F447271

General Info

Members Datasets Scaffolds Average Seq Length
453 210 906 280

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0390714|Ga0501038_0390714_36_860
Length 274
Sequence MWGTLERVLVRPPLAEDAEHWRDYGWRAAPDHPAAAAEHERLCGLLEAAGAEVVVSRHDPGNPDAIYVYDPVLVGSEGAILLRPGKEGRRGEPSAIAVSLEAAGVPIAGELADPVLAEGGDTVWLDEETLLVGIGYRTNPAAVVALGDALGVEVVAFDLPHWNGRGEVMHLMSFLSPLDRDLALVYPRLAPVRLLQLLAERGIAVVEVPDEEFETQGPNVLALGPRHALALDGNPETRRRMGRAGVDVVVYRGEEISRKGDGGPTCLTRPLLRS

Samples

Sample ID Description Type Environment
1 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
114 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
115 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
116 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
117 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
120 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
121 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
122 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
130 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
131 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
132 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
133 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
141 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
142 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 2.65
Rhizosphere 96.47
Stem 0
Stem Tuber 0
Unclassified 7.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501038_0390714 3300049574 Unclassified 1078
2 JGI25406J46586_10046810 3300003203 Bacteria 1478
3 Ga0070658_10028580 3300005327 Bacteria 4478
4 Ga0070658_10403254 3300005327 Bacteria 1175
5 Ga0070683_100015830 3300005329 Bacteria 6632
6 Ga0070683_100015891 3300005329 Bacteria 6622
7 Ga0070683_100030031 3300005329 Bacteria 4928
8 Ga0070683_100160448 3300005329 Bacteria 2133
9 Ga0070670_100139214 3300005331 Bacteria 2099
10 Ga0068869_100010513 3300005334 Bacteria 6038
11 Ga0070680_100023016 3300005336 Bacteria 4965
12 Ga0070680_100215134 3300005336 Bacteria 1622
13 Ga0070680_100617846 3300005336 Unclassified 930
14 Ga0070682_100008580 3300005337 Bacteria 5768
15 Ga0070682_100088753 3300005337 Bacteria 2018
16 Ga0070660_100089764 3300005339 Bacteria 2422
17 Ga0070689_100008401 3300005340 Bacteria 7272
18 Ga0070691_10003647 3300005341 Bacteria 6949
19 Ga0070661_100008439 3300005344 Bacteria 7122
20 Ga0070661_100015898 3300005344 Bacteria 5310
21 Ga0070692_10103812 3300005345 Bacteria 1562
22 Ga0070668_100275568 3300005347 Bacteria 1403
23 Ga0070675_100255717 3300005354 Unclassified 1534
24 Ga0070674_100001302 3300005356 Bacteria 13114
25 Ga0070674_100006132 3300005356 Bacteria 6988
26 Ga0070674_100115512 3300005356 Bacteria 1979
27 Ga0070673_100510116 3300005364 Unclassified 1089
28 Ga0070688_100015707 3300005365 Bacteria 4314
29 Ga0070659_100016104 3300005366 Bacteria 5610
30 Ga0070659_100095275 3300005366 Bacteria 2391
31 Ga0070700_100150649 3300005441 Bacteria 1590
32 Ga0070678_100074061 3300005456 Bacteria 2558
33 Ga0070678_100118635 3300005456 Bacteria 2083
34 Ga0070678_100214497 3300005456 Bacteria 1597
35 Ga0070678_100257288 3300005456 Bacteria 1466
36 Ga0070662_100048186 3300005457 Bacteria 3069
37 Ga0070662_100202492 3300005457 Unclassified 1576
38 Ga0070681_10013197 3300005458 Bacteria 8209
39 Ga0070681_10151565 3300005458 Bacteria 2245
40 Ga0070681_10181104 3300005458 Bacteria 2029
41 Ga0068867_100089144 3300005459 Bacteria 2339
42 Ga0070685_10005978 3300005466 Bacteria 6197
43 Ga0070679_100005464 3300005530 Bacteria 11782
44 Ga0070679_100093483 3300005530 Bacteria 2994
45 Ga0070684_100011603 3300005535 Bacteria 7022
46 Ga0070684_100030872 3300005535 Bacteria 4557
47 Ga0070684_100034227 3300005535 Bacteria 4343
48 Ga0070684_100041144 3300005535 Bacteria 3983
49 Ga0068853_100009467 3300005539 Bacteria 7849
50 Ga0070672_100003936 3300005543 Bacteria 9680
51 Ga0070672_100023768 3300005543 Bacteria 4521
52 Ga0070672_100112745 3300005543 Bacteria 2219
53 Ga0070686_100004761 3300005544 Bacteria 7486
54 Ga0070686_100251661 3300005544 Bacteria 1291
55 Ga0070696_100254789 3300005546 Bacteria 1329
56 Ga0070693_100019933 3300005547 Bacteria 3528
57 Ga0070693_100046798 3300005547 Bacteria 2458
58 Ga0070665_100603514 3300005548 Bacteria 1111
59 Ga0068855_100474408 3300005563 Bacteria 1362
60 Ga0070664_100014453 3300005564 Bacteria 6436
61 Ga0070664_100076027 3300005564 Bacteria 2885
62 Ga0070664_100485142 3300005564 Bacteria 1138
63 Ga0068857_100049130 3300005577 Bacteria 3744
64 Ga0068857_100488025 3300005577 Bacteria 1155
65 Ga0068854_100568896 3300005578 Bacteria 964
66 Ga0070702_100108068 3300005615 Unclassified 1719
67 Ga0070702_100166215 3300005615 Bacteria 1431
68 Ga0068852_100008666 3300005616 Bacteria 7515
69 Ga0068866_10053362 3300005718 Bacteria 2067
70 Ga0068861_100007248 3300005719 Bacteria 7600
71 Ga0068851_10025421 3300005834 Bacteria 2905
72 Ga0068870_10004976 3300005840 Bacteria 5764
73 Ga0068870_10240817 3300005840 Bacteria 1117
74 Ga0068863_100020555 3300005841 Bacteria 6311
75 Ga0081455_10021525 3300005937 Bacteria 6047
76 Ga0081455_10038320 3300005937 Bacteria 4245
77 Ga0081539_10002592 3300005985 Bacteria 24830
78 Ga0075365_10169110 3300006038 Bacteria 1525
79 Ga0075432_10038560 3300006058 Bacteria 1665
80 Ga0097621_100150286 3300006237 Bacteria 1997
81 Ga0075428_100058183 3300006844 Bacteria 4231
82 Ga0075428_100076973 3300006844 Bacteria 3642
83 Ga0075429_100569599 3300006880 Bacteria 992
84 Ga0068865_100011508 3300006881 Bacteria 5544
85 Ga0111539_10043769 3300009094 Bacteria 5367
86 Ga0111539_10045112 3300009094 Bacteria 5278
87 Ga0111539_10120881 3300009094 Bacteria 3069
88 Ga0105245_10018522 3300009098 Bacteria 6090
89 Ga0105245_10024416 3300009098 Bacteria 5308
90 Ga0105245_10027306 3300009098 Bacteria 5030
91 Ga0105245_10212902 3300009098 Bacteria 1861
92 Ga0105247_10054841 3300009101 Bacteria 2460
93 Ga0114129_10044321 3300009147 Bacteria 6258
94 Ga0114129_10185125 3300009147 Bacteria 2831
95 Ga0114129_10291031 3300009147 Bacteria 2180
96 Ga0105243_10007960 3300009148 Bacteria 8143
97 Ga0105243_10030907 3300009148 Bacteria 4127
98 Ga0105243_10117909 3300009148 Unclassified 2233
99 Ga0105241_10561972 3300009174 Bacteria 1026
100 Ga0105242_10081304 3300009176 Bacteria 2709
101 Ga0105242_10295332 3300009176 Bacteria 1477
102 Ga0105242_10391268 3300009176 Unclassified 1295
103 Ga0105248_10168341 3300009177 Bacteria 2470
104 Ga0105248_10255802 3300009177 Bacteria 1971
105 Ga0105238_10036924 3300009551 Bacteria 4968
106 Ga0105249_10009847 3300009553 Bacteria 8377
107 Ga0105249_10248202 3300009553 Bacteria 1763
108 Ga0105239_10057366 3300010375 Bacteria 4271
109 Ga0105239_10209040 3300010375 Bacteria 2187
110 Ga0105239_10276631 3300010375 Bacteria 1889
111 Ga0157342_1006529 3300012507 Bacteria 1107
112 Ga0157371_10007020 3300013102 Bacteria 9163
113 Ga0157369_10033154 3300013105 Bacteria 5677
114 Ga0157374_10105371 3300013296 Bacteria 2708
115 Ga0157374_10156342 3300013296 Bacteria 2219
116 Ga0157378_10101345 3300013297 Bacteria 2630
117 Ga0157372_10026859 3300013307 Bacteria 6267
118 Ga0157372_10039029 3300013307 Bacteria 5241
119 Ga0157372_10114393 3300013307 Bacteria 3093
120 Ga0157372_10466845 3300013307 Unclassified 1471
121 Ga0157375_10029202 3300013308 Bacteria 5183
122 Ga0157375_10525353 3300013308 Unclassified 1346
123 Ga0157380_10024897 3300014326 Bacteria 4534
124 Ga0157377_10005225 3300014745 Bacteria 6080
125 Ga0157377_10006038 3300014745 Bacteria 5745
126 Ga0157379_10325019 3300014968 Bacteria 1405
127 Ga0163161_10276450 3300017792 Bacteria 1316
128 Ga0163161_10446218 3300017792 Bacteria 1045
129 Ga0207688_10000822 3300025901 Bacteria 15528
130 Ga0207688_10031096 3300025901 Bacteria 2946
131 Ga0207643_10005291 3300025908 Bacteria 6906
132 Ga0207643_10221688 3300025908 Bacteria 1158
133 Ga0207707_10024128 3300025912 Bacteria 5320
134 Ga0207671_10326348 3300025914 Bacteria 1215
135 Ga0207660_10005528 3300025917 Bacteria 8208
136 Ga0207660_10160413 3300025917 Bacteria 1734
137 Ga0207662_10010917 3300025918 Bacteria 5023
138 Ga0207657_10001651 3300025919 Bacteria 24065
139 Ga0207657_10124977 3300025919 Bacteria 2113
140 Ga0207652_10084032 3300025921 Bacteria 2788
141 Ga0207681_10116714 3300025923 Bacteria 1951
142 Ga0207694_10030877 3300025924 Bacteria 4091
143 Ga0207650_10045392 3300025925 Bacteria 3232
144 Ga0207650_10262176 3300025925 Bacteria 1402
145 Ga0207659_10158582 3300025926 Bacteria 1774
146 Ga0207659_10224913 3300025926 Unclassified 1511
147 Ga0207659_10239378 3300025926 Unclassified 1467
148 Ga0207687_10031906 3300025927 Bacteria 3564
149 Ga0207687_10144608 3300025927 Bacteria 1808
150 Ga0207687_10218372 3300025927 Bacteria 1499
151 Ga0207644_10084816 3300025931 Bacteria 2349
152 Ga0207690_10037336 3300025932 Bacteria 3154
153 Ga0207706_10002051 3300025933 Bacteria 19764
154 Ga0207706_10041735 3300025933 Bacteria 4066
155 Ga0207706_10119823 3300025933 Unclassified 2314
156 Ga0207709_10045915 3300025935 Bacteria 2648
157 Ga0207709_10158725 3300025935 Bacteria 1575
158 Ga0207669_10021431 3300025937 Bacteria 3412
159 Ga0207704_10160374 3300025938 Bacteria 1599
160 Ga0207704_10176434 3300025938 Unclassified 1539
161 Ga0207704_10328057 3300025938 Bacteria 1183
162 Ga0207691_10006749 3300025940 Bacteria 11072
163 Ga0207691_10046975 3300025940 Bacteria 3965
164 Ga0207691_10386280 3300025940 Unclassified 1195
165 Ga0207711_10212288 3300025941 Bacteria 1768
166 Ga0207689_10103814 3300025942 Bacteria 2335
167 Ga0207661_10000195 3300025944 Bacteria 39367
168 Ga0207661_10131217 3300025944 Bacteria 2146
169 Ga0207661_10154552 3300025944 Bacteria 1986
170 Ga0207679_10038699 3300025945 Bacteria 3400
171 Ga0207679_10062314 3300025945 Bacteria 2779
172 Ga0207667_10108200 3300025949 Bacteria 2868
173 Ga0207712_10296958 3300025961 Bacteria 1324
174 Ga0207668_10052559 3300025972 Bacteria 2819
175 Ga0207677_10356935 3300026023 Bacteria 1226
176 Ga0207678_10039615 3300026067 Bacteria 4089
177 Ga0207708_10025727 3300026075 Bacteria 4453
178 Ga0207708_10121781 3300026075 Unclassified 2033
179 Ga0207708_10128692 3300026075 Bacteria 1978
180 Ga0207702_10217630 3300026078 Bacteria 1779
181 Ga0207648_10018761 3300026089 Bacteria 6255
182 Ga0207648_10102103 3300026089 Bacteria 2513
183 Ga0207648_10127162 3300026089 Bacteria 2242
184 Ga0207648_10667479 3300026089 Bacteria 962
185 Ga0207674_10008631 3300026116 Bacteria 11742
186 Ga0207674_10074098 3300026116 Bacteria 3417
187 Ga0207674_10243495 3300026116 Bacteria 1745
188 Ga0207675_100006629 3300026118 Bacteria 10950
189 Ga0207675_100176612 3300026118 Bacteria 2043
190 Ga0207683_10011476 3300026121 Bacteria 7561
191 Ga0207683_10032676 3300026121 Bacteria 4520
192 Ga0207683_10081551 3300026121 Bacteria 2871
193 Ga0207683_10389582 3300026121 Bacteria 1281
194 Ga0207698_10014637 3300026142 Bacteria 5222
195 Ga0207698_10041458 3300026142 Bacteria 3430
196 Ga0207428_10000347 3300027907 Bacteria 60088
197 Ga0207428_10002821 3300027907 Bacteria 17256
198 Ga0207428_10052600 3300027907 Bacteria 3251
199 Ga0207428_10342854 3300027907 Bacteria 1100
200 Ga0268265_10220026 3300028380 Bacteria 1661
201 Ga0265319_1010975 3300028563 Bacteria 3746
202 Ga0265334_10002325 3300028573 Bacteria 8948
203 Ga0265318_10001303 3300028577 Bacteria 15009
204 Ga0265323_10039186 3300028653 Bacteria 1729
205 Ga0265322_10039529 3300028654 Bacteria 1342
206 Ga0265338_10012864 3300028800 Bacteria 9509
207 Ga0265338_10066069 3300028800 Bacteria 3132
208 Ga0265330_10013887 3300031235 Bacteria 3744
209 Ga0265332_10006973 3300031238 Bacteria 5118
210 Ga0265328_10000553 3300031239 Bacteria 17405
211 Ga0265340_10003712 3300031247 Bacteria 8594
212 Ga0265339_10017818 3300031249 Bacteria 4198
213 Ga0265331_10001988 3300031250 Bacteria 14279
214 Ga0265327_10026605 3300031251 Bacteria 3346
215 Ga0265327_10035433 3300031251 Bacteria 2758
216 Ga0265313_10020434 3300031595 Bacteria 3653
217 Ga0265342_10044687 3300031712 Bacteria 2669
218 Ga0307409_100035675 3300031995 Bacteria 3647
219 Ga0307409_100131444 3300031995 Bacteria 2140
220 Ga0373938_0023856 3300034957 Bacteria 1261
221 Ga0373952_0030983 3300035092 Unclassified 1187
222 Ga0373932_0019023 3300035112 Unclassified 1785
223 Ga0373941_0054849 3300035115 Bacteria 1279
224 Ga0373957_0053591 3300035120 Bacteria 1548
225 Ga0373937_0247176 3300036401 Bacteria 1681
226 Ga0373925_0232145 3300037068 Bacteria 1476
227 Ga0395900_0158933 3300037418 Bacteria 2306
228 Ga0395900_0325116 3300037418 Bacteria 1517
229 Ga0395900_0410737 3300037418 Bacteria 1316
230 Ga0395905_0040081 3300037471 Bacteria 4394
231 Ga0395905_0052242 3300037471 Bacteria 3826
232 Ga0395901_0236883 3300038443 Bacteria 1904
233 Ga0451853_2784022 3300041512 Bacteria 1728
234 Ga0439448_0035083 3300042005 Bacteria 1605
235 Ga0450920_002221 3300042122 Bacteria 3288
236 Ga0450920_003301 3300042122 Bacteria 2786
237 Ga0450920_007176 3300042122 Bacteria 2015
238 Ga0450906_023622 3300042145 Bacteria 1094
239 Ga0495592_0186116 3300046454 Bacteria 1411
240 Ga0495651_0053042 3300046462 Bacteria 3123
241 Ga0495653_0059086 3300046463 Bacteria 2912
242 Ga0495582_0084410 3300046473 Bacteria 1765
243 Ga0495584_0194915 3300046491 Bacteria 1030
244 Ga0495630_0208243 3300046517 Bacteria 1493
245 Ga0495609_0141722 3300046538 Bacteria 1026
246 Ga0495635_0067400 3300046663 Bacteria 2455
247 Ga0495635_0162148 3300046663 Bacteria 1522
248 Ga0495657_0099818 3300046675 Bacteria 1851
249 Ga0495657_0156846 3300046675 Bacteria 1410
250 Ga0495646_0143258 3300046680 Bacteria 1335
251 Ga0495658_0045754 3300046683 Bacteria 2457
252 Ga0495589_0029839 3300046794 Bacteria 2749
253 Ga0495581_0000299 3300047315 Bacteria 24150
254 Ga0495604_0187836 3300047317 Bacteria 1442
255 Ga0495674_0110974 3300047319 Bacteria 2325
256 Ga0495676_0059673 3300047321 Bacteria 2994
257 Ga0495680_0072136 3300047322 Bacteria 2627
258 Ga0495680_0105886 3300047322 Bacteria 2091
259 Ga0495684_0003859 3300047471 Bacteria 11679
260 Ga0496102_0294083 3300048905 Unclassified 1531
261 Ga0496104_0038427 3300048907 Bacteria 4479
262 Ga0496106_0025492 3300048909 Bacteria 4401
263 Ga0496107_0042719 3300048910 Bacteria 3256
264 Ga0496108_0020817 3300048911 Bacteria 5393
265 Ga0496109_0016884 3300048912 Bacteria 6387
266 Ga0496109_0496326 3300048912 Unclassified 1152
267 Ga0496109_0602417 3300048912 Bacteria 1035
268 Ga0496110_0005043 3300048913 Bacteria 10320
269 Ga0496110_0026862 3300048913 Bacteria 4929
270 Ga0496110_0343380 3300048913 Bacteria 1360
271 Ga0496111_0010119 3300048914 Bacteria 6313
272 Ga0501031_0001126 3300049568 Bacteria 16256
273 Ga0501031_0001439 3300049568 Bacteria 14764
274 Ga0501031_0001727 3300049568 Bacteria 13710
275 Ga0501031_0058062 3300049568 Bacteria 2521
276 Ga0501031_0149002 3300049568 Bacteria 1529
277 Ga0501032_0113557 3300049569 Bacteria 1792
278 Ga0501033_0007144 3300049570 Bacteria 8714
279 Ga0501033_0191225 3300049570 Bacteria 1465
280 Ga0501034_0157620 3300049571 Bacteria 2243
281 Ga0501034_0166371 3300049571 Bacteria 2174
282 Ga0501036_0006429 3300049572 Bacteria 9541
283 Ga0501036_0013551 3300049572 Bacteria 6779
284 Ga0501036_0061215 3300049572 Bacteria 3188
285 Ga0501036_0065439 3300049572 Bacteria 3077
286 Ga0501036_0190549 3300049572 Bacteria 1725
287 Ga0501036_0549674 3300049572 Bacteria 959
288 Ga0501037_0024816 3300049573 Bacteria 4432
289 Ga0501037_0048045 3300049573 Bacteria 3128
290 Ga0501037_0051824 3300049573 Bacteria 3001
291 Ga0501038_0005294 3300049574 Bacteria 11995
292 Ga0501038_0017471 3300049574 Bacteria 6484
293 Ga0501038_0069629 3300049574 Bacteria 2988
294 Ga0501038_0087358 3300049574 Bacteria 2618
295 Ga0501038_0167180 3300049574 Bacteria 1783
296 Ga0501038_0208385 3300049574 Unclassified 1565
297 Ga0501039_0010245 3300049575 Bacteria 7144
298 Ga0501039_0010802 3300049575 Bacteria 6955
299 Ga0501039_0336790 3300049575 Unclassified 1186
300 Ga0501039_0374003 3300049575 Unclassified 1119
301 Ga0501039_0382572 3300049575 Bacteria 1105
302 Ga0501040_0001032 3300049576 Bacteria 17675
303 Ga0501040_0007691 3300049576 Bacteria 6974
304 Ga0501040_0008892 3300049576 Bacteria 6530
305 Ga0501040_0022680 3300049576 Bacteria 4205
306 Ga0501040_0023738 3300049576 Bacteria 4112
307 Ga0501040_0033211 3300049576 Bacteria 3494
308 Ga0501040_0253406 3300049576 Unclassified 1256
309 Ga0501041_0001126 3300049577 Bacteria 14642
310 Ga0501041_0010551 3300049577 Bacteria 5446
311 Ga0501041_0021858 3300049577 Bacteria 3832
312 Ga0501041_0022670 3300049577 Bacteria 3760
313 Ga0501041_0033496 3300049577 Bacteria 3108
314 Ga0501041_0063585 3300049577 Bacteria 2259
315 Ga0501041_0067773 3300049577 Bacteria 2187
316 Ga0501042_0001595 3300049578 Bacteria 13472
317 Ga0501042_0010768 3300049578 Bacteria 6148
318 Ga0501042_0042560 3300049578 Bacteria 3233
319 Ga0501042_0065652 3300049578 Bacteria 2593
320 Ga0501042_0100556 3300049578 Bacteria 2079
321 Ga0501042_0364920 3300049578 Bacteria 1045
322 Ga0501043_0009107 3300049579 Bacteria 7809
323 Ga0501043_0031201 3300049579 Bacteria 4190
324 Ga0501043_0047939 3300049579 Bacteria 3359
325 Ga0501043_0086843 3300049579 Bacteria 2458
326 Ga0501046_0003756 3300049580 Bacteria 13906
327 Ga0501046_0025431 3300049580 Bacteria 4845
328 Ga0501046_0034368 3300049580 Bacteria 4091
329 Ga0501046_0041123 3300049580 Bacteria 3690
330 Ga0501046_0073201 3300049580 Archaea 2659
331 Ga0501048_0001465 3300049582 Bacteria 17896
332 Ga0501048_0002453 3300049582 Bacteria 14144
333 Ga0501048_0006964 3300049582 Bacteria 8589
334 Ga0501048_0007213 3300049582 Bacteria 8438
335 Ga0501048_0193587 3300049582 Unclassified 1441
336 Ga0501048_0195996 3300049582 Bacteria 1432
337 Ga0501067_0009509 3300049583 Bacteria 5383
338 Ga0501067_0134745 3300049583 Unclassified 1375
339 Ga0501067_0167709 3300049583 Bacteria 1223
340 Ga0501068_0007499 3300049584 Bacteria 6037
341 Ga0501068_0010823 3300049584 Bacteria 5133
342 Ga0501068_0033199 3300049584 Bacteria 3073
343 Ga0501068_0036785 3300049584 Bacteria 2929
344 Ga0501068_0043562 3300049584 Bacteria 2700
345 Ga0501068_0057027 3300049584 Bacteria 2368
346 Ga0501069_0051075 3300049585 Bacteria 2300
347 Ga0501069_0251250 3300049585 Bacteria 1031
348 Ga0501070_0008666 3300049586 Bacteria 8597
349 Ga0501070_0015036 3300049586 Bacteria 6513
350 Ga0501071_0000342 3300049587 Bacteria 22658
351 Ga0501071_0000475 3300049587 Bacteria 20283
352 Ga0501071_0000997 3300049587 Bacteria 15530
353 Ga0501071_0067591 3300049587 Bacteria 2599
354 Ga0501071_0180678 3300049587 Bacteria 1581
355 Ga0501071_0227096 3300049587 Unclassified 1406
356 Ga0501071_0277734 3300049587 Bacteria 1267
357 Ga0501072_0002010 3300049588 Bacteria 15152
358 Ga0501072_0002272 3300049588 Bacteria 14360
359 Ga0501072_0003294 3300049588 Bacteria 12148
360 Ga0501072_0003887 3300049588 Bacteria 11297
361 Ga0501072_0027186 3300049588 Bacteria 4464
362 Ga0501072_0120346 3300049588 Bacteria 2091
363 Ga0501072_0320954 3300049588 Unclassified 1231
364 Ga0501073_0045226 3300049589 Bacteria 3101
365 Ga0501073_0086928 3300049589 Bacteria 2175
366 Ga0501074_0004933 3300049590 Bacteria 9560
367 Ga0501074_0151205 3300049590 Unclassified 1659
368 Ga0501075_0000158 3300049591 Bacteria 34420
369 Ga0501075_0001677 3300049591 Bacteria 14528
370 Ga0501075_0017454 3300049591 Bacteria 5185
371 Ga0501075_0107608 3300049591 Bacteria 2119
372 Ga0501076_0001942 3300049592 Bacteria 14116
373 Ga0501076_0004726 3300049592 Bacteria 9717
374 Ga0501076_0008934 3300049592 Bacteria 7374
375 Ga0501076_0063406 3300049592 Bacteria 2944
376 Ga0501077_0004460 3300049593 Bacteria 8503
377 Ga0501077_0005033 3300049593 Bacteria 8013
378 Ga0501077_0007166 3300049593 Bacteria 6877
379 Ga0501077_0034384 3300049593 Bacteria 3226
380 Ga0501077_0034601 3300049593 Bacteria 3215
381 Ga0501077_0049940 3300049593 Bacteria 2658
382 Ga0501077_0115877 3300049593 Unclassified 1698
383 Ga0501077_0385127 3300049593 Bacteria 896
384 Ga0501079_0001658 3300049741 Bacteria 15848
385 Ga0501079_0011954 3300049741 Bacteria 6626
386 Ga0501079_0038112 3300049741 Bacteria 3707
387 Ga0501079_0075187 3300049741 Bacteria 2612
388 Ga0501079_0097710 3300049741 Bacteria 2276
389 Ga0501079_0189124 3300049741 Bacteria 1606
390 Ga0501080_0004685 3300049742 Bacteria 12198
391 Ga0501080_0007312 3300049742 Bacteria 9963
392 Ga0501080_0242669 3300049742 Bacteria 1644
393 Ga0501080_0611176 3300049742 Bacteria 967
394 Ga0501081_0002286 3300049743 Bacteria 12062
395 Ga0501081_0009112 3300049743 Bacteria 6457
396 Ga0501081_0072488 3300049743 Bacteria 2402
397 Ga0501081_0131192 3300049743 Archaea 1790
398 Ga0501081_0136614 3300049743 Bacteria 1755
399 Ga0501081_0238853 3300049743 Bacteria 1325
400 Ga0501081_0312328 3300049743 Unclassified 1154
401 Ga0501083_0017527 3300049744 Bacteria 4993
402 Ga0501083_0031724 3300049744 Bacteria 3626
403 Ga0501083_0082376 3300049744 Bacteria 2132
404 Ga0501035_0021200 3300049822 Bacteria 5973
405 Ga0501035_0093667 3300049822 Bacteria 2643
406 Ga0501035_0164323 3300049822 Bacteria 1920
407 Ga0501035_0430088 3300049822 Unclassified 1095
408 Ga0501044_0248219 3300049823 Bacteria 1722
409 Ga0501045_0005580 3300049824 Bacteria 8705
410 Ga0501045_0006880 3300049824 Bacteria 7882
411 Ga0501045_0013043 3300049824 Bacteria 5859
412 Ga0501045_0054057 3300049824 Bacteria 2935
413 Ga0501045_0101923 3300049824 Bacteria 2125
414 Ga0501045_0102148 3300049824 Bacteria 2123
415 nmdc:mga0yw44_157419_c1 3300050492 Bacteria 1485
416 nmdc:mga0yw44_252695_c1 3300050492 Bacteria 1173
417 nmdc:mga05p37_243363_c1 3300050507 Bacteria 2161
418 nmdc:mga05p37_325393_c1 3300050507 Bacteria 1818
419 nmdc:mga05p37_413052_c1 3300050507 Bacteria 1573
420 nmdc:mga09592_34319_c1 3300050508 Bacteria 4241
421 nmdc:mga0qj67_6754_c1 3300050509 Bacteria 8434
422 nmdc:mga06r32_4545_c1 3300050510 Bacteria 12431
423 nmdc:mga08y16_111758_c1 3300050511 Bacteria 2844
424 nmdc:mga08y16_220732_c1 3300050511 Unclassified 1963
425 nmdc:mga08y16_43344_c1 3300050511 Bacteria 4716
426 nmdc:mga08y16_58646_c1 3300050511 Bacteria 4022
427 nmdc:mga08y16_77133_c1 3300050511 Bacteria 3474
428 nmdc:mga08x19_160164_c1 3300050514 Bacteria 1528
429 nmdc:mga0a205_225303_c1 3300050515 Bacteria 1759
430 Ga0501084_0001219 3300054114 Bacteria 20223
431 Ga0501084_0003680 3300054114 Bacteria 12444
432 Ga0501084_0004188 3300054114 Bacteria 11764
433 Ga0501084_0021635 3300054114 Bacteria 5362
434 Ga0501084_0100667 3300054114 Bacteria 2426
435 Ga0501084_0103555 3300054114 Bacteria 2390
436 Ga0501084_0138810 3300054114 Bacteria 2046
437 Ga0501084_0160025 3300054114 Bacteria 1899
438 Ga0501084_0296838 3300054114 Bacteria 1365
439 Ga0501082_0002045 3300060353 Bacteria 17742
440 Ga0501082_0008432 3300060353 Bacteria 8890
441 Ga0501082_0014872 3300060353 Bacteria 6703
442 Ga0501082_0044683 3300060353 Bacteria 3821
443 Ga0501082_0079384 3300060353 Bacteria 2831
444 Ga0501082_0083710 3300060353 Bacteria 2752
445 Ga0501082_0601147 3300060353 Bacteria 962
446 Ga0530510_0011607 3300061734 Bacteria 6183
447 Ga0530510_0013682 3300061734 Bacteria 5711
448 Ga0530510_0019184 3300061734 Bacteria 4852
449 Ga0530510_0102880 3300061734 Bacteria 2089
450 Ga0530510_0196010 3300061734 Bacteria 1500
451 Ga0530510_0216508 3300061734 Bacteria 1423
452 Ga0530510_0250470 3300061734 Bacteria 1320
453 Ga0530510_0311786 3300061734 Unclassified 1178
454 Ga0501038_0390714
455 JGI25406J46586_10046810
456 Ga0070658_10028580
457 Ga0070658_10403254
458 Ga0070683_100015830
459 Ga0070683_100015891
460 Ga0070683_100030031
461 Ga0070683_100160448
462 Ga0070670_100139214
463 Ga0068869_100010513
464 Ga0070680_100023016
465 Ga0070680_100215134
466 Ga0070680_100617846
467 Ga0070682_100008580
468 Ga0070682_100088753
469 Ga0070660_100089764
470 Ga0070689_100008401
471 Ga0070691_10003647
472 Ga0070661_100008439
473 Ga0070661_100015898
474 Ga0070692_10103812
475 Ga0070668_100275568
476 Ga0070675_100255717
477 Ga0070674_100001302
478 Ga0070674_100006132
479 Ga0070674_100115512
480 Ga0070673_100510116
481 Ga0070688_100015707
482 Ga0070659_100016104
483 Ga0070659_100095275
484 Ga0070700_100150649
485 Ga0070678_100074061
486 Ga0070678_100118635
487 Ga0070678_100214497
488 Ga0070678_100257288
489 Ga0070662_100048186
490 Ga0070662_100202492
491 Ga0070681_10013197
492 Ga0070681_10151565
493 Ga0070681_10181104
494 Ga0068867_100089144
495 Ga0070685_10005978
496 Ga0070679_100005464
497 Ga0070679_100093483
498 Ga0070684_100011603
499 Ga0070684_100030872
500 Ga0070684_100034227
501 Ga0070684_100041144
502 Ga0068853_100009467
503 Ga0070672_100003936
504 Ga0070672_100023768
505 Ga0070672_100112745
506 Ga0070686_100004761
507 Ga0070686_100251661
508 Ga0070696_100254789
509 Ga0070693_100019933
510 Ga0070693_100046798
511 Ga0070665_100603514
512 Ga0068855_100474408
513 Ga0070664_100014453
514 Ga0070664_100076027
515 Ga0070664_100485142
516 Ga0068857_100049130
517 Ga0068857_100488025
518 Ga0068854_100568896
519 Ga0070702_100108068
520 Ga0070702_100166215
521 Ga0068852_100008666
522 Ga0068866_10053362
523 Ga0068861_100007248
524 Ga0068851_10025421
525 Ga0068870_10004976
526 Ga0068870_10240817
527 Ga0068863_100020555
528 Ga0081455_10021525
529 Ga0081455_10038320
530 Ga0081539_10002592
531 Ga0075365_10169110
532 Ga0075432_10038560
533 Ga0097621_100150286
534 Ga0075428_100058183
535 Ga0075428_100076973
536 Ga0075429_100569599
537 Ga0068865_100011508
538 Ga0111539_10043769
539 Ga0111539_10045112
540 Ga0111539_10120881
541 Ga0105245_10018522
542 Ga0105245_10024416
543 Ga0105245_10027306
544 Ga0105245_10212902
545 Ga0105247_10054841
546 Ga0114129_10044321
547 Ga0114129_10185125
548 Ga0114129_10291031
549 Ga0105243_10007960
550 Ga0105243_10030907
551 Ga0105243_10117909
552 Ga0105241_10561972
553 Ga0105242_10081304
554 Ga0105242_10295332
555 Ga0105242_10391268
556 Ga0105248_10168341
557 Ga0105248_10255802
558 Ga0105238_10036924
559 Ga0105249_10009847
560 Ga0105249_10248202
561 Ga0105239_10057366
562 Ga0105239_10209040
563 Ga0105239_10276631
564 Ga0157342_1006529
565 Ga0157371_10007020
566 Ga0157369_10033154
567 Ga0157374_10105371
568 Ga0157374_10156342
569 Ga0157378_10101345
570 Ga0157372_10026859
571 Ga0157372_10039029
572 Ga0157372_10114393
573 Ga0157372_10466845
574 Ga0157375_10029202
575 Ga0157375_10525353
576 Ga0157380_10024897
577 Ga0157377_10005225
578 Ga0157377_10006038
579 Ga0157379_10325019
580 Ga0163161_10276450
581 Ga0163161_10446218
582 Ga0207688_10000822
583 Ga0207688_10031096
584 Ga0207643_10005291
585 Ga0207643_10221688
586 Ga0207707_10024128
587 Ga0207671_10326348
588 Ga0207660_10005528
589 Ga0207660_10160413
590 Ga0207662_10010917
591 Ga0207657_10001651
592 Ga0207657_10124977
593 Ga0207652_10084032
594 Ga0207681_10116714
595 Ga0207694_10030877
596 Ga0207650_10045392
597 Ga0207650_10262176
598 Ga0207659_10158582
599 Ga0207659_10224913
600 Ga0207659_10239378
601 Ga0207687_10031906
602 Ga0207687_10144608
603 Ga0207687_10218372
604 Ga0207644_10084816
605 Ga0207690_10037336
606 Ga0207706_10002051
607 Ga0207706_10041735
608 Ga0207706_10119823
609 Ga0207709_10045915
610 Ga0207709_10158725
611 Ga0207669_10021431
612 Ga0207704_10160374
613 Ga0207704_10176434
614 Ga0207704_10328057
615 Ga0207691_10006749
616 Ga0207691_10046975
617 Ga0207691_10386280
618 Ga0207711_10212288
619 Ga0207689_10103814
620 Ga0207661_10000195
621 Ga0207661_10131217
622 Ga0207661_10154552
623 Ga0207679_10038699
624 Ga0207679_10062314
625 Ga0207667_10108200
626 Ga0207712_10296958
627 Ga0207668_10052559
628 Ga0207677_10356935
629 Ga0207678_10039615
630 Ga0207708_10025727
631 Ga0207708_10121781
632 Ga0207708_10128692
633 Ga0207702_10217630
634 Ga0207648_10018761
635 Ga0207648_10102103
636 Ga0207648_10127162
637 Ga0207648_10667479
638 Ga0207674_10008631
639 Ga0207674_10074098
640 Ga0207674_10243495
641 Ga0207675_100006629
642 Ga0207675_100176612
643 Ga0207683_10011476
644 Ga0207683_10032676
645 Ga0207683_10081551
646 Ga0207683_10389582
647 Ga0207698_10014637
648 Ga0207698_10041458
649 Ga0207428_10000347
650 Ga0207428_10002821
651 Ga0207428_10052600
652 Ga0207428_10342854
653 Ga0268265_10220026
654 Ga0265319_1010975
655 Ga0265334_10002325
656 Ga0265318_10001303
657 Ga0265323_10039186
658 Ga0265322_10039529
659 Ga0265338_10012864
660 Ga0265338_10066069
661 Ga0265330_10013887
662 Ga0265332_10006973
663 Ga0265328_10000553
664 Ga0265340_10003712
665 Ga0265339_10017818
666 Ga0265331_10001988
667 Ga0265327_10026605
668 Ga0265327_10035433
669 Ga0265313_10020434
670 Ga0265342_10044687
671 Ga0307409_100035675
672 Ga0307409_100131444
673 Ga0373938_0023856
674 Ga0373952_0030983
675 Ga0373932_0019023
676 Ga0373941_0054849
677 Ga0373957_0053591
678 Ga0373937_0247176
679 Ga0373925_0232145
680 Ga0395900_0158933
681 Ga0395900_0325116
682 Ga0395900_0410737
683 Ga0395905_0040081
684 Ga0395905_0052242
685 Ga0395901_0236883
686 Ga0451853_2784022
687 Ga0439448_0035083
688 Ga0450920_002221
689 Ga0450920_003301
690 Ga0450920_007176
691 Ga0450906_023622
692 Ga0495592_0186116
693 Ga0495651_0053042
694 Ga0495653_0059086
695 Ga0495582_0084410
696 Ga0495584_0194915
697 Ga0495630_0208243
698 Ga0495609_0141722
699 Ga0495635_0067400
700 Ga0495635_0162148
701 Ga0495657_0099818
702 Ga0495657_0156846
703 Ga0495646_0143258
704 Ga0495658_0045754
705 Ga0495589_0029839
706 Ga0495581_0000299
707 Ga0495604_0187836
708 Ga0495674_0110974
709 Ga0495676_0059673
710 Ga0495680_0072136
711 Ga0495680_0105886
712 Ga0495684_0003859
713 Ga0496102_0294083
714 Ga0496104_0038427
715 Ga0496106_0025492
716 Ga0496107_0042719
717 Ga0496108_0020817
718 Ga0496109_0016884
719 Ga0496109_0496326
720 Ga0496109_0602417
721 Ga0496110_0005043
722 Ga0496110_0026862
723 Ga0496110_0343380
724 Ga0496111_0010119
725 Ga0501031_0001126
726 Ga0501031_0001439
727 Ga0501031_0001727
728 Ga0501031_0058062
729 Ga0501031_0149002
730 Ga0501032_0113557
731 Ga0501033_0007144
732 Ga0501033_0191225
733 Ga0501034_0157620
734 Ga0501034_0166371
735 Ga0501036_0006429
736 Ga0501036_0013551
737 Ga0501036_0061215
738 Ga0501036_0065439
739 Ga0501036_0190549
740 Ga0501036_0549674
741 Ga0501037_0024816
742 Ga0501037_0048045
743 Ga0501037_0051824
744 Ga0501038_0005294
745 Ga0501038_0017471
746 Ga0501038_0069629
747 Ga0501038_0087358
748 Ga0501038_0167180
749 Ga0501038_0208385
750 Ga0501039_0010245
751 Ga0501039_0010802
752 Ga0501039_0336790
753 Ga0501039_0374003
754 Ga0501039_0382572
755 Ga0501040_0001032
756 Ga0501040_0007691
757 Ga0501040_0008892
758 Ga0501040_0022680
759 Ga0501040_0023738
760 Ga0501040_0033211
761 Ga0501040_0253406
762 Ga0501041_0001126
763 Ga0501041_0010551
764 Ga0501041_0021858
765 Ga0501041_0022670
766 Ga0501041_0033496
767 Ga0501041_0063585
768 Ga0501041_0067773
769 Ga0501042_0001595
770 Ga0501042_0010768
771 Ga0501042_0042560
772 Ga0501042_0065652
773 Ga0501042_0100556
774 Ga0501042_0364920
775 Ga0501043_0009107
776 Ga0501043_0031201
777 Ga0501043_0047939
778 Ga0501043_0086843
779 Ga0501046_0003756
780 Ga0501046_0025431
781 Ga0501046_0034368
782 Ga0501046_0041123
783 Ga0501046_0073201
784 Ga0501048_0001465
785 Ga0501048_0002453
786 Ga0501048_0006964
787 Ga0501048_0007213
788 Ga0501048_0193587
789 Ga0501048_0195996
790 Ga0501067_0009509
791 Ga0501067_0134745
792 Ga0501067_0167709
793 Ga0501068_0007499
794 Ga0501068_0010823
795 Ga0501068_0033199
796 Ga0501068_0036785
797 Ga0501068_0043562
798 Ga0501068_0057027
799 Ga0501069_0051075
800 Ga0501069_0251250
801 Ga0501070_0008666
802 Ga0501070_0015036
803 Ga0501071_0000342
804 Ga0501071_0000475
805 Ga0501071_0000997
806 Ga0501071_0067591
807 Ga0501071_0180678
808 Ga0501071_0227096
809 Ga0501071_0277734
810 Ga0501072_0002010
811 Ga0501072_0002272
812 Ga0501072_0003294
813 Ga0501072_0003887
814 Ga0501072_0027186
815 Ga0501072_0120346
816 Ga0501072_0320954
817 Ga0501073_0045226
818 Ga0501073_0086928
819 Ga0501074_0004933
820 Ga0501074_0151205
821 Ga0501075_0000158
822 Ga0501075_0001677
823 Ga0501075_0017454
824 Ga0501075_0107608
825 Ga0501076_0001942
826 Ga0501076_0004726
827 Ga0501076_0008934
828 Ga0501076_0063406
829 Ga0501077_0004460
830 Ga0501077_0005033
831 Ga0501077_0007166
832 Ga0501077_0034384
833 Ga0501077_0034601
834 Ga0501077_0049940
835 Ga0501077_0115877
836 Ga0501077_0385127
837 Ga0501079_0001658
838 Ga0501079_0011954
839 Ga0501079_0038112
840 Ga0501079_0075187
841 Ga0501079_0097710
842 Ga0501079_0189124
843 Ga0501080_0004685
844 Ga0501080_0007312
845 Ga0501080_0242669
846 Ga0501080_0611176
847 Ga0501081_0002286
848 Ga0501081_0009112
849 Ga0501081_0072488
850 Ga0501081_0131192
851 Ga0501081_0136614
852 Ga0501081_0238853
853 Ga0501081_0312328
854 Ga0501083_0017527
855 Ga0501083_0031724
856 Ga0501083_0082376
857 Ga0501035_0021200
858 Ga0501035_0093667
859 Ga0501035_0164323
860 Ga0501035_0430088
861 Ga0501044_0248219
862 Ga0501045_0005580
863 Ga0501045_0006880
864 Ga0501045_0013043
865 Ga0501045_0054057
866 Ga0501045_0101923
867 Ga0501045_0102148
868 nmdc:mga0yw44_157419_c1
869 nmdc:mga0yw44_252695_c1
870 nmdc:mga05p37_243363_c1
871 nmdc:mga05p37_325393_c1
872 nmdc:mga05p37_413052_c1
873 nmdc:mga09592_34319_c1
874 nmdc:mga0qj67_6754_c1
875 nmdc:mga06r32_4545_c1
876 nmdc:mga08y16_111758_c1
877 nmdc:mga08y16_220732_c1
878 nmdc:mga08y16_43344_c1
879 nmdc:mga08y16_58646_c1
880 nmdc:mga08y16_77133_c1
881 nmdc:mga08x19_160164_c1
882 nmdc:mga0a205_225303_c1
883 Ga0501084_0001219
884 Ga0501084_0003680
885 Ga0501084_0004188
886 Ga0501084_0021635
887 Ga0501084_0100667
888 Ga0501084_0103555
889 Ga0501084_0138810
890 Ga0501084_0160025
891 Ga0501084_0296838
892 Ga0501082_0002045
893 Ga0501082_0008432
894 Ga0501082_0014872
895 Ga0501082_0044683
896 Ga0501082_0079384
897 Ga0501082_0083710
898 Ga0501082_0601147
899 Ga0530510_0011607
900 Ga0530510_0013682
901 Ga0530510_0019184
902 Ga0530510_0102880
903 Ga0530510_0196010
904 Ga0530510_0216508
905 Ga0530510_0250470
906 Ga0530510_0311786

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02274

ADI

Arginine deiminase

190

273

0.94

PF02274

ADI

Arginine deiminase

105

195

0.9

PF19420

DDAH_eukar

N,N dimethylarginine dimethylhydrolase, eukaryotic

26

272

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rhy-assembly2.cif.gz_B crystal structure of the dimethylarginine dimethylaminohydrolase adduct with 4-chloro-2-hydroxymethylpyridine 0.8949 5 275
3rhy-assembly2.cif.gz_B crystal structure of the dimethylarginine dimethylaminohydrolase adduct with 4-chloro-2-hydroxymethylpyridine 0.8881 5 275
1h70-assembly1.cif.gz_A ddah from pseudomonas aeruginosa. c249s mutant complexed with citrulline 0.8821 4 275
6juy-assembly1.cif.gz_A crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.8812 4 275
1h70-assembly1.cif.gz_A ddah from pseudomonas aeruginosa. c249s mutant complexed with citrulline 0.8756 4 275
ID Description Score Start End Superfamily
af_P71889_53_299_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.8845 28 273 3.75.10.10
3bpbA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.8719 5 275 3.75.10.10
3bpbA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.8654 5 275 3.75.10.10
af_A0A7I9BCB0_10_272_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.8593 5 275 3.75.10.10
1s9rB01 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.8588 2 275 3.75.10.10
ID Description Score Start End GO Terms
AF-A0A538E4K8-F1-model_v4 Amidinotransferase 0.9907 1 139
AF-A0A537YL19-F1-model_v4 Amidinotransferase 0.9794 2 275 GO:0016990
GO:0019546
AF-A0A7W0NHM6-F1-model_v4 Arginine deiminase 0.9794 63 275 GO:0016990
GO:0019546
AF-A0A388NYZ8-F1-model_v4 Arginine deiminase 0.9781 176 275 GO:0006527
GO:0016990
AF-A0A538E4K8-F1-model_v4 Amidinotransferase 0.9767 1 139

Map