 Ga0466966_0149658 3300044684 Bacteria 1424
202 Ga0466966_0176223 3300044684 Bacteria 1298
203 Ga0466966_0206452 3300044684 Bacteria 1188
204 Ga0466966_0815703 3300044684 Bacteria 562
205 Ga0466961_0160459 3300044693 Bacteria 1401
206 Ga0466961_0161747 3300044693 Bacteria 1395
207 Ga0466961_0216935 3300044693 Bacteria 1180
208 Ga0466961_0565297 3300044693 Bacteria 684
209 Ga0466964_0162126 3300044706 Bacteria 1046
210 Ga0466964_0230186 3300044706 Bacteria 904
211 Ga0466964_0690050 3300044706 Bacteria 568
212 Ga0466971_0123170 3300044719 Bacteria 1201
213 Ga0466971_0394712 3300044719 Bacteria 674
214 Ga0466968_0132824 3300044735 Bacteria 1134
215 Ga0466970_0032352 3300044765 Bacteria 2763
216 Ga0466970_0333357 3300044765 Bacteria 859
217 Ga0466957_0000121 3300044842 Bacteria 32737
218 Ga0466957_0529670 3300044842 Bacteria 819
219 Ga0466957_1042795 3300044842 Bacteria 588
220 Ga0466960_0381743 3300044901 Bacteria 809
221 Ga0466960_0757908 3300044901 Bacteria 585
222 Ga0466959_0049330 3300045049 Bacteria 3092
223 Ga0466959_0052265 3300045049 Bacteria 2993
224 Ga0466959_0203124 3300045049 Bacteria 1379
225 Ga0466958_0144378 3300045836 Bacteria 1499
226 Ga0466958_0435364 3300045836 Bacteria 848
227 Ga0466958_0550757 3300045836 Bacteria 749
228 Ga0466958_1029453 3300045836 Bacteria 537
229 Ga0466967_0022225 3300045976 Bacteria 5170
230 Ga0466967_0052799 3300045976 Bacteria 3570
231 Ga0466967_1476267 3300045976 Bacteria 677
232 Ga0495627_000007 3300046453 Bacteria 575915
233 Ga0495603_0015152 3300046455 Bacteria 4664
234 Ga0495590_0000005 3300046457 Bacteria 384276
235 Ga0495590_0000351 3300046457 Bacteria 23818
236 Ga0495590_0010773 3300046457 Bacteria 3427
237 Ga0495590_0018350 3300046457 Bacteria 2505
238 Ga0495638_0000027 3300046460 Bacteria 337569
239 Ga0495638_0039487 3300046460 Bacteria 2996
240 Ga0495638_0069291 3300046460 Bacteria 2162
241 Ga0495653_0029347 3300046463 Bacteria 4392
242 Ga0495653_0101394 3300046463 Bacteria 2085
243 Ga0495650_0005067 3300046471 Bacteria 8716
244 Ga0495580_0116060 3300046472 Bacteria 1859
245 Ga0495580_0373532 3300046472 Bacteria 964
246 Ga0495605_0000130 3300046474 Bacteria 98652
247 Ga0495605_0035728 3300046474 Bacteria 2510
248 Ga0495639_0069061 3300046475 Bacteria 1629
249 Ga0495664_0440544 3300046477 Bacteria 781
250 Ga0495584_0002296 3300046491 Bacteria 10910
251 Ga0495584_0023153 3300046491 Bacteria 3150
252 Ga0495584_0100451 3300046491 Bacteria 1462
253 Ga0495584_0127048 3300046491 Bacteria 1292
254 Ga0495584_0139500 3300046491 Bacteria 1231
255 Ga0495585_0127958 3300046492 Bacteria 1339
256 Ga0495594_0034155 3300046499 Bacteria 2767
257 Ga0495594_0194867 3300046499 Bacteria 1154
258 Ga0495596_0102206 3300046500 Bacteria 1113
259 Ga0495607_0000720 3300046501 Bacteria 31834
260 Ga0495607_0002353 3300046501 Bacteria 15449
261 Ga0495607_0003771 3300046501 Bacteria 11459
262 Ga0495607_0045162 3300046501 Bacteria 2593
263 Ga0495607_0048968 3300046501 Bacteria 2467
264 Ga0495607_0079564 3300046501 Bacteria 1805
265 Ga0495607_0137713 3300046501 Bacteria 1263
266 Ga0495583_0000100 3300046506 Bacteria 145745
267 Ga0495583_0086307 3300046506 Bacteria 1357
268 Ga0495606_0000907 3300046507 Bacteria 44030
269 Ga0495606_0013357 3300046507 Bacteria 6493
270 Ga0495606_0014188 3300046507 Bacteria 6236
271 Ga0495606_0018908 3300046507 Bacteria 5150
272 Ga0495606_0189323 3300046507 Bacteria 1180
273 Ga0495610_0035653 3300046512 Bacteria 2551
274 Ga0495610_0194909 3300046512 Bacteria 833
275 Ga0495616_0020730 3300046513 Bacteria 3570
276 Ga0495616_0051467 3300046513 Bacteria 2054
277 Ga0495630_0204651 3300046517 Bacteria 1506
278 Ga0495631_0029496 3300046518 Bacteria 2494
279 Ga0495643_0017494 3300046522 Bacteria 4189
280 Ga0495643_0039859 3300046522 Bacteria 2567
281 Ga0495643_0116173 3300046522 Bacteria 1355
282 Ga0495643_0272232 3300046522 Bacteria 782
283 Ga0495643_0329494 3300046522 Bacteria 688
284 Ga0495643_0477760 3300046522 Bacteria 539
285 Ga0495648_0000002 3300046524 Bacteria 593972
286 Ga0495648_0063987 3300046524 Bacteria 2169
287 Ga0495666_0002773 3300046526 Bacteria 8751
288 Ga0495666_0059723 3300046526 Bacteria 1823
289 Ga0495666_0227323 3300046526 Bacteria 853
290 Ga0495642_0001650 3300046528 Bacteria 9676
291 Ga0495642_0001734 3300046528 Bacteria 9396
292 Ga0495642_0004425 3300046528 Bacteria 5455
293 Ga0495642_0060610 3300046528 Bacteria 1569
294 Ga0495642_0111773 3300046528 Bacteria 1168
295 Ga0495652_0057178 3300046529 Bacteria 3309
296 Ga0495654_0038592 3300046530 Bacteria 2387
297 Ga0495654_0260549 3300046530 Bacteria 719
298 Ga0495665_0022066 3300046531 Bacteria 3423
299 Ga0495665_0540095 3300046531 Bacteria 585
300 Ga0495586_0021945 3300046535 Bacteria 3406
301 Ga0495587_0071730 3300046536 Bacteria 2014
302 Ga0495587_0137111 3300046536 Bacteria 1397
303 Ga0495587_0168312 3300046536 Bacteria 1245
304 Ga0495587_0184448 3300046536 Bacteria 1182
305 Ga0495609_0000055 3300046538 Bacteria 146808
306 Ga0495609_0017845 3300046538 Bacteria 3294
307 Ga0495609_0028210 3300046538 Bacteria 2562
308 Ga0495609_0085173 3300046538 Bacteria 1378
309 Ga0495597_0005636 3300046542 Bacteria 6598
310 Ga0495597_0016852 3300046542 Bacteria 3446
311 Ga0495597_0019193 3300046542 Bacteria 3201
312 Ga0495597_0084364 3300046542 Bacteria 1355
313 Ga0495645_0185021 3300046543 Bacteria 1424
314 Ga0495622_0000128 3300046557 Bacteria 65352
315 Ga0495622_0000313 3300046557 Bacteria 35947
316 Ga0495622_0099555 3300046557 Bacteria 1333
317 Ga0495633_0000031 3300046558 Bacteria 196727
318 Ga0495633_0000050 3300046558 Bacteria 155466
319 Ga0495633_0033913 3300046558 Bacteria 2458
320 Ga0495668_0000101 3300046616 Bacteria 137289
321 Ga0495668_0019952 3300046616 Bacteria 3856
322 Ga0495668_0024796 3300046616 Bacteria 3410
323 Ga0495668_0033381 3300046616 Bacteria 2891
324 Ga0495634_0048924 3300046642 Bacteria 2844
325 Ga0495625_0000121 3300046660 Bacteria 121186
326 Ga0495625_0019207 3300046660 Bacteria 5308
327 Ga0495625_0020342 3300046660 Bacteria 5127
328 Ga0495625_0279633 3300046660 Bacteria 1074
329 Ga0495659_0000204 3300046664 Bacteria 25590
330 Ga0495659_0003883 3300046664 Bacteria 4742
331 Ga0495661_0016832 3300046665 Bacteria 4833
332 Ga0495661_0034138 3300046665 Bacteria 3202
333 Ga0495661_0039378 3300046665 Bacteria 2937
334 Ga0495661_0053510 3300046665 Bacteria 2427
335 Ga0495661_0070618 3300046665 Bacteria 2043
336 Ga0495661_0411478 3300046665 Bacteria 656
337 Ga0495661_0488922 3300046665 Bacteria 588
338 Ga0495588_0000041 3300046674 Bacteria 377896
339 Ga0495588_0371690 3300046674 Bacteria 751
340 Ga0495588_0392610 3300046674 Bacteria 728
341 Ga0495599_0647049 3300046678 Bacteria 613
342 Ga0495623_0013663 3300046679 Bacteria 5263
343 Ga0495623_0041950 3300046679 Bacteria 2916
344 Ga0495646_0144343 3300046680 Bacteria 1328
345 Ga0495669_0002327 3300046684 Bacteria 7786
346 Ga0495613_0274683 3300046689 Bacteria 1171
347 Ga0495624_0038663 3300046690 Bacteria 3064
348 Ga0495670_0130447 3300046691 Bacteria 1310
349 Ga0495671_0000109 3300046692 Bacteria 74002
350 Ga0495649_0044576 3300046694 Bacteria 2421
351 Ga0495589_0000034 3300046794 Bacteria 162449
352 Ga0495589_0053074 3300046794 Bacteria 2001
353 Ga0495660_0000107 3300046810 Bacteria 89427
354 Ga0495660_0000860 3300046810 Bacteria 22420
355 Ga0495660_0001714 3300046810 Bacteria 14673
356 Ga0495660_0008054 3300046810 Bacteria 6192
357 Ga0495660_0032759 3300046810 Bacteria 2918
358 Ga0495660_0042127 3300046810 Bacteria 2523
359 Ga0495660_0102499 3300046810 Bacteria 1471
360 Ga0495581_0003117 3300047315 Bacteria 9493
361 Ga0495581_0077854 3300047315 Bacteria 1919
362 Ga0495581_0530015 3300047315 Bacteria 684
363 Ga0495604_0025156 3300047317 Bacteria 4743
364 Ga0495636_0005832 3300047318 Bacteria 4829
365 Ga0495672_0000244 3300047320 Bacteria 76463
366 Ga0495672_0107072 3300047320 Bacteria 1506
367 Ga0495680_0107112 3300047322 Bacteria 2076
368 Ga0495683_0093148 3300047323 Bacteria 1457
369 Ga0495687_000023 3300047443 Bacteria 317750
370 Ga0495687_000535 3300047443 Bacteria 45436
371 Ga0495687_000550 3300047443 Bacteria 44560
372 Ga0495687_001509 3300047443 Bacteria 21213
373 Ga0495687_022915 3300047443 Bacteria 2990
374 Ga0495675_0033927 3300047444 Bacteria 3258
375 Ga0495675_0231960 3300047444 Bacteria 1113
376 Ga0495675_0442231 3300047444 Bacteria 753
377 Ga0495677_0003378 3300047445 Bacteria 6211
378 Ga0495677_0009634 3300047445 Bacteria 3562
379 Ga0495677_0028108 3300047445 Bacteria 2041
380 Ga0495677_0101464 3300047445 Bacteria 1090
381 Ga0495685_017670 3300047447 Bacteria 2443
382 Ga0495685_061540 3300047447 Bacteria 1264
383 Ga0495681_0025025 3300047470 Bacteria 3129
384 Ga0495681_0042289 3300047470 Bacteria 2206
385 Ga0495681_0072981 3300047470 Bacteria 1550
386 Ga0495681_0165564 3300047470 Bacteria 918
387 Ga0495686_0001420 3300047472 Bacteria 26206
388 Ga0495686_0041981 3300047472 Bacteria 2910
389 Ga0495602_0019960 3300048088 Bacteria 6634
390 Ga0495626_0000037 3300048091 Bacteria 178573
391 Ga0495626_0164901 3300048091 Bacteria 926
392 Ga0496100_0244275 3300048903 Bacteria 1326
393 Ga0496100_0666647 3300048903 Bacteria 811
394 Ga0496100_0876345 3300048903 Bacteria 705
395 Ga0496102_0275122 3300048905 Bacteria 1587
396 Ga0496102_0357868 3300048905 Bacteria 1374
397 Ga0496102_0423092 3300048905 Bacteria 1251
398 Ga0496102_0989710 3300048905 Bacteria 761
399 Ga0496103_0001094 3300048906 Bacteria 18866
400 Ga0496105_0090364 3300048908 Bacteria 2529
401 Ga0496106_0007749 3300048909 Bacteria 7947
402 Ga0496106_0224057 3300048909 Bacteria 1500
403 Ga0496107_0029537 3300048910 Bacteria 3901
404 Ga0496108_1606227 3300048911 Bacteria 538
405 Ga0496110_0546455 3300048913 Bacteria 1053
406 Ga0496111_0456094 3300048914 Bacteria 943
407 Ga0496111_1058166 3300048914 Bacteria 580
408 Ga0496113_0240165 3300048916 Bacteria 1445
409 Ga0496113_0344536 3300048916 Bacteria 1195
410 Ga0496113_0722599 3300048916 Bacteria 794
411 Ga0496113_0851956 3300048916 Bacteria 722
412 Ga0496114_0040880 3300048917 Bacteria 3841
413 Ga0496115_1324130 3300048918 Bacteria 535
414 Ga0496116_0026712 3300048919 Bacteria 4213
415 Ga0496122_0034913 3300048925 Bacteria 4104
416 Ga0496122_0110900 3300048925 Bacteria 1801
417 Ga0496122_0408700 3300048925 Bacteria 686
418 Ga0496123_0118447 3300048926 Bacteria 1495
419 Ga0496123_0363983 3300048926 Bacteria 668
420 Ga0496124_0021280 3300048927 Bacteria 5979
421 Ga0496124_0028803 3300048927 Bacteria 4961
422 Ga0496124_0029090 3300048927 Bacteria 4929
423 Ga0496124_0030139 3300048927 Bacteria 4820
424 Ga0496125_0164534 3300048928 Bacteria 1501
425 Ga0501310_043633 3300049130 Bacteria 631
426 Ga0495678_000004 3300049459 Bacteria 532920
427 Ga0495678_029020 3300049459 Bacteria 2327
428 Ga0495678_121519 3300049459 Bacteria 876
429 Ga0501047_0323369 3300049581 Bacteria 1382
430 Ga0501224_022922 3300049664 Bacteria 932
431 Ga0501235_047561 3300049669 Bacteria 989
432 Ga0501249_014645 3300049679 Bacteria 1672
433 Ga0501234_107218 3300049707 Bacteria 512
434 Ga0501269_000036 3300049766 Bacteria 41517
435 Ga0501279_011679 3300049775 Bacteria 1190
436 Ga0501035_0269816 3300049822 Bacteria 1440
437 Ga0501044_0222077 3300049823 Bacteria 1840
438 Ga0501226_021430 3300049853 Bacteria 716
439 nmdc:mga03683_17796_c1 3300050489 Bacteria 2694
440 Ga0587088_181204 3300059508 Bacteria 528
441 Ga0466962_0091706 3300061719 Bacteria 1456
442 Ga0466962_0132195 3300061719 Bacteria 1206
443 2644254021 2643221645 Bacteria 7207331
444 2644356791 2643221664 Bacteria 7272945
445 2644473484 2643221684 Bacteria 7145183
446 2738742022 2738541280 Bacteria 6630198
447 2738844475 2738541300 Bacteria 6675882
448 2739277053 2738543018 Bacteria 6718814
449 2739346006 2738543030 Bacteria 6719714
450 2857554663 2857553236 Bacteria 6166726
451 2857563355 2857558681 Bacteria 6617694
452 2904426861 2904424332 Bacteria 7633521
453 8047679211 8047673197 Bacteria 7395230
454 Ga0501249_006731
455 JGI25158J39367_1005056
456 JGI25159J45721_1003893
457 rootL2_10143385
458 JGI25161J50226_1000542
459 Ga0055525_1000025
460 Ga0055542_1028482
461 Ga0055526_1000514
462 Ga0055526_1046184
463 Ga0055537_1000098
464 Ga0055524_1024990
465 Ga0055534_1000009
466 Ga0055528_1000012
467 Ga0055543_1000760
468 Ga0055543_1012413
469 Ga0065165_1000051
470 Ga0065165_1003498
471 Ga0065165_1009472
472 Ga0070658_10256422
473 Ga0070658_10524302
474 Ga0070658_11510117
475 Ga0070658_11588707
476 Ga0070658_11610997
477 Ga0070666_11185908
478 Ga0070660_100015265
479 Ga0070660_100379049
480 Ga0070659_100090707
481 Ga0070663_100813119
482 Ga0070663_101316059
483 Ga0070662_100214420
484 Ga0070662_100282156
485 Ga0070662_100294257
486 Ga0068867_100629880
487 Ga0068855_100035470
488 Ga0068855_100213646
489 Ga0070664_100234045
490 Ga0070664_102403498
491 Ga0068857_102457908
492 Ga0068856_100324739
493 Ga0068852_100333508
494 Ga0075362_10072624
495 Ga0079104_1004117
496 Ga0105244_10003601
497 Ga0105244_10297128
498 Ga0105240_10750196
499 Ga0105243_12114403
500 Ga0105241_10191084
501 Ga0105241_11056602
502 Ga0105242_10240484
503 Ga0105242_10705786
504 Ga0105242_11470153
505 Ga0105248_10479800
506 Ga0105237_10980750
507 Ga0105238_10338631
508 Ga0105239_10399044
509 Ga0105246_10353440
510 Ga0105246_12277374
511 Ga0157371_10000060
512 Ga0157369_10451306
513 Ga0157374_10681251
514 Ga0157374_11843263
515 Ga0157372_10672708
516 Ga0157372_10673428
517 Ga0157372_11421190
518 Ga0157372_12147124
519 Ga0157372_12657226
520 Ga0163163_12495755
521 Ga0182008_10182501
522 Ga0182006_1000054
523 Ga0182006_1049374
524 Ga0182006_1208317
525 Ga0182007_10107553
526 Ga0182007_10129612
527 Ga0182007_10287233
528 Ga0182005_1000012
529 Ga0209436_100099
530 Ga0209436_112786
531 Ga0209563_100003
532 Ga0209677_107770
533 Ga0209148_1001884
534 Ga0209565_1000015
535 Ga0209673_1000017
536 Ga0209130_1000063
537 Ga0209130_1001327
538 Ga0209675_1000012
539 Ga0209564_1000016
540 Ga0209564_1038206
541 Ga0209256_1000593
542 Ga0207426_1116192
543 Ga0207655_1030945
544 Ga0207705_10008590
545 Ga0207705_10734260
546 Ga0207654_10097376
547 Ga0207695_10742496
548 Ga0207671_10402673
549 Ga0207657_10021673
550 Ga0207657_10253278
551 Ga0207657_10284239
552 Ga0207649_10113539
553 Ga0207690_10043094
554 Ga0207706_10122474
555 Ga0207706_10316299
556 Ga0207706_10615991
557 Ga0207686_10071301
558 Ga0207679_10073281
559 Ga0207679_10369299
560 Ga0207667_10014971
561 Ga0207667_10383648
562 Ga0207640_11157111
563 Ga0207639_11861643
564 Ga0207678_10448212
565 Ga0207702_11043670
566 Ga0207674_11126314
567 Ga0207698_10443745
568 Ga0207698_11613753
569 Ga0316177_1065105
570 Ga0316178_1014113
571 Ga0316180_1061982
572 Ga0316181_1085165
573 Ga0316181_1092946
574 Ga0316182_1088262
575 Ga0316182_1220829
576 Ga0307408_100000115
577 Ga0307408_100030755
578 Ga0307408_101035150
579 Ga0307408_102055207
580 Ga0307406_11688384
581 Ga0307510_10473307
582 Ga0395899_0009972
583 Ga0395899_0015599
584 Ga0395899_0015964
585 Ga0395899_0042960
586 Ga0395899_0190693
587 Ga0395899_0198965
588 Ga0395899_0336280
589 Ga0395899_0398420
590 Ga0395899_0717455
591 Ga0395900_0001651
592 Ga0395900_0040293
593 Ga0395900_0066863
594 Ga0395900_0117209
595 Ga0395900_0136346
596 Ga0395900_0277058
597 Ga0395900_0375594
598 Ga0395900_0380035
599 Ga0395900_0715228
600 Ga0395900_1342690
601 Ga0395898_0003616
602 Ga0395898_0060986
603 Ga0395898_0111766
604 Ga0395898_0260894
605 Ga0395898_0492134
606 Ga0395905_0030787
607 Ga0395905_0101509
608 Ga0395905_0304194
609 Ga0395905_0408833
610 Ga0395905_0774210
611 Ga0395905_0788383
612 Ga0395905_1147361
613 Ga0395905_1658040
614 Ga0395905_1815338
615 Ga0395901_0000212
616 Ga0395901_0006637
617 Ga0395901_0074457
618 Ga0395901_0217719
619 Ga0395901_0296005
620 Ga0395901_0619258
621 Ga0395901_0676303
622 Ga0395901_0871002
623 Ga0395901_1009956
624 Ga0395901_1017081
625 Ga0439433_0143336
626 Ga0439448_0001989
627 Ga0439448_0002870
628 Ga0439448_0248527
629 Ga0439449_0240098
630 Ga0439450_014522
631 Ga0439450_030847
632 Ga0439455_0001953
633 Ga0439455_0018952
634 Ga0450911_038606
635 Ga0450923_135349
636 Ga0450904_000617
637 Ga0450906_014413
638 Ga0439458_0035450
639 Ga0439458_0046146
640 Ga0439458_0094442
641 Ga0439458_0101782
642 Ga0466969_0467808
643 Ga0466972_0097447
644 Ga0466972_0218221
645 Ga0466981_0279929
646 Ga0466965_0022307
647 Ga0466965_0031608
648 Ga0466965_0090731
649 Ga0466965_0128922
650 Ga0466966_0043982
651 Ga0466966_0063947
652 Ga0466966_0122513
653 Ga0466966_0146294
654 Ga0466966_0149658
655 Ga0466966_0176223
656 Ga0466966_0206452
657 Ga0466966_0815703
658 Ga0466961_0160459
659 Ga0466961_0161747
660 Ga0466961_0216935
661 Ga0466961_0565297
662 Ga0466964_0162126
663 Ga0466964_0230186
664 Ga0466964_0690050
665 Ga0466971_0123170
666 Ga0466971_0394712
667 Ga0466968_0132824
668 Ga0466970_0032352
669 Ga0466970_0333357
670 Ga0466957_0000121
671 Ga0466957_0529670
672 Ga0466957_1042795
673 Ga0466960_0381743
674 Ga0466960_0757908
675 Ga0466959_0049330
676 Ga0466959_0052265
677 Ga0466959_0203124
678 Ga0466958_0144378
679 Ga0466958_0435364
680 Ga0466958_0550757
681 Ga0466958_1029453
682 Ga0466967_0022225
683 Ga0466967_0052799
684 Ga0466967_1476267
685 Ga0495627_000007
686 Ga0495603_0015152
687 Ga0495590_0000005
688 Ga0495590_0000351
689 Ga0495590_0010773
690 Ga0495590_0018350
691 Ga0495638_0000027
692 Ga0495638_0039487
693 Ga0495638_0069291
694 Ga0495653_0029347
695 Ga0495653_0101394
696 Ga0495650_0005067
697 Ga0495580_0116060
698 Ga0495580_0373532
699 Ga0495605_0000130
700 Ga0495605_0035728
701 Ga0495639_0069061
702 Ga0495664_0440544
703 Ga0495584_0002296
704 Ga0495584_0023153
705 Ga0495584_0100451
706 Ga0495584_0127048
707 Ga0495584_0139500
708 Ga0495585_0127958
709 Ga0495594_0034155
710 Ga0495594_0194867
711 Ga0495596_0102206
712 Ga0495607_0000720
713 Ga0495607_0002353
714 Ga0495607_0003771
715 Ga0495607_0045162
716 Ga0495607_0048968
717 Ga0495607_0079564
718 Ga0495607_0137713
719 Ga0495583_0000100
720 Ga0495583_0086307
721 Ga0495606_0000907
722 Ga0495606_0013357
723 Ga0495606_0014188
724 Ga0495606_0018908
725 Ga0495606_0189323
726 Ga0495610_0035653
727 Ga0495610_0194909
728 Ga0495616_0020730
729 Ga0495616_0051467
730 Ga0495630_0204651
731 Ga0495631_0029496
732 Ga0495643_0017494
733 Ga0495643_0039859
734 Ga0495643_0116173
735 Ga0495643_0272232
736 Ga0495643_0329494
737 Ga0495643_0477760
738 Ga0495648_0000002
739 Ga0495648_0063987
740 Ga0495666_0002773
741 Ga0495666_0059723
742 Ga0495666_0227323
743 Ga0495642_0001650
744 Ga0495642_0001734
745 Ga0495642_0004425
746 Ga0495642_0060610
747 Ga0495642_0111773
748 Ga0495652_0057178
749 Ga0495654_0038592
750 Ga0495654_0260549
751 Ga0495665_0022066
752 Ga0495665_0540095
753 Ga0495586_0021945
754 Ga0495587_0071730
755 Ga0495587_0137111
756 Ga0495587_0168312
757 Ga0495587_0184448
758 Ga0495609_0000055
759 Ga0495609_0017845
760 Ga0495609_0028210
761 Ga0495609_0085173
762 Ga0495597_0005636
763 Ga0495597_0016852
764 Ga0495597_0019193
765 Ga0495597_0084364
766 Ga0495645_0185021
767 Ga0495622_0000128
768 Ga0495622_0000313
769 Ga0495622_0099555
770 Ga0495633_0000031
771 Ga0495633_0000050
772 Ga0495633_0033913
773 Ga0495668_0000101
774 Ga0495668_0019952
775 Ga0495668_0024796
776 Ga0495668_0033381
777 Ga0495634_0048924
778 Ga0495625_0000121
779 Ga0495625_0019207
780 Ga0495625_0020342
781 Ga0495625_0279633
782 Ga0495659_0000204
783 Ga0495659_0003883
784 Ga0495661_0016832
785 Ga0495661_0034138
786 Ga0495661_0039378
787 Ga0495661_0053510
788 Ga0495661_0070618
789 Ga0495661_0411478
790 Ga0495661_0488922
791 Ga0495588_0000041
792 Ga0495588_0371690
793 Ga0495588_0392610
794 Ga0495599_0647049
795 Ga0495623_0013663
796 Ga0495623_0041950
797 Ga0495646_0144343
798 Ga0495669_0002327
799 Ga0495613_0274683
800 Ga0495624_0038663
801 Ga0495670_0130447
802 Ga0495671_0000109
803 Ga0495649_0044576
804 Ga0495589_0000034
805 Ga0495589_0053074
806 Ga0495660_0000107
807 Ga0495660_0000860
808 Ga0495660_0001714
809 Ga0495660_0008054
810 Ga0495660_0032759
811 Ga0495660_0042127
812 Ga0495660_0102499
813 Ga0495581_0003117
814 Ga0495581_0077854
815 Ga0495581_0530015
816 Ga0495604_0025156
817 Ga0495636_0005832
818 Ga0495672_0000244
819 Ga0495672_0107072
820 Ga0495680_0107112
821 Ga0495683_0093148
822 Ga0495687_000023
823 Ga0495687_000535
824 Ga0495687_000550
825 Ga0495687_001509
826 Ga0495687_022915
827 Ga0495675_0033927
828 Ga0495675_0231960
829 Ga0495675_0442231
830 Ga0495677_0003378
831 Ga0495677_0009634
832 Ga0495677_0028108
833 Ga0495677_0101464
834 Ga0495685_017670
835 Ga0495685_061540
836 Ga0495681_0025025
837 Ga0495681_0042289
838 Ga0495681_0072981
839 Ga0495681_0165564
840 Ga0495686_0001420
841 Ga0495686_0041981
842 Ga0495602_0019960
843 Ga0495626_0000037
844 Ga0495626_0164901
845 Ga0496100_0244275
846 Ga0496100_0666647
847 Ga0496100_0876345
848 Ga0496102_0275122
849 Ga0496102_0357868
850 Ga0496102_0423092
851 Ga0496102_0989710
852 Ga0496103_0001094
853 Ga0496105_0090364
854 Ga0496106_0007749
855 Ga0496106_0224057
856 Ga0496107_0029537
857 Ga0496108_1606227
858 Ga0496110_0546455
859 Ga0496111_0456094
860 Ga0496111_1058166
861 Ga0496113_0240165
862 Ga0496113_0344536
863 Ga0496113_0722599
864 Ga0496113_0851956
865 Ga0496114_0040880
866 Ga0496115_1324130
867 Ga0496116_0026712
868 Ga0496122_0034913
869 Ga0496122_0110900
870 Ga0496122_0408700
871 Ga0496123_0118447
872 Ga0496123_0363983
873 Ga0496124_0021280
874 Ga0496124_0028803
875 Ga0496124_0029090
876 Ga0496124_0030139
877 Ga0496125_0164534
878 Ga0501310_043633
879 Ga0495678_000004
880 Ga0495678_029020
881 Ga0495678_121519
882 Ga0501047_0323369
883 Ga0501224_022922
884 Ga0501235_047561
885 Ga0501249_014645
886 Ga0501234_107218
887 Ga0501269_000036
888 Ga0501279_011679
889 Ga0501035_0269816
890 Ga0501044_0222077
891 Ga0501226_021430
892 nmdc:mga03683_17796_c1
893 Ga0587088_181204
894 Ga0466962_0091706
895 Ga0466962_0132195
896 2644254021
897 2644356791
898 2644473484
899 2738742022
900 2738844475
901 2739277053
902 2739346006
903 2857554663
904 2857563355
905 2904426861
906 8047679211

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map