F447248

General Info

Members Datasets Scaffolds Average Seq Length
453 246 906 428

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0004409|Ga0495629_0004409_1108_2484
Length 458
Sequence VPAFIRGSSLEDAGPIAVPIDAGNASGISRRIFMKSGALALATIGLNPSFLRRTVFAQDLLKGAALNGNARGKVLIVLFQRGAADALNVVVPHGEQAYYKLRPNIAIPRPVSGTAQSAIDLDGFFGLHPSLSPFKRLWDDGILASVHAVGSPSNTRSHFDAQDYMESGTPDNKGTRDGWLNRYLAVKGTCDECKLGHDAGHAKSSPFQAVAMTPQTPRILEGTAATVAMNNLDEFTIRTNGTQAERIEALYRTGNADVVHAAGGEMFEAMKILQAANPQQYIPQNSADYPRSPFGQHLRQIAQIIKADVGLEVAFADVGGWDTHVNQGGATGQLANRLDDFAKSISALVQDLGNRMADVTILTMSEFGRTARQNGNGGTDHGHATSMFVIGGDVRGKKIYGKWPGLEQEQLNEGRDLALTTDFRSVFSEVAFKHLGAAKMDAVFPGFKGDDKSWLGVL

Samples

Sample ID Description Type Environment
1 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
158 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
159 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
215 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
246 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.87
Rhizosphere 96.25
Stem 0
Stem Tuber 0
Unclassified 2.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495629_0004409 3300046459 Bacteria 10542
2 Ga0058863_10106134 3300004799 Bacteria 3027
3 Ga0058863_10121670 3300004799 Bacteria 1989
4 Ga0058861_10015065 3300004800 Bacteria 2311
5 Ga0058862_10219638 3300004803 Bacteria 1684
6 Ga0065712_10129632 3300005290 Bacteria 1565
7 Ga0065715_10094534 3300005293 Bacteria 4306
8 Ga0065707_10141115 3300005295 Bacteria 1771
9 Ga0070658_10014052 3300005327 Bacteria 6428
10 Ga0070676_10011291 3300005328 Bacteria 4855
11 Ga0070676_10050215 3300005328 Bacteria 2444
12 Ga0070683_100003738 3300005329 Bacteria 12414
13 Ga0070683_100009705 3300005329 Bacteria 8241
14 Ga0070683_100014998 3300005329 Bacteria 6797
15 Ga0070683_100042362 3300005329 Bacteria 4192
16 Ga0070683_100159596 3300005329 Bacteria 2139
17 Ga0070683_100167856 3300005329 Bacteria 2083
18 Ga0070683_100277149 3300005329 Bacteria 1595
19 Ga0070690_100029326 3300005330 Bacteria 3412
20 Ga0070690_100029557 3300005330 Bacteria 3400
21 Ga0070670_100025422 3300005331 Bacteria 5095
22 Ga0070670_100156246 3300005331 Bacteria 1975
23 Ga0068869_100000500 3300005334 Bacteria 21850
24 Ga0070680_100000097 3300005336 Bacteria 50005
25 Ga0070680_100020335 3300005336 Bacteria 5269
26 Ga0070680_100098212 3300005336 Bacteria 2429
27 Ga0070680_100271987 3300005336 Bacteria 1434
28 Ga0070682_100006424 3300005337 Bacteria 6606
29 Ga0070682_100011487 3300005337 Bacteria 5062
30 Ga0070682_100159142 3300005337 Bacteria 1558
31 Ga0068868_100028109 3300005338 Bacteria 4296
32 Ga0068868_100029341 3300005338 Bacteria 4212
33 Ga0070660_100025699 3300005339 Bacteria 4379
34 Ga0070660_100038675 3300005339 Bacteria 3622
35 Ga0070689_100010816 3300005340 Bacteria 6521
36 Ga0070691_10023614 3300005341 Bacteria 2856
37 Ga0070687_100047272 3300005343 Bacteria 2206
38 Ga0070661_100010509 3300005344 Bacteria 6436
39 Ga0070661_100121400 3300005344 Bacteria 1958
40 Ga0070692_10068740 3300005345 Bacteria 1883
41 Ga0070668_100084940 3300005347 Bacteria 2487
42 Ga0070669_100019751 3300005353 Bacteria 4813
43 Ga0070669_100112729 3300005353 Bacteria 2065
44 Ga0070675_100001067 3300005354 Bacteria 19775
45 Ga0070675_100002415 3300005354 Bacteria 13927
46 Ga0070673_100037692 3300005364 Bacteria 3685
47 Ga0070673_100065410 3300005364 Bacteria 2900
48 Ga0070673_100066224 3300005364 Bacteria 2885
49 Ga0070673_100143889 3300005364 Bacteria 2014
50 Ga0070688_100047944 3300005365 Bacteria 2652
51 Ga0070659_100000678 3300005366 Bacteria 24805
52 Ga0070659_100060182 3300005366 Bacteria 3000
53 Ga0070659_100196055 3300005366 Bacteria 1661
54 Ga0070659_100239194 3300005366 Bacteria 1502
55 Ga0070667_100034133 3300005367 Bacteria 4254
56 Ga0070667_100048817 3300005367 Bacteria 3563
57 Ga0070667_100131966 3300005367 Bacteria 2181
58 Ga0070714_100007947 3300005435 Bacteria 8264
59 Ga0070714_100009005 3300005435 Bacteria 7819
60 Ga0070714_100016766 3300005435 Bacteria 5923
61 Ga0070714_100020809 3300005435 Bacteria 5363
62 Ga0070713_100000246 3300005436 Bacteria 35790
63 Ga0070713_100003260 3300005436 Bacteria 10706
64 Ga0070713_100016984 3300005436 Bacteria 5487
65 Ga0070713_100066817 3300005436 Bacteria 3025
66 Ga0070713_100120430 3300005436 Bacteria 2301
67 Ga0070710_10059275 3300005437 Bacteria 2174
68 Ga0070711_100034029 3300005439 Bacteria 3397
69 Ga0070700_100008347 3300005441 Bacteria 5638
70 Ga0070694_100118384 3300005444 Bacteria 1897
71 Ga0070694_100147210 3300005444 Bacteria 1716
72 Ga0070708_100000034 3300005445 Bacteria 86359
73 Ga0070662_100011352 3300005457 Bacteria 5878
74 Ga0070662_100215779 3300005457 Bacteria 1529
75 Ga0070681_10000466 3300005458 Bacteria 33102
76 Ga0070681_10000973 3300005458 Bacteria 24211
77 Ga0070681_10005479 3300005458 Bacteria 12255
78 Ga0070681_10065733 3300005458 Bacteria 3595
79 Ga0070681_10238833 3300005458 Bacteria 1731
80 Ga0068867_100014919 3300005459 Bacteria 5505
81 Ga0068867_100121293 3300005459 Bacteria 2021
82 Ga0070706_100025172 3300005467 Bacteria 5478
83 Ga0070707_100001435 3300005468 Bacteria 23334
84 Ga0070698_100002122 3300005471 Bacteria 22030
85 Ga0070698_100060419 3300005471 Bacteria 3825
86 Ga0070679_100000960 3300005530 Bacteria 25080
87 Ga0070679_100000981 3300005530 Bacteria 24856
88 Ga0070679_100014877 3300005530 Bacteria 7475
89 Ga0070679_100016865 3300005530 Bacteria 7059
90 Ga0070679_100019755 3300005530 Bacteria 6558
91 Ga0070679_100073699 3300005530 Bacteria 3405
92 Ga0070684_100009232 3300005535 Bacteria 7762
93 Ga0070684_100010131 3300005535 Bacteria 7453
94 Ga0070684_100019361 3300005535 Bacteria 5628
95 Ga0070684_100030647 3300005535 Bacteria 4572
96 Ga0070684_100057466 3300005535 Bacteria 3397
97 Ga0070684_100077748 3300005535 Bacteria 2931
98 Ga0070684_100162091 3300005535 Bacteria 2029
99 Ga0070684_100180188 3300005535 Bacteria 1921
100 Ga0070684_100201680 3300005535 Bacteria 1812
101 Ga0070684_100241348 3300005535 Bacteria 1651
102 Ga0068853_100083883 3300005539 Bacteria 2792
103 Ga0068853_100127840 3300005539 Bacteria 2272
104 Ga0068853_100138568 3300005539 Bacteria 2183
105 Ga0070672_100021171 3300005543 Bacteria 4753
106 Ga0070672_100034303 3300005543 Bacteria 3851
107 Ga0070672_100046202 3300005543 Bacteria 3373
108 Ga0070686_100006273 3300005544 Bacteria 6603
109 Ga0070695_100047623 3300005545 Bacteria 2739
110 Ga0070696_100010047 3300005546 Bacteria 6333
111 Ga0070693_100002747 3300005547 Bacteria 8097
112 Ga0070693_100003377 3300005547 Bacteria 7427
113 Ga0070693_100006348 3300005547 Bacteria 5731
114 Ga0070693_100020776 3300005547 Bacteria 3469
115 Ga0070665_100244303 3300005548 Bacteria 1796
116 Ga0068855_100053248 3300005563 Bacteria 4762
117 Ga0068855_100100652 3300005563 Bacteria 3327
118 Ga0068855_100431130 3300005563 Bacteria 1441
119 Ga0070664_100028652 3300005564 Bacteria 4635
120 Ga0070664_100031036 3300005564 Bacteria 4462
121 Ga0070664_100106266 3300005564 Bacteria 2445
122 Ga0070664_100133906 3300005564 Bacteria 2178
123 Ga0068857_100005824 3300005577 Bacteria 10526
124 Ga0068857_100011596 3300005577 Bacteria 7668
125 Ga0068857_100035679 3300005577 Bacteria 4404
126 Ga0068854_100011712 3300005578 Bacteria 5720
127 Ga0068856_100012900 3300005614 Bacteria 8086
128 Ga0070702_100004962 3300005615 Bacteria 6142
129 Ga0068852_100029977 3300005616 Bacteria 4474
130 Ga0068852_100082870 3300005616 Bacteria 2851
131 Ga0068859_100005826 3300005617 Bacteria 12512
132 Ga0068859_100006012 3300005617 Bacteria 12330
133 Ga0068859_100258722 3300005617 Bacteria 1831
134 Ga0068864_100011615 3300005618 Bacteria 7272
135 Ga0068864_100049325 3300005618 Bacteria 3622
136 Ga0068864_100051545 3300005618 Bacteria 3546
137 Ga0068866_10064911 3300005718 Bacteria 1908
138 Ga0068866_10070023 3300005718 Bacteria 1850
139 Ga0068863_100006269 3300005841 Bacteria 11680
140 Ga0068860_100040104 3300005843 Bacteria 4478
141 Ga0081539_10000378 3300005985 Bacteria 97159
142 Ga0070717_10004094 3300006028 Bacteria 10521
143 Ga0070716_100011860 3300006173 Bacteria 4399
144 Ga0070712_100057424 3300006175 Unclassified 2734
145 Ga0068871_100022975 3300006358 Bacteria 4815
146 Ga0075430_100016331 3300006846 Bacteria 6321
147 Ga0075430_100026899 3300006846 Bacteria 4892
148 Ga0075431_100014989 3300006847 Bacteria 7846
149 Ga0075433_10105406 3300006852 Bacteria 2498
150 Ga0075434_100012141 3300006871 Bacteria 8157
151 Ga0075434_100122768 3300006871 Bacteria 2613
152 Ga0075429_100026769 3300006880 Bacteria 5007
153 Ga0068865_100024558 3300006881 Bacteria 3956
154 Ga0068865_100071866 3300006881 Bacteria 2456
155 Ga0075436_100030790 3300006914 Bacteria 3693
156 Ga0097620_100005826 3300006931 Bacteria 12512
157 Ga0097620_100006012 3300006931 Bacteria 12330
158 Ga0097620_100258728 3300006931 Bacteria 1831
159 Ga0075435_100177915 3300007076 Bacteria 1797
160 Ga0105240_10030761 3300009093 Bacteria 6973
161 Ga0105240_10044416 3300009093 Bacteria 5646
162 Ga0105240_10110508 3300009093 Bacteria 3327
163 Ga0105245_10005067 3300009098 Bacteria 11590
164 Ga0105245_10014536 3300009098 Bacteria 6853
165 Ga0105245_10337021 3300009098 Bacteria 1490
166 Ga0114129_10121183 3300009147 Unclassified 3600
167 Ga0114129_10347931 3300009147 Bacteria 1964
168 Ga0105241_10000247 3300009174 Bacteria 40769
169 Ga0105241_10047169 3300009174 Bacteria 3275
170 Ga0105242_10011069 3300009176 Bacteria 6931
171 Ga0105242_10013674 3300009176 Bacteria 6277
172 Ga0105248_10004992 3300009177 Bacteria 14662
173 Ga0105237_10106347 3300009545 Bacteria 2798
174 Ga0105238_10012636 3300009551 Bacteria 8522
175 Ga0105238_10070634 3300009551 Bacteria 3491
176 Ga0105249_10117660 3300009553 Bacteria 2521
177 Ga0099796_10055499 3300010159 Bacteria 1388
178 Ga0105239_10006887 3300010375 Bacteria 13115
179 Ga0105239_10167661 3300010375 Bacteria 2456
180 Ga0157370_10123493 3300013104 Bacteria 2417
181 Ga0157370_10181429 3300013104 Bacteria 1956
182 Ga0157369_10026987 3300013105 Bacteria 6368
183 Ga0157369_10159375 3300013105 Bacteria 2382
184 Ga0157369_10310905 3300013105 Bacteria 1639
185 Ga0157378_10001096 3300013297 Bacteria 24704
186 Ga0157372_10002098 3300013307 Bacteria 21682
187 Ga0157372_10007230 3300013307 Bacteria 11822
188 Ga0157372_10009597 3300013307 Bacteria 10286
189 Ga0157372_10016991 3300013307 Bacteria 7811
190 Ga0157372_10035272 3300013307 Bacteria 5506
191 Ga0157372_10045345 3300013307 Bacteria 4876
192 Ga0157372_10051290 3300013307 Bacteria 4591
193 Ga0157372_10233089 3300013307 Bacteria 2135
194 Ga0157372_10404536 3300013307 Bacteria 1590
195 Ga0157375_10001032 3300013308 Bacteria 24022
196 Ga0157375_10215804 3300013308 Bacteria 2076
197 Ga0163163_10005584 3300014325 Bacteria 10897
198 Ga0157377_10003013 3300014745 Bacteria 7550
199 Ga0157376_10021084 3300014969 Bacteria 5056
200 Ga0213876_10011086 3300021384 Bacteria 4822
201 Ga0213876_10062636 3300021384 Bacteria 1964
202 Ga0207682_10021126 3300025893 Bacteria 2560
203 Ga0207699_10005310 3300025906 Bacteria 6171
204 Ga0207699_10109606 3300025906 Bacteria 1767
205 Ga0207645_10078466 3300025907 Bacteria 2116
206 Ga0207643_10007135 3300025908 Bacteria 5995
207 Ga0207643_10017146 3300025908 Bacteria 3956
208 Ga0207705_10127799 3300025909 Bacteria 1890
209 Ga0207684_10208762 3300025910 Bacteria 1685
210 Ga0207654_10001366 3300025911 Bacteria 12960
211 Ga0207707_10002961 3300025912 Bacteria 15125
212 Ga0207707_10020511 3300025912 Bacteria 5772
213 Ga0207707_10059654 3300025912 Bacteria 3319
214 Ga0207707_10100230 3300025912 Bacteria 2531
215 Ga0207707_10104195 3300025912 Bacteria 2479
216 Ga0207707_10147689 3300025912 Bacteria 2055
217 Ga0207707_10189821 3300025912 Bacteria 1793
218 Ga0207695_10015553 3300025913 Bacteria 8951
219 Ga0207695_10209245 3300025913 Bacteria 1862
220 Ga0207693_10008850 3300025915 Bacteria 8222
221 Ga0207693_10040760 3300025915 Unclassified 3657
222 Ga0207663_10169101 3300025916 Bacteria 1551
223 Ga0207660_10000125 3300025917 Bacteria 45245
224 Ga0207660_10013137 3300025917 Bacteria 5424
225 Ga0207660_10023424 3300025917 Bacteria 4170
226 Ga0207660_10040698 3300025917 Bacteria 3254
227 Ga0207660_10052471 3300025917 Bacteria 2903
228 Ga0207662_10047840 3300025918 Bacteria 2533
229 Ga0207657_10008877 3300025919 Bacteria 10168
230 Ga0207657_10036499 3300025919 Bacteria 4399
231 Ga0207657_10047526 3300025919 Bacteria 3751
232 Ga0207649_10145824 3300025920 Bacteria 1625
233 Ga0207652_10003565 3300025921 Bacteria 12837
234 Ga0207652_10007729 3300025921 Bacteria 8638
235 Ga0207652_10008562 3300025921 Bacteria 8232
236 Ga0207652_10087477 3300025921 Bacteria 2733
237 Ga0207652_10098391 3300025921 Bacteria 2580
238 Ga0207652_10118513 3300025921 Bacteria 2353
239 Ga0207652_10145670 3300025921 Bacteria 2120
240 Ga0207646_10002979 3300025922 Bacteria 19567
241 Ga0207681_10016092 3300025923 Bacteria 4672
242 Ga0207694_10010785 3300025924 Bacteria 6900
243 Ga0207694_10067940 3300025924 Bacteria 2783
244 Ga0207650_10049585 3300025925 Bacteria 3101
245 Ga0207659_10099280 3300025926 Bacteria 2191
246 Ga0207687_10045349 3300025927 Bacteria 3038
247 Ga0207700_10003234 3300025928 Bacteria 9409
248 Ga0207700_10032495 3300025928 Bacteria 3723
249 Ga0207700_10112401 3300025928 Unclassified 2194
250 Ga0207664_10015240 3300025929 Bacteria 5573
251 Ga0207664_10030104 3300025929 Bacteria 4143
252 Ga0207664_10142874 3300025929 Unclassified 2026
253 Ga0207690_10001892 3300025932 Bacteria 12847
254 Ga0207690_10140992 3300025932 Bacteria 1776
255 Ga0207706_10014563 3300025933 Bacteria 7125
256 Ga0207706_10035265 3300025933 Bacteria 4448
257 Ga0207706_10068434 3300025933 Bacteria 3124
258 Ga0207686_10136393 3300025934 Bacteria 1690
259 Ga0207686_10211982 3300025934 Bacteria 1393
260 Ga0207670_10011228 3300025936 Bacteria 5192
261 Ga0207669_10002689 3300025937 Bacteria 7604
262 Ga0207669_10061364 3300025937 Bacteria 2310
263 Ga0207704_10034652 3300025938 Bacteria 2883
264 Ga0207704_10047453 3300025938 Bacteria 2567
265 Ga0207665_10003982 3300025939 Bacteria 9869
266 Ga0207691_10033926 3300025940 Bacteria 4750
267 Ga0207691_10114775 3300025940 Bacteria 2392
268 Ga0207689_10003732 3300025942 Bacteria 13882
269 Ga0207689_10060157 3300025942 Bacteria 3124
270 Ga0207661_10005105 3300025944 Bacteria 9215
271 Ga0207661_10024425 3300025944 Bacteria 4581
272 Ga0207661_10033078 3300025944 Bacteria 4011
273 Ga0207661_10033263 3300025944 Bacteria 4000
274 Ga0207661_10071050 3300025944 Bacteria 2843
275 Ga0207661_10251094 3300025944 Bacteria 1572
276 Ga0207679_10041692 3300025945 Bacteria 3294
277 Ga0207679_10082454 3300025945 Bacteria 2462
278 Ga0207679_10168939 3300025945 Bacteria 1798
279 Ga0207667_10026913 3300025949 Bacteria 6274
280 Ga0207667_10034803 3300025949 Bacteria 5406
281 Ga0207651_10042552 3300025960 Bacteria 3024
282 Ga0207712_10083901 3300025961 Bacteria 2326
283 Ga0207658_10054091 3300025986 Bacteria 2969
284 Ga0207677_10013223 3300026023 Bacteria 4775
285 Ga0207677_10021538 3300026023 Bacteria 3941
286 Ga0207677_10048007 3300026023 Bacteria 2871
287 Ga0207639_10075181 3300026041 Bacteria 2656
288 Ga0207639_10118890 3300026041 Bacteria 2168
289 Ga0207678_10193851 3300026067 Bacteria 1737
290 Ga0207708_10032556 3300026075 Bacteria 3958
291 Ga0207708_10060933 3300026075 Bacteria 2881
292 Ga0207702_10007324 3300026078 Bacteria 9425
293 Ga0207641_10035976 3300026088 Bacteria 4130
294 Ga0207648_10038962 3300026089 Bacteria 4181
295 Ga0207648_10085818 3300026089 Bacteria 2746
296 Ga0207676_10010110 3300026095 Bacteria 6715
297 Ga0207674_10000102 3300026116 Bacteria 97500
298 Ga0207674_10006726 3300026116 Bacteria 13498
299 Ga0207683_10096093 3300026121 Bacteria 2642
300 Ga0207683_10159568 3300026121 Bacteria 2038
301 Ga0207698_10017148 3300026142 Bacteria 4906
302 Ga0207698_10063073 3300026142 Bacteria 2898
303 Ga0209967_1008699 3300027364 Bacteria 1400
304 Ga0210000_1007480 3300027462 Bacteria 1598
305 Ga0268266_10128524 3300028379 Bacteria 2264
306 Ga0268265_10043582 3300028380 Bacteria 3337
307 Ga0268264_10037876 3300028381 Bacteria 3978
308 Ga0268264_10081776 3300028381 Bacteria 2762
309 Ga0307405_10026141 3300031731 Bacteria 3364
310 Ga0307410_10110255 3300031852 Bacteria 1990
311 Ga0307409_100014577 3300031995 Bacteria 5121
312 Ga0307416_100027032 3300032002 Bacteria 4240
313 Ga0373926_0005427 3300035083 Bacteria 4204
314 Ga0373934_0000191 3300035086 Bacteria 22610
315 Ga0373923_0003862 3300035111 Bacteria 4882
316 Ga0373953_0001587 3300035117 Bacteria 6643
317 Ga0373954_0012103 3300035118 Bacteria 3833
318 Ga0373956_0000216 3300035119 Bacteria 22668
319 Ga0373957_0026642 3300035120 Bacteria 2093
320 Ga0373943_0002162 3300035170 Bacteria 8935
321 Ga0373943_0112283 3300035170 Bacteria 1439
322 Ga0373946_0021169 3300035171 Bacteria 2519
323 Ga0373955_0001937 3300035172 Bacteria 8929
324 Ga0373955_0093083 3300035172 Bacteria 1720
325 Ga0373924_0002197 3300035410 Bacteria 6539
326 Ga0373931_0044707 3300035691 Bacteria 2336
327 Ga0373935_0047843 3300035692 Bacteria 2706
328 Ga0373935_0111214 3300035692 Bacteria 1819
329 Ga0373927_0013490 3300035695 Bacteria 5430
330 Ga0373927_0025365 3300035695 Bacteria 3875
331 Ga0373933_0001442 3300035724 Bacteria 13903
332 Ga0373937_0001142 3300036401 Bacteria 22287
333 Ga0373937_0064867 3300036401 Bacteria 3361
334 Ga0373925_0005957 3300037068 Bacteria 9034
335 Ga0373925_0211124 3300037068 Bacteria 1546
336 Ga0395899_0020441 3300037312 Bacteria 5019
337 Ga0395900_0020775 3300037418 Bacteria 6712
338 Ga0395905_0020526 3300037471 Bacteria 6257
339 Ga0395901_0006395 3300038443 Bacteria 11936
340 Ga0436365_0834469 3300039437 Bacteria 2722
341 Ga0436365_1924068 3300039437 Bacteria 4929
342 Ga0466963_0023962 3300044694 Bacteria 3882
343 Ga0466963_0052879 3300044694 Bacteria 2696
344 Ga0466957_0058001 3300044842 Bacteria 2371
345 Ga0466959_0026927 3300045049 Bacteria 4264
346 Ga0451576_0240726 3300045051 Bacteria 1890
347 Ga0466967_0008061 3300045976 Bacteria 7680
348 Ga0466967_0014377 3300045976 Bacteria 6164
349 Ga0495592_0041826 3300046454 Bacteria 3434
350 Ga0495592_0052625 3300046454 Bacteria 3023
351 Ga0495603_0149864 3300046455 Bacteria 1355
352 Ga0495629_0041002 3300046459 Bacteria 3257
353 Ga0495629_0119039 3300046459 Bacteria 1840
354 Ga0495651_0000209 3300046462 Bacteria 44770
355 Ga0495653_0000152 3300046463 Bacteria 57842
356 Ga0495653_0080812 3300046463 Bacteria 2403
357 Ga0495653_0155980 3300046463 Bacteria 1590
358 Ga0495580_0042426 3300046472 Bacteria 3241
359 Ga0495582_0012193 3300046473 Bacteria 4735
360 Ga0495582_0018487 3300046473 Bacteria 3811
361 Ga0495639_0000826 3300046475 Bacteria 14119
362 Ga0495594_0005119 3300046499 Bacteria 6747
363 Ga0495594_0015617 3300046499 Unclassified 3991
364 Ga0495594_0024288 3300046499 Bacteria 3254
365 Ga0495594_0074675 3300046499 Bacteria 1889
366 Ga0495608_0025072 3300046511 Bacteria 4072
367 Ga0495608_0031619 3300046511 Bacteria 3578
368 Ga0495618_0051172 3300046514 Bacteria 2610
369 Ga0495630_0003532 3300046517 Bacteria 10885
370 Ga0495630_0004553 3300046517 Bacteria 9713
371 Ga0495630_0040444 3300046517 Bacteria 3484
372 Ga0495630_0044245 3300046517 Bacteria 3327
373 Ga0495630_0068381 3300046517 Bacteria 2671
374 Ga0495652_0000686 3300046529 Bacteria 39249
375 Ga0495652_0005910 3300046529 Bacteria 11447
376 Ga0495652_0010181 3300046529 Bacteria 8522
377 Ga0495665_0000863 3300046531 Bacteria 15856
378 Ga0495665_0015096 3300046531 Bacteria 4163
379 Ga0495586_0010163 3300046535 Bacteria 5010
380 Ga0495587_0021460 3300046536 Bacteria 3983
381 Ga0495587_0028316 3300046536 Bacteria 3407
382 Ga0495645_0000373 3300046543 Bacteria 31161
383 Ga0495645_0000666 3300046543 Bacteria 23716
384 Ga0495667_0001160 3300046559 Bacteria 17181
385 Ga0495667_0012508 3300046559 Bacteria 5756
386 Ga0495667_0047727 3300046559 Bacteria 2828
387 Ga0495667_0070658 3300046559 Bacteria 2277
388 Ga0495588_0001134 3300046674 Bacteria 11475
389 Ga0495588_0017767 3300046674 Bacteria 3460
390 Ga0495657_0000333 3300046675 Bacteria 43451
391 Ga0495657_0071404 3300046675 Bacteria 2266
392 Ga0495599_0092284 3300046678 Bacteria 1889
393 Ga0495623_0000128 3300046679 Bacteria 45993
394 Ga0495646_0029303 3300046680 Bacteria 3441
395 Ga0495658_0011197 3300046683 Bacteria 4504
396 Ga0495658_0093405 3300046683 Bacteria 1785
397 Ga0495613_0036029 3300046689 Bacteria 3669
398 Ga0495613_0040669 3300046689 Bacteria 3444
399 Ga0495613_0085033 3300046689 Bacteria 2296
400 Ga0495600_0001346 3300046809 Bacteria 13540
401 Ga0495600_0043688 3300046809 Bacteria 2923
402 Ga0495581_0115885 3300047315 Bacteria 1558
403 Ga0495604_0000306 3300047317 Bacteria 43911
404 Ga0495604_0057271 3300047317 Bacteria 2996
405 Ga0495674_0004387 3300047319 Bacteria 13566
406 Ga0495672_0089329 3300047320 Bacteria 1696
407 Ga0495675_0000598 3300047444 Bacteria 23257
408 Ga0495675_0010799 3300047444 Bacteria 5722
409 Ga0495684_0003119 3300047471 Bacteria 12995
410 Ga0495686_0000093 3300047472 Bacteria 188735
411 Ga0495686_0008460 3300047472 Bacteria 7548
412 Ga0495686_0071721 3300047472 Bacteria 2131
413 Ga0495593_0000349 3300047673 Bacteria 25495
414 Ga0495602_0000412 3300048088 Bacteria 40025
415 Ga0496101_0128118 3300048904 Bacteria 1925
416 Ga0496104_0000032 3300048907 Bacteria 191998
417 Ga0496104_0044154 3300048907 Bacteria 4188
418 Ga0496105_0241967 3300048908 Bacteria 1464
419 Ga0496106_0168634 3300048909 Bacteria 1734
420 Ga0496108_0040207 3300048911 Bacteria 3897
421 Ga0496110_0098716 3300048913 Bacteria 2618
422 Ga0496112_0001583 3300048915 Bacteria 17583
423 Ga0496113_0002716 3300048916 Bacteria 10394
424 Ga0496113_0017958 3300048916 Bacteria 4919
425 Ga0496114_0209856 3300048917 Bacteria 1708
426 Ga0496115_0001285 3300048918 Bacteria 17935
427 Ga0496115_0033604 3300048918 Bacteria 4050
428 Ga0501033_0003596 3300049570 Bacteria 12668
429 Ga0501034_0083920 3300049571 Unclassified 3188
430 Ga0501036_0098749 3300049572 Bacteria 2469
431 Ga0501037_0078674 3300049573 Unclassified 2393
432 Ga0501038_0022716 3300049574 Bacteria 5616
433 Ga0501038_0218346 3300049574 Bacteria 1522
434 Ga0501043_0010643 3300049579 Bacteria 7205
435 Ga0501043_0040908 3300049579 Unclassified 3643
436 Ga0501047_0021971 3300049581 Bacteria 6128
437 Ga0501070_0051302 3300049586 Bacteria 3425
438 Ga0501070_0111488 3300049586 Bacteria 2261
439 Ga0501044_0144464 3300049823 Bacteria 2366
440 Ga0501044_0269471 3300049823 Bacteria 1639
441 nmdc:mga05p37_143264_c1 3300050507 Unclassified 2927
442 nmdc:mga05p37_553493_c1 3300050507 Unclassified 1309
443 nmdc:mga09592_12962_c1 3300050508 Bacteria 6802
444 nmdc:mga0qj67_28108_c1 3300050509 Bacteria 4363
445 nmdc:mga06r32_7256_c1 3300050510 Bacteria 9984
446 nmdc:mga06r32_9516_c1 3300050510 Bacteria 8775
447 nmdc:mga08y16_19561_c1 3300050511 Bacteria 7139
448 nmdc:mga0rr50_56005_c1 3300050513 Bacteria 2944
449 nmdc:mga0a205_165926_c1 3300050515 Bacteria 2104
450 Ga0495601_0050189 3300053077 Bacteria 2631
451 Ga0495612_0000453 3300053078 Bacteria 16409
452 Ga0495612_0017441 3300053078 Bacteria 2875
453 Ga0495595_0094927 3300053084 Bacteria 1434
454 Ga0495629_0004409
455 Ga0058863_10106134
456 Ga0058863_10121670
457 Ga0058861_10015065
458 Ga0058862_10219638
459 Ga0065712_10129632
460 Ga0065715_10094534
461 Ga0065707_10141115
462 Ga0070658_10014052
463 Ga0070676_10011291
464 Ga0070676_10050215
465 Ga0070683_100003738
466 Ga0070683_100009705
467 Ga0070683_100014998
468 Ga0070683_100042362
469 Ga0070683_100159596
470 Ga0070683_100167856
471 Ga0070683_100277149
472 Ga0070690_100029326
473 Ga0070690_100029557
474 Ga0070670_100025422
475 Ga0070670_100156246
476 Ga0068869_100000500
477 Ga0070680_100000097
478 Ga0070680_100020335
479 Ga0070680_100098212
480 Ga0070680_100271987
481 Ga0070682_100006424
482 Ga0070682_100011487
483 Ga0070682_100159142
484 Ga0068868_100028109
485 Ga0068868_100029341
486 Ga0070660_100025699
487 Ga0070660_100038675
488 Ga0070689_100010816
489 Ga0070691_10023614
490 Ga0070687_100047272
491 Ga0070661_100010509
492 Ga0070661_100121400
493 Ga0070692_10068740
494 Ga0070668_100084940
495 Ga0070669_100019751
496 Ga0070669_100112729
497 Ga0070675_100001067
498 Ga0070675_100002415
499 Ga0070673_100037692
500 Ga0070673_100065410
501 Ga0070673_100066224
502 Ga0070673_100143889
503 Ga0070688_100047944
504 Ga0070659_100000678
505 Ga0070659_100060182
506 Ga0070659_100196055
507 Ga0070659_100239194
508 Ga0070667_100034133
509 Ga0070667_100048817
510 Ga0070667_100131966
511 Ga0070714_100007947
512 Ga0070714_100009005
513 Ga0070714_100016766
514 Ga0070714_100020809
515 Ga0070713_100000246
516 Ga0070713_100003260
517 Ga0070713_100016984
518 Ga0070713_100066817
519 Ga0070713_100120430
520 Ga0070710_10059275
521 Ga0070711_100034029
522 Ga0070700_100008347
523 Ga0070694_100118384
524 Ga0070694_100147210
525 Ga0070708_100000034
526 Ga0070662_100011352
527 Ga0070662_100215779
528 Ga0070681_10000466
529 Ga0070681_10000973
530 Ga0070681_10005479
531 Ga0070681_10065733
532 Ga0070681_10238833
533 Ga0068867_100014919
534 Ga0068867_100121293
535 Ga0070706_100025172
536 Ga0070707_100001435
537 Ga0070698_100002122
538 Ga0070698_100060419
539 Ga0070679_100000960
540 Ga0070679_100000981
541 Ga0070679_100014877
542 Ga0070679_100016865
543 Ga0070679_100019755
544 Ga0070679_100073699
545 Ga0070684_100009232
546 Ga0070684_100010131
547 Ga0070684_100019361
548 Ga0070684_100030647
549 Ga0070684_100057466
550 Ga0070684_100077748
551 Ga0070684_100162091
552 Ga0070684_100180188
553 Ga0070684_100201680
554 Ga0070684_100241348
555 Ga0068853_100083883
556 Ga0068853_100127840
557 Ga0068853_100138568
558 Ga0070672_100021171
559 Ga0070672_100034303
560 Ga0070672_100046202
561 Ga0070686_100006273
562 Ga0070695_100047623
563 Ga0070696_100010047
564 Ga0070693_100002747
565 Ga0070693_100003377
566 Ga0070693_100006348
567 Ga0070693_100020776
568 Ga0070665_100244303
569 Ga0068855_100053248
570 Ga0068855_100100652
571 Ga0068855_100431130
572 Ga0070664_100028652
573 Ga0070664_100031036
574 Ga0070664_100106266
575 Ga0070664_100133906
576 Ga0068857_100005824
577 Ga0068857_100011596
578 Ga0068857_100035679
579 Ga0068854_100011712
580 Ga0068856_100012900
581 Ga0070702_100004962
582 Ga0068852_100029977
583 Ga0068852_100082870
584 Ga0068859_100005826
585 Ga0068859_100006012
586 Ga0068859_100258722
587 Ga0068864_100011615
588 Ga0068864_100049325
589 Ga0068864_100051545
590 Ga0068866_10064911
591 Ga0068866_10070023
592 Ga0068863_100006269
593 Ga0068860_100040104
594 Ga0081539_10000378
595 Ga0070717_10004094
596 Ga0070716_100011860
597 Ga0070712_100057424
598 Ga0068871_100022975
599 Ga0075430_100016331
600 Ga0075430_100026899
601 Ga0075431_100014989
602 Ga0075433_10105406
603 Ga0075434_100012141
604 Ga0075434_100122768
605 Ga0075429_100026769
606 Ga0068865_100024558
607 Ga0068865_100071866
608 Ga0075436_100030790
609 Ga0097620_100005826
610 Ga0097620_100006012
611 Ga0097620_100258728
612 Ga0075435_100177915
613 Ga0105240_10030761
614 Ga0105240_10044416
615 Ga0105240_10110508
616 Ga0105245_10005067
617 Ga0105245_10014536
618 Ga0105245_10337021
619 Ga0114129_10121183
620 Ga0114129_10347931
621 Ga0105241_10000247
622 Ga0105241_10047169
623 Ga0105242_10011069
624 Ga0105242_10013674
625 Ga0105248_10004992
626 Ga0105237_10106347
627 Ga0105238_10012636
628 Ga0105238_10070634
629 Ga0105249_10117660
630 Ga0099796_10055499
631 Ga0105239_10006887
632 Ga0105239_10167661
633 Ga0157370_10123493
634 Ga0157370_10181429
635 Ga0157369_10026987
636 Ga0157369_10159375
637 Ga0157369_10310905
638 Ga0157378_10001096
639 Ga0157372_10002098
640 Ga0157372_10007230
641 Ga0157372_10009597
642 Ga0157372_10016991
643 Ga0157372_10035272
644 Ga0157372_10045345
645 Ga0157372_10051290
646 Ga0157372_10233089
647 Ga0157372_10404536
648 Ga0157375_10001032
649 Ga0157375_10215804
650 Ga0163163_10005584
651 Ga0157377_10003013
652 Ga0157376_10021084
653 Ga0213876_10011086
654 Ga0213876_10062636
655 Ga0207682_10021126
656 Ga0207699_10005310
657 Ga0207699_10109606
658 Ga0207645_10078466
659 Ga0207643_10007135
660 Ga0207643_10017146
661 Ga0207705_10127799
662 Ga0207684_10208762
663 Ga0207654_10001366
664 Ga0207707_10002961
665 Ga0207707_10020511
666 Ga0207707_10059654
667 Ga0207707_10100230
668 Ga0207707_10104195
669 Ga0207707_10147689
670 Ga0207707_10189821
671 Ga0207695_10015553
672 Ga0207695_10209245
673 Ga0207693_10008850
674 Ga0207693_10040760
675 Ga0207663_10169101
676 Ga0207660_10000125
677 Ga0207660_10013137
678 Ga0207660_10023424
679 Ga0207660_10040698
680 Ga0207660_10052471
681 Ga0207662_10047840
682 Ga0207657_10008877
683 Ga0207657_10036499
684 Ga0207657_10047526
685 Ga0207649_10145824
686 Ga0207652_10003565
687 Ga0207652_10007729
688 Ga0207652_10008562
689 Ga0207652_10087477
690 Ga0207652_10098391
691 Ga0207652_10118513
692 Ga0207652_10145670
693 Ga0207646_10002979
694 Ga0207681_10016092
695 Ga0207694_10010785
696 Ga0207694_10067940
697 Ga0207650_10049585
698 Ga0207659_10099280
699 Ga0207687_10045349
700 Ga0207700_10003234
701 Ga0207700_10032495
702 Ga0207700_10112401
703 Ga0207664_10015240
704 Ga0207664_10030104
705 Ga0207664_10142874
706 Ga0207690_10001892
707 Ga0207690_10140992
708 Ga0207706_10014563
709 Ga0207706_10035265
710 Ga0207706_10068434
711 Ga0207686_10136393
712 Ga0207686_10211982
713 Ga0207670_10011228
714 Ga0207669_10002689
715 Ga0207669_10061364
716 Ga0207704_10034652
717 Ga0207704_10047453
718 Ga0207665_10003982
719 Ga0207691_10033926
720 Ga0207691_10114775
721 Ga0207689_10003732
722 Ga0207689_10060157
723 Ga0207661_10005105
724 Ga0207661_10024425
725 Ga0207661_10033078
726 Ga0207661_10033263
727 Ga0207661_10071050
728 Ga0207661_10251094
729 Ga0207679_10041692
730 Ga0207679_10082454
731 Ga0207679_10168939
732 Ga0207667_10026913
733 Ga0207667_10034803
734 Ga0207651_10042552
735 Ga0207712_10083901
736 Ga0207658_10054091
737 Ga0207677_10013223
738 Ga0207677_10021538
739 Ga0207677_10048007
740 Ga0207639_10075181
741 Ga0207639_10118890
742 Ga0207678_10193851
743 Ga0207708_10032556
744 Ga0207708_10060933
745 Ga0207702_10007324
746 Ga0207641_10035976
747 Ga0207648_10038962
748 Ga0207648_10085818
749 Ga0207676_10010110
750 Ga0207674_10000102
751 Ga0207674_10006726
752 Ga0207683_10096093
753 Ga0207683_10159568
754 Ga0207698_10017148
755 Ga0207698_10063073
756 Ga0209967_1008699
757 Ga0210000_1007480
758 Ga0268266_10128524
759 Ga0268265_10043582
760 Ga0268264_10037876
761 Ga0268264_10081776
762 Ga0307405_10026141
763 Ga0307410_10110255
764 Ga0307409_100014577
765 Ga0307416_100027032
766 Ga0373926_0005427
767 Ga0373934_0000191
768 Ga0373923_0003862
769 Ga0373953_0001587
770 Ga0373954_0012103
771 Ga0373956_0000216
772 Ga0373957_0026642
773 Ga0373943_0002162
774 Ga0373943_0112283
775 Ga0373946_0021169
776 Ga0373955_0001937
777 Ga0373955_0093083
778 Ga0373924_0002197
779 Ga0373931_0044707
780 Ga0373935_0047843
781 Ga0373935_0111214
782 Ga0373927_0013490
783 Ga0373927_0025365
784 Ga0373933_0001442
785 Ga0373937_0001142
786 Ga0373937_0064867
787 Ga0373925_0005957
788 Ga0373925_0211124
789 Ga0395899_0020441
790 Ga0395900_0020775
791 Ga0395905_0020526
792 Ga0395901_0006395
793 Ga0436365_0834469
794 Ga0436365_1924068
795 Ga0466963_0023962
796 Ga0466963_0052879
797 Ga0466957_0058001
798 Ga0466959_0026927
799 Ga0451576_0240726
800 Ga0466967_0008061
801 Ga0466967_0014377
802 Ga0495592_0041826
803 Ga0495592_0052625
804 Ga0495603_0149864
805 Ga0495629_0041002
806 Ga0495629_0119039
807 Ga0495651_0000209
808 Ga0495653_0000152
809 Ga0495653_0080812
810 Ga0495653_0155980
811 Ga0495580_0042426
812 Ga0495582_0012193
813 Ga0495582_0018487
814 Ga0495639_0000826
815 Ga0495594_0005119
816 Ga0495594_0015617
817 Ga0495594_0024288
818 Ga0495594_0074675
819 Ga0495608_0025072
820 Ga0495608_0031619
821 Ga0495618_0051172
822 Ga0495630_0003532
823 Ga0495630_0004553
824 Ga0495630_0040444
825 Ga0495630_0044245
826 Ga0495630_0068381
827 Ga0495652_0000686
828 Ga0495652_0005910
829 Ga0495652_0010181
830 Ga0495665_0000863
831 Ga0495665_0015096
832 Ga0495586_0010163
833 Ga0495587_0021460
834 Ga0495587_0028316
835 Ga0495645_0000373
836 Ga0495645_0000666
837 Ga0495667_0001160
838 Ga0495667_0012508
839 Ga0495667_0047727
840 Ga0495667_0070658
841 Ga0495588_0001134
842 Ga0495588_0017767
843 Ga0495657_0000333
844 Ga0495657_0071404
845 Ga0495599_0092284
846 Ga0495623_0000128
847 Ga0495646_0029303
848 Ga0495658_0011197
849 Ga0495658_0093405
850 Ga0495613_0036029
851 Ga0495613_0040669
852 Ga0495613_0085033
853 Ga0495600_0001346
854 Ga0495600_0043688
855 Ga0495581_0115885
856 Ga0495604_0000306
857 Ga0495604_0057271
858 Ga0495674_0004387
859 Ga0495672_0089329
860 Ga0495675_0000598
861 Ga0495675_0010799
862 Ga0495684_0003119
863 Ga0495686_0000093
864 Ga0495686_0008460
865 Ga0495686_0071721
866 Ga0495593_0000349
867 Ga0495602_0000412
868 Ga0496101_0128118
869 Ga0496104_0000032
870 Ga0496104_0044154
871 Ga0496105_0241967
872 Ga0496106_0168634
873 Ga0496108_0040207
874 Ga0496110_0098716
875 Ga0496112_0001583
876 Ga0496113_0002716
877 Ga0496113_0017958
878 Ga0496114_0209856
879 Ga0496115_0001285
880 Ga0496115_0033604
881 Ga0501033_0003596
882 Ga0501034_0083920
883 Ga0501036_0098749
884 Ga0501037_0078674
885 Ga0501038_0022716
886 Ga0501038_0218346
887 Ga0501043_0010643
888 Ga0501043_0040908
889 Ga0501047_0021971
890 Ga0501070_0051302
891 Ga0501070_0111488
892 Ga0501044_0144464
893 Ga0501044_0269471
894 nmdc:mga05p37_143264_c1
895 nmdc:mga05p37_553493_c1
896 nmdc:mga09592_12962_c1
897 nmdc:mga0qj67_28108_c1
898 nmdc:mga06r32_7256_c1
899 nmdc:mga06r32_9516_c1
900 nmdc:mga08y16_19561_c1
901 nmdc:mga0rr50_56005_c1
902 nmdc:mga0a205_165926_c1
903 Ga0495601_0050189
904 Ga0495612_0000453
905 Ga0495612_0017441
906 Ga0495595_0094927

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07394

DUF1501

Protein of unknown function (DUF1501)

72

442

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zga-assembly1.cif.gz_A structural basis for inhibition of human autotaxin by four novel compounds 0.7219 274 343
6aek-assembly1.cif.gz_A crystal structure of enpp1 in complex with papg 0.6278 257 346
4gtz-assembly2.cif.gz_B crystal structure of mouse enpp1 in complex with cmp 0.6126 257 346
6ael-assembly1.cif.gz_A crystal structure of enpp1 in complex with 3'3'-cgamp 0.6011 257 344
6vc7-assembly1.cif.gz_A structure of the f349a mutant of the periplasmic domain of yejm from salmonella typhimurium 0.5606 39 414
ID Description Score Start End Superfamily
af_A0A0G2KLG3_35_301_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5604 272 339 3.40.720.10
5lrmA00 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5357 38 412 3.40.720.10
af_Q8SZ72_26_377_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5347 269 429 3.40.720.10
af_P40367_51_359_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5293 46 367 3.40.720.10
af_Q09782_46_351_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5192 47 414 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A1F2QV88-F1-model_v4 DUF1501 domain-containing protein 0.9166 275 434
AF-A0A4Q3D5C6-F1-model_v4 DUF1501 domain-containing protein 0.9141 274 434
AF-A0A3M1JBJ8-F1-model_v4 DUF1501 domain-containing protein 0.9117 268 434
AF-A0A2V5KPS4-F1-model_v4 DUF1501 domain-containing protein 0.9022 239 434
AF-A0A3M1JBJ8-F1-model_v4 DUF1501 domain-containing protein 0.9013 268 434

Map