F447202

General Info

Members Datasets Scaffolds Average Seq Length
453 193 453 334

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10207882|Ga0207646_102078823
Length 330
Sequence MKAFEWTNAGSVSEAVQLLAAPAASHDIDEAPRPIAGGQDLLTTMKDYLTRPARVVNLKSIRGLDRIEGDGKKGLTIGALVTLSQLETHPAVRASFPGLAEAAHSIASPQIRNLGTVGGNLCQRPRCWYFRLEEAVCLKKGGTECFAATGENKYNAILGGGPSYIVHPSDLAPMLVALGASVSITGAEGKRLISLERFFTLPSEGSIRRENVLRNDEIITAIQVPASGFASHSTFLKFKELASVAAAVELQTNKTIQQARIVLGGVAPIPWRVPQAEKFLAGKTLSAAVLTEVARLALEGAQPLEKNAYKVPLTQTLVRRALTQAANGSV

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
157 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
179 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
180 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
181 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
182 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
183 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.77
Rhizosphere 97.13
Stem 0
Stem Tuber 0
Unclassified 1.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_4807613 2162886012 Unclassified 1280
2 CNAas_1000097 3300000532 Bacteria 6978
3 JGI24751J29686_10000011 3300002459 Bacteria 117978
4 JGI25406J46586_10002512 3300003203 Bacteria 8684
5 JGI25406J46586_10018582 3300003203 Unclassified 2854
6 rootL2_10056559 3300003322 Unclassified 1307
7 Ga0065714_10064575 3300005288 Bacteria 33064
8 Ga0065712_10000114 3300005290 Bacteria 191810
9 Ga0065712_10073901 3300005290 Bacteria 4246
10 Ga0065712_10077139 3300005290 Bacteria 3543
11 Ga0065715_10100793 3300005293 Bacteria 3269
12 Ga0065715_10103824 3300005293 Bacteria 2961
13 Ga0065715_10126615 3300005293 Unclassified 2105
14 Ga0070676_10075435 3300005328 Bacteria 2033
15 Ga0070676_10088935 3300005328 Bacteria 1888
16 Ga0070690_100001160 3300005330 Bacteria 13561
17 Ga0070690_100036967 3300005330 Unclassified 3074
18 Ga0070690_100086113 3300005330 Bacteria 2062
19 Ga0070670_100000295 3300005331 Bacteria 43851
20 Ga0070670_100064659 3300005331 Bacteria 3138
21 Ga0070670_100305555 3300005331 Bacteria 1392
22 Ga0068869_100032487 3300005334 Bacteria 3678
23 Ga0068869_100085043 3300005334 Bacteria 2369
24 Ga0068869_100135652 3300005334 Unclassified 1896
25 Ga0070680_100005183 3300005336 Bacteria 9866
26 Ga0070680_100031693 3300005336 Unclassified 4251
27 Ga0070680_100069436 3300005336 Bacteria 2893
28 Ga0070682_100007638 3300005337 Bacteria 6092
29 Ga0068868_100123159 3300005338 Bacteria 2116
30 Ga0070689_100067174 3300005340 Unclassified 2794
31 Ga0070689_100140527 3300005340 Bacteria 1942
32 Ga0070689_100164966 3300005340 Unclassified 1792
33 Ga0070661_100127766 3300005344 Unclassified 1908
34 Ga0070692_10021725 3300005345 Bacteria 3124
35 Ga0070669_100003018 3300005353 Bacteria 12115
36 Ga0070669_100075716 3300005353 Unclassified 2497
37 Ga0070669_100080361 3300005353 Unclassified 2427
38 Ga0070669_100132820 3300005353 Bacteria 1912
39 Ga0070675_100292733 3300005354 Bacteria 1433
40 Ga0070675_100294956 3300005354 Unclassified 1427
41 Ga0070671_100008517 3300005355 Bacteria 8221
42 Ga0070671_100108225 3300005355 Bacteria 2334
43 Ga0070674_100122022 3300005356 Unclassified 1930
44 Ga0070673_100001041 3300005364 Bacteria 15734
45 Ga0070673_100191866 3300005364 Unclassified 1755
46 Ga0070673_100445991 3300005364 Bacteria 1163
47 Ga0070688_100123127 3300005365 Bacteria 1740
48 Ga0070659_100000787 3300005366 Bacteria 23097
49 Ga0070703_10012561 3300005406 Bacteria 2399
50 Ga0070709_10122790 3300005434 Bacteria 1763
51 Ga0070701_10040638 3300005438 Bacteria 2365
52 Ga0070701_10128085 3300005438 Bacteria 1439
53 Ga0070705_100020410 3300005440 Bacteria 3506
54 Ga0070705_100026060 3300005440 Bacteria 3179
55 Ga0070700_100000027 3300005441 Bacteria 123461
56 Ga0070700_100012395 3300005441 Bacteria 4755
57 Ga0070700_100069769 3300005441 Bacteria 2239
58 Ga0070694_100001111 3300005444 Bacteria 15387
59 Ga0070694_100019011 3300005444 Bacteria 4365
60 Ga0070694_100038120 3300005444 Bacteria 3192
61 Ga0070694_100051107 3300005444 Bacteria 2789
62 Ga0070694_100058713 3300005444 Unclassified 2618
63 Ga0070694_100059673 3300005444 Bacteria 2599
64 Ga0070694_100082846 3300005444 Bacteria 2234
65 Ga0070694_100230765 3300005444 Unclassified 1392
66 Ga0070708_100001780 3300005445 Bacteria 16548
67 Ga0070678_100119866 3300005456 Unclassified 2073
68 Ga0070662_100127037 3300005457 Bacteria 1961
69 Ga0070681_10002247 3300005458 Bacteria 17621
70 Ga0070681_10003445 3300005458 Bacteria 14812
71 Ga0070681_10085769 3300005458 Bacteria 3102
72 Ga0070681_10097421 3300005458 Bacteria 2888
73 Ga0068867_100009530 3300005459 Bacteria 6846
74 Ga0070706_100000001 3300005467 Bacteria 342302
75 Ga0070706_100002045 3300005467 Bacteria 20666
76 Ga0070706_100014846 3300005467 Bacteria 7199
77 Ga0070706_100123226 3300005467 Unclassified 2417
78 Ga0070706_100219394 3300005467 Bacteria 1775
79 Ga0070706_100234553 3300005467 Bacteria 1713
80 Ga0070707_100011629 3300005468 Bacteria 8214
81 Ga0070707_100089829 3300005468 Unclassified 2973
82 Ga0070707_100181473 3300005468 Bacteria 2052
83 Ga0070698_100000060 3300005471 Bacteria 78692
84 Ga0070698_100006632 3300005471 Bacteria 12552
85 Ga0070698_100018934 3300005471 Bacteria 7242
86 Ga0070698_100024930 3300005471 Bacteria 6234
87 Ga0070698_100076709 3300005471 Bacteria 3343
88 Ga0070698_100150064 3300005471 Bacteria 2279
89 Ga0070698_100209953 3300005471 Bacteria 1882
90 Ga0070698_100239911 3300005471 Bacteria 1746
91 Ga0070699_100002750 3300005518 Bacteria 15692
92 Ga0070699_100002779 3300005518 Bacteria 15617
93 Ga0070699_100097768 3300005518 Unclassified 2572
94 Ga0070699_100137779 3300005518 Unclassified 2153
95 Ga0070679_100000081 3300005530 Bacteria 71191
96 Ga0070679_100119603 3300005530 Bacteria 2619
97 Ga0070684_100142652 3300005535 Bacteria 2167
98 Ga0070684_100419411 3300005535 Unclassified 1235
99 Ga0070697_100000288 3300005536 Bacteria 40851
100 Ga0070697_100004245 3300005536 Bacteria 10978
101 Ga0070697_100008628 3300005536 Bacteria 7959
102 Ga0070697_100197850 3300005536 Unclassified 1707
103 Ga0068853_100007317 3300005539 Bacteria 8835
104 Ga0068853_100255193 3300005539 Bacteria 1610
105 Ga0070686_100009790 3300005544 Bacteria 5387
106 Ga0070686_100032378 3300005544 Unclassified 3205
107 Ga0070695_100024097 3300005545 Bacteria 3746
108 Ga0070695_100088332 3300005545 Unclassified 2064
109 Ga0070695_100094949 3300005545 Bacteria 1998
110 Ga0070695_100130804 3300005545 Bacteria 1730
111 Ga0070695_100149151 3300005545 Unclassified 1630
112 Ga0070695_100183020 3300005545 Bacteria 1486
113 Ga0070695_100251562 3300005545 Bacteria 1286
114 Ga0070696_100011881 3300005546 Bacteria 5836
115 Ga0070696_100041536 3300005546 Bacteria 3177
116 Ga0070693_100001810 3300005547 Bacteria 9750
117 Ga0070693_100065953 3300005547 Bacteria 2117
118 Ga0070693_100263474 3300005547 Bacteria 1147
119 Ga0070704_100042912 3300005549 Bacteria 3132
120 Ga0070704_100099491 3300005549 Bacteria 2187
121 Ga0070704_100128435 3300005549 Bacteria 1960
122 Ga0070704_100228648 3300005549 Unclassified 1516
123 Ga0070704_100313639 3300005549 Unclassified 1311
124 Ga0070664_100005344 3300005564 Bacteria 10305
125 Ga0068857_100006954 3300005577 Bacteria 9738
126 Ga0068857_100090469 3300005577 Bacteria 2739
127 Ga0068857_100165127 3300005577 Bacteria 2010
128 Ga0068856_100021062 3300005614 Bacteria 6336
129 Ga0070702_100009387 3300005615 Bacteria 4784
130 Ga0070702_100046003 3300005615 Bacteria 2472
131 Ga0068852_100050164 3300005616 Bacteria 3574
132 Ga0068859_100014258 3300005617 Bacteria 7972
133 Ga0068859_100023191 3300005617 Bacteria 6226
134 Ga0068859_100027580 3300005617 Bacteria 5696
135 Ga0068859_100035885 3300005617 Bacteria 4975
136 Ga0068859_100060922 3300005617 Unclassified 3802
137 Ga0068859_100163287 3300005617 Bacteria 2306
138 Ga0068859_100167265 3300005617 Bacteria 2279
139 Ga0068859_100437227 3300005617 Bacteria 1404
140 Ga0068864_100004638 3300005618 Bacteria 11272
141 Ga0068864_100012882 3300005618 Bacteria 6918
142 Ga0068864_100017277 3300005618 Bacteria 6015
143 Ga0068864_100042679 3300005618 Unclassified 3881
144 Ga0068864_100106152 3300005618 Bacteria 2497
145 Ga0068864_100112283 3300005618 Bacteria 2429
146 Ga0068864_100142175 3300005618 Bacteria 2166
147 Ga0068864_100277317 3300005618 Bacteria 1564
148 Ga0068866_10036414 3300005718 Bacteria 2411
149 Ga0068861_100001833 3300005719 Bacteria 13675
150 Ga0068861_100162842 3300005719 Bacteria 1841
151 Ga0068851_10001817 3300005834 Bacteria 9333
152 Ga0068870_10028559 3300005840 Bacteria 2802
153 Ga0068870_10056933 3300005840 Unclassified 2088
154 Ga0068870_10069106 3300005840 Bacteria 1921
155 Ga0068870_10162640 3300005840 Bacteria 1325
156 Ga0068863_100054528 3300005841 Bacteria 3787
157 Ga0068863_100056577 3300005841 Bacteria 3713
158 Ga0068863_100133962 3300005841 Bacteria 2367
159 Ga0068858_100031935 3300005842 Bacteria 4891
160 Ga0068858_100134833 3300005842 Bacteria 2316
161 Ga0068858_100160406 3300005842 Bacteria 2117
162 Ga0068858_100441276 3300005842 Bacteria 1254
163 Ga0068860_100026440 3300005843 Bacteria 5594
164 Ga0068860_100056294 3300005843 Bacteria 3739
165 Ga0068860_100077129 3300005843 Bacteria 3168
166 Ga0068860_100206420 3300005843 Bacteria 1905
167 Ga0068860_100255846 3300005843 Bacteria 1706
168 Ga0068860_100553697 3300005843 Bacteria 1152
169 Ga0068862_100019559 3300005844 Bacteria 5654
170 Ga0081539_10000165 3300005985 Bacteria 153824
171 Ga0081539_10000413 3300005985 Bacteria 91117
172 Ga0081539_10002856 3300005985 Bacteria 22992
173 Ga0070715_10000017 3300006163 Bacteria 132686
174 Ga0070716_100000005 3300006173 Bacteria 273485
175 Ga0070716_100057617 3300006173 Bacteria 2233
176 Ga0070716_100092934 3300006173 Bacteria 1830
177 Ga0097621_100001200 3300006237 Bacteria 17937
178 Ga0097621_100073892 3300006237 Unclassified 2823
179 Ga0097621_100078042 3300006237 Bacteria 2750
180 Ga0068871_100021093 3300006358 Bacteria 5002
181 Ga0068871_100084768 3300006358 Bacteria 2630
182 Ga0075428_100302315 3300006844 Bacteria 1720
183 Ga0075431_100055499 3300006847 Bacteria 4086
184 Ga0075431_100114343 3300006847 Bacteria 2786
185 Ga0075431_100206718 3300006847 Bacteria 2007
186 Ga0075431_100230464 3300006847 Bacteria 1887
187 Ga0075433_10098124 3300006852 Unclassified 2593
188 Ga0075433_10180693 3300006852 Unclassified 1877
189 Ga0075434_100082551 3300006871 Bacteria 3211
190 Ga0075434_100135232 3300006871 Unclassified 2484
191 Ga0075434_100442728 3300006871 Bacteria 1321
192 Ga0075429_100006076 3300006880 Bacteria 10443
193 Ga0075429_100013848 3300006880 Bacteria 6993
194 Ga0075429_100016223 3300006880 Bacteria 6454
195 Ga0075429_100056027 3300006880 Bacteria 3431
196 Ga0068865_100092982 3300006881 Unclassified 2192
197 Ga0068865_100121451 3300006881 Unclassified 1943
198 Ga0097620_100014258 3300006931 Bacteria 7972
199 Ga0097620_100023191 3300006931 Bacteria 6226
200 Ga0097620_100027580 3300006931 Bacteria 5696
201 Ga0097620_100035886 3300006931 Bacteria 4975
202 Ga0097620_100060919 3300006931 Unclassified 3802
203 Ga0097620_100163287 3300006931 Bacteria 2306
204 Ga0097620_100167261 3300006931 Bacteria 2279
205 Ga0097620_100437217 3300006931 Bacteria 1404
206 Ga0105240_10439131 3300009093 Unclassified 1463
207 Ga0111539_10010638 3300009094 Bacteria 11585
208 Ga0111539_10046108 3300009094 Bacteria 5215
209 Ga0111539_10212725 3300009094 Bacteria 2253
210 Ga0105245_10048260 3300009098 Unclassified 3808
211 Ga0105247_10005898 3300009101 Bacteria 7653
212 Ga0114129_10028028 3300009147 Bacteria 7977
213 Ga0114129_10040340 3300009147 Bacteria 6581
214 Ga0114129_10048037 3300009147 Bacteria 5996
215 Ga0114129_10102697 3300009147 Bacteria 3954
216 Ga0114129_10165032 3300009147 Unclassified 3023
217 Ga0114129_10336475 3300009147 Unclassified 2003
218 Ga0105243_10000056 3300009148 Bacteria 133442
219 Ga0105243_10017614 3300009148 Bacteria 5403
220 Ga0105243_10056408 3300009148 Bacteria 3124
221 Ga0105243_10090577 3300009148 Bacteria 2517
222 Ga0105241_10116250 3300009174 Bacteria 2148
223 Ga0105241_10185210 3300009174 Bacteria 1730
224 Ga0105242_10000015 3300009176 Bacteria 124678
225 Ga0105242_10385251 3300009176 Bacteria 1304
226 Ga0105248_10001862 3300009177 Bacteria 23377
227 Ga0105248_10011162 3300009177 Bacteria 9911
228 Ga0105248_10059270 3300009177 Unclassified 4299
229 Ga0105248_10417583 3300009177 Unclassified 1511
230 Ga0105248_10534547 3300009177 Bacteria 1322
231 Ga0105248_10580733 3300009177 Bacteria 1264
232 Ga0105237_10002156 3300009545 Bacteria 24760
233 Ga0105238_10008655 3300009551 Bacteria 10185
234 Ga0105238_10041585 3300009551 Bacteria 4655
235 Ga0105249_10024175 3300009553 Bacteria 5459
236 Ga0105249_10060087 3300009553 Unclassified 3487
237 Ga0105249_10131390 3300009553 Bacteria 2391
238 Ga0105249_10159207 3300009553 Unclassified 2180
239 Ga0105239_10162452 3300010375 Unclassified 2496
240 Ga0105246_10009597 3300011119 Bacteria 5964
241 Ga0105246_10029418 3300011119 Unclassified 3618
242 Ga0105246_10040261 3300011119 Unclassified 3153
243 Ga0105246_10170260 3300011119 Bacteria 1667
244 Ga0157373_10013171 3300013100 Bacteria 6069
245 Ga0157378_10005014 3300013297 Bacteria 11619
246 Ga0157378_10015295 3300013297 Bacteria 6721
247 Ga0157378_10095606 3300013297 Bacteria 2706
248 Ga0157378_10121470 3300013297 Bacteria 2408
249 Ga0157378_10208142 3300013297 Bacteria 1853
250 Ga0157378_10352370 3300013297 Unclassified 1438
251 Ga0163162_10021746 3300013306 Bacteria 6318
252 Ga0163162_10100016 3300013306 Unclassified 2991
253 Ga0163162_10124507 3300013306 Bacteria 2683
254 Ga0163162_10195357 3300013306 Unclassified 2152
255 Ga0163162_10441753 3300013306 Bacteria 1433
256 Ga0163162_10570158 3300013306 Bacteria 1259
257 Ga0157372_10045891 3300013307 Unclassified 4849
258 Ga0157375_10023253 3300013308 Bacteria 5716
259 Ga0163163_10001637 3300014325 Bacteria 18849
260 Ga0163163_10011850 3300014325 Bacteria 7927
261 Ga0163163_10021640 3300014325 Bacteria 6072
262 Ga0163163_10094647 3300014325 Unclassified 3005
263 Ga0163163_10222545 3300014325 Unclassified 1936
264 Ga0163163_10283278 3300014325 Bacteria 1709
265 Ga0163163_10285081 3300014325 Bacteria 1704
266 Ga0163163_10356171 3300014325 Bacteria 1520
267 Ga0163163_10622623 3300014325 Bacteria 1143
268 Ga0157380_10002170 3300014326 Bacteria 13168
269 Ga0157380_10008690 3300014326 Bacteria 7259
270 Ga0157379_10213592 3300014968 Bacteria 1747
271 Ga0157376_10006738 3300014969 Bacteria 8133
272 Ga0163161_10076675 3300017792 Unclassified 2454
273 Ga0163161_10099730 3300017792 Unclassified 2160
274 Ga0213876_10000144 3300021384 Bacteria 76915
275 Ga0213876_10000303 3300021384 Bacteria 44145
276 Ga0207656_10013961 3300025321 Bacteria 3083
277 Ga0207653_10007463 3300025885 Bacteria 3408
278 Ga0207653_10017501 3300025885 Unclassified 2256
279 Ga0207682_10045561 3300025893 Bacteria 1800
280 Ga0207642_10195931 3300025899 Bacteria 1112
281 Ga0207710_10002739 3300025900 Bacteria 8075
282 Ga0207647_10003466 3300025904 Bacteria 11831
283 Ga0207685_10000017 3300025905 Bacteria 146902
284 Ga0207699_10293539 3300025906 Bacteria 1133
285 Ga0207645_10080822 3300025907 Bacteria 2084
286 Ga0207645_10087985 3300025907 Unclassified 1996
287 Ga0207645_10139810 3300025907 Unclassified 1578
288 Ga0207643_10004807 3300025908 Bacteria 7238
289 Ga0207643_10038533 3300025908 Bacteria 2685
290 Ga0207684_10000030 3300025910 Bacteria 300037
291 Ga0207684_10024833 3300025910 Bacteria 5107
292 Ga0207684_10081771 3300025910 Bacteria 2749
293 Ga0207684_10227634 3300025910 Bacteria 1609
294 Ga0207654_10101732 3300025911 Unclassified 1771
295 Ga0207707_10000007 3300025912 Bacteria 368555
296 Ga0207707_10017187 3300025912 Bacteria 6305
297 Ga0207707_10077889 3300025912 Unclassified 2894
298 Ga0207671_10003800 3300025914 Bacteria 14811
299 Ga0207660_10012090 3300025917 Bacteria 5642
300 Ga0207660_10079579 3300025917 Unclassified 2404
301 Ga0207660_10165981 3300025917 Bacteria 1706
302 Ga0207662_10049787 3300025918 Bacteria 2486
303 Ga0207649_10100765 3300025920 Unclassified 1911
304 Ga0207652_10000062 3300025921 Bacteria 113255
305 Ga0207646_10015763 3300025922 Bacteria 7118
306 Ga0207646_10061815 3300025922 Bacteria 3343
307 Ga0207646_10207882 3300025922 Unclassified 1768
308 Ga0207681_10111046 3300025923 Archaea 1994
309 Ga0207681_10112626 3300025923 Bacteria 1982
310 Ga0207694_10002731 3300025924 Bacteria 14272
311 Ga0207694_10208818 3300025924 Bacteria 1590
312 Ga0207650_10000001 3300025925 Bacteria 1545726
313 Ga0207644_10011941 3300025931 Bacteria 5759
314 Ga0207644_10103820 3300025931 Bacteria 2139
315 Ga0207644_10192591 3300025931 Unclassified 1604
316 Ga0207644_10351041 3300025931 Bacteria 1198
317 Ga0207706_10131663 3300025933 Bacteria 2200
318 Ga0207706_10200465 3300025933 Unclassified 1750
319 Ga0207686_10000007 3300025934 Bacteria 249199
320 Ga0207709_10000101 3300025935 Bacteria 133425
321 Ga0207709_10010743 3300025935 Bacteria 5044
322 Ga0207670_10000663 3300025936 Bacteria 18187
323 Ga0207670_10176593 3300025936 Bacteria 1606
324 Ga0207670_10229330 3300025936 Unclassified 1425
325 Ga0207665_10000012 3300025939 Bacteria 143062
326 Ga0207691_10007495 3300025940 Bacteria 10504
327 Ga0207711_10007023 3300025941 Bacteria 9434
328 Ga0207711_10019506 3300025941 Bacteria 5645
329 Ga0207689_10039655 3300025942 Bacteria 3899
330 Ga0207689_10102000 3300025942 Bacteria 2357
331 Ga0207689_10146145 3300025942 Unclassified 1948
332 Ga0207689_10167714 3300025942 Bacteria 1809
333 Ga0207689_10258284 3300025942 Unclassified 1441
334 Ga0207689_10312635 3300025942 Unclassified 1303
335 Ga0207679_10398885 3300025945 Bacteria 1210
336 Ga0207651_10011016 3300025960 Bacteria 5041
337 Ga0207651_10018155 3300025960 Bacteria 4178
338 Ga0207651_10139015 3300025960 Unclassified 1873
339 Ga0207651_10160508 3300025960 Bacteria 1762
340 Ga0207712_10074331 3300025961 Bacteria 2454
341 Ga0207712_10214645 3300025961 Bacteria 1535
342 Ga0207658_10131505 3300025986 Bacteria 2011
343 Ga0207677_10031979 3300026023 Bacteria 3377
344 Ga0207703_10022483 3300026035 Bacteria 4947
345 Ga0207703_10104852 3300026035 Unclassified 2402
346 Ga0207703_10200228 3300026035 Bacteria 1774
347 Ga0207703_10341970 3300026035 Bacteria 1375
348 Ga0207703_10464752 3300026035 Unclassified 1184
349 Ga0207639_10181102 3300026041 Unclassified 1792
350 Ga0207708_10000055 3300026075 Bacteria 103534
351 Ga0207708_10006980 3300026075 Bacteria 8351
352 Ga0207708_10017769 3300026075 Bacteria 5353
353 Ga0207708_10035261 3300026075 Unclassified 3807
354 Ga0207708_10062314 3300026075 Bacteria 2849
355 Ga0207708_10143017 3300026075 Bacteria 1878
356 Ga0207702_10288368 3300026078 Unclassified 1554
357 Ga0207641_10041513 3300026088 Bacteria 3855
358 Ga0207641_10092585 3300026088 Bacteria 2648
359 Ga0207648_10008567 3300026089 Bacteria 9893
360 Ga0207648_10182252 3300026089 Bacteria 1859
361 Ga0207648_10199787 3300026089 Unclassified 1773
362 Ga0207676_10001550 3300026095 Bacteria 16929
363 Ga0207676_10010363 3300026095 Bacteria 6636
364 Ga0207676_10019802 3300026095 Unclassified 4915
365 Ga0207676_10028169 3300026095 Unclassified 4194
366 Ga0207676_10088952 3300026095 Unclassified 2529
367 Ga0207674_10000683 3300026116 Bacteria 44086
368 Ga0207674_10086017 3300026116 Bacteria 3138
369 Ga0207674_10088404 3300026116 Bacteria 3091
370 Ga0207674_10268565 3300026116 Unclassified 1653
371 Ga0207675_100002309 3300026118 Bacteria 18947
372 Ga0207675_100031432 3300026118 Bacteria 4946
373 Ga0207675_100151180 3300026118 Unclassified 2209
374 Ga0207683_10134040 3300026121 Unclassified 2229
375 Ga0207698_10097564 3300026142 Bacteria 2426
376 Ga0207428_10012011 3300027907 Bacteria 7622
377 Ga0207428_10167197 3300027907 Unclassified 1667
378 Ga0268265_10026507 3300028380 Bacteria 4125
379 Ga0268265_10095955 3300028380 Unclassified 2382
380 Ga0268265_10162351 3300028380 Bacteria 1900
381 Ga0268265_10224680 3300028380 Bacteria 1646
382 Ga0268265_10382255 3300028380 Bacteria 1296
383 Ga0268264_10015001 3300028381 Bacteria 6359
384 Ga0268264_10031005 3300028381 Bacteria 4384
385 Ga0268264_10180349 3300028381 Bacteria 1917
386 Ga0268264_10240918 3300028381 Bacteria 1675
387 Ga0307408_100189817 3300031548 Bacteria 1654
388 Ga0307405_10035688 3300031731 Unclassified 2972
389 Ga0307416_100026853 3300032002 Bacteria 4251
390 Ga0307416_100146998 3300032002 Bacteria 2154
391 Ga0307414_10174314 3300032004 Unclassified 1723
392 Ga0307414_10214839 3300032004 Bacteria 1575
393 Ga0373951_0001518 3300035091 Bacteria 6072
394 Ga0373941_0018010 3300035115 Bacteria 1945
395 Ga0373942_0006082 3300035207 Unclassified 2785
396 Ga0373937_0031553 3300036401 Bacteria 4803
397 Ga0395898_0025386 3300037466 Bacteria 5972
398 Ga0395905_0011413 3300037471 Bacteria 8585
399 Ga0395905_0115123 3300037471 Unclassified 2527
400 Ga0395901_0091585 3300038443 Bacteria 3183
401 Ga0395901_0447763 3300038443 Bacteria 1321
402 Ga0436365_0255646 3300039437 Bacteria 91230
403 Ga0436365_0854233 3300039437 Bacteria 41356
404 Ga0439458_0006852 3300042157 Bacteria 2539
405 Ga0451576_0240744 3300045051 Bacteria 1890
406 Ga0451576_0510668 3300045051 Bacteria 1263
407 Ga0495659_0003199 3300046664 Bacteria 5243
408 Ga0495684_0064510 3300047471 Unclassified 2784
409 Ga0496102_0191806 3300048905 Bacteria 1926
410 Ga0496104_0276312 3300048907 Bacteria 1593
411 Ga0496106_0078862 3300048909 Bacteria 2528
412 Ga0496107_0031751 3300048910 Bacteria 3771
413 Ga0496108_0263853 3300048911 Bacteria 1499
414 Ga0496112_0366298 3300048915 Bacteria 1383
415 Ga0496112_0488253 3300048915 Bacteria 1168
416 Ga0496113_0331940 3300048916 Bacteria 1219
417 Ga0501298_008600 3300049521 Bacteria 1719
418 Ga0501038_0002091 3300049574 Bacteria 18504
419 Ga0501048_0188941 3300049582 Bacteria 1460
420 Ga0501198_004854 3300049649 Unclassified 1878
421 Ga0501217_005003 3300049661 Unclassified 2752
422 Ga0501224_004426 3300049664 Bacteria 1997
423 Ga0501233_031931 3300049668 Unclassified 1194
424 Ga0501225_0015668 3300049705 Bacteria 2109
425 Ga0501234_027597 3300049707 Unclassified 913
426 nmdc:mga05p37_13879_c1 3300050507 Bacteria 3113
427 nmdc:mga05p37_1659_c1 3300050507 Bacteria 25849
428 nmdc:mga05p37_18129_c1 3300050507 Bacteria 8505
429 nmdc:mga05p37_245820_c1 3300050507 Unclassified 1856
430 nmdc:mga05p37_44785_c1 3300050507 Bacteria 5443
431 nmdc:mga05p37_60311_c1 3300050507 Bacteria 1615
432 nmdc:mga09592_100822_c1 3300050508 Bacteria 2473
433 nmdc:mga09592_140980_c1 3300050508 Bacteria 2078
434 nmdc:mga09592_1621_c1 3300050508 Bacteria 18112
435 nmdc:mga09592_17778_c1 3300050508 Bacteria 5827
436 nmdc:mga0qj67_60141_c1 3300050509 Bacteria 3014
437 nmdc:mga06r32_145096_c1 3300050510 Bacteria 2351
438 nmdc:mga08y16_190958_c1 3300050511 Unclassified 2125
439 nmdc:mga08y16_346795_c1 3300050511 Bacteria 1526
440 nmdc:mga08y16_81366_c1 3300050511 Bacteria 3377
441 nmdc:mga0n895_161153_c1 3300050512 Bacteria 2275
442 nmdc:mga0n895_26275_c1 3300050512 Bacteria 5511
443 nmdc:mga0n895_89903_c1 3300050512 Bacteria 3072
444 nmdc:mga0rr50_19787_c1 3300050513 Bacteria 4554
445 nmdc:mga0rr50_70682_c1 3300050513 Archaea 2660
446 nmdc:mga08x19_55570_c1 3300050514 Bacteria 2552
447 nmdc:mga0a205_115044_c1 3300050515 Bacteria 2588
448 nmdc:mga0a205_18744_c1 3300050515 Bacteria 6512
449 nmdc:mga0a205_255407_c1 3300050515 Unclassified 1631
450 nmdc:mga0a205_278235_c1 3300050515 Unclassified 1549
451 nmdc:mga0a205_289423_c1 3300050515 Unclassified 1513
452 nmdc:mga0a205_99785_c1 3300050515 Bacteria 2802
453 Ga0501084_0178775 3300054114 Bacteria 1791

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048915 Ga0496112_0488253 Ga0496112_0488253_38_913 290
2 3300049707 Ga0501234_027597 Ga0501234_027597_13_885 290
3 3300050515 nmdc:mga0a205_99785_c1 nmdc:mga0a205_99785_c1_1912_2784 290
4 3300038443 Ga0395901_0447763 Ga0395901_0447763_373_1251 292
5 3300009177 Ga0105248_10534547 Ga0105248_105345471 310
6 3300045051 Ga0451576_0240744 Ga0451576_0240744_923_1870 315
7 3300005458 Ga0070681_10097421 Ga0070681_100974214 317
8 3300025912 Ga0207707_10017187 Ga0207707_100171874 317
9 3300049664 Ga0501224_004426 Ga0501224_004426_1007_1963 317
10 3300050513 nmdc:mga0rr50_19787_c1 nmdc:mga0rr50_19787_c1_2001_2999 317
11 3300005471 Ga0070698_100150064 Ga0070698_1001500643 322
12 3300005545 Ga0070695_100183020 Ga0070695_1001830202 324
13 3300037471 Ga0395905_0115123 Ga0395905_0115123_1186_2199 324
14 3300005577 Ga0068857_100090469 Ga0068857_1000904692 325
15 3300005841 Ga0068863_100054528 Ga0068863_1000545282 325
16 3300026088 Ga0207641_10041513 Ga0207641_100415132 325
17 3300026116 Ga0207674_10086017 Ga0207674_100860172 325
18 3300005336 Ga0070680_100005183 Ga0070680_1000051838 326
19 3300005458 Ga0070681_10002247 Ga0070681_100022479 326
20 3300005530 Ga0070679_100000081 Ga0070679_10000008147 326
21 3300005549 Ga0070704_100228648 Ga0070704_1002286481 326
22 3300025912 Ga0207707_10000007 Ga0207707_1000000786 326
23 3300025917 Ga0207660_10012090 Ga0207660_100120902 326
24 3300025921 Ga0207652_10000062 Ga0207652_1000006212 326
25 3300049521 Ga0501298_008600 Ga0501298_008600_672_1652 326
26 3300025922 Ga0207646_10207882 Ga0207646_102078823 329
27 3300005290 Ga0065712_10077139 Ga0065712_100771393 331
28 3300005355 Ga0070671_100008517 Ga0070671_1000085176 331
29 3300005843 Ga0068860_100206420 Ga0068860_1002064203 331
30 3300009094 Ga0111539_10046108 Ga0111539_100461082 331
31 3300009101 Ga0105247_10005898 Ga0105247_100058985 331
32 3300011119 Ga0105246_10170260 Ga0105246_101702601 331
33 3300025900 Ga0207710_10002739 Ga0207710_100027395 331
34 3300025931 Ga0207644_10011941 Ga0207644_100119415 331
35 3300028381 Ga0268264_10180349 Ga0268264_101803493 331
36 3300050515 nmdc:mga0a205_18744_c1 nmdc:mga0a205_18744_c1_1004_1999 331
37 3300000532 CNAas_1000097 CNAas_10000975 332
38 3300002459 JGI24751J29686_10000011 JGI24751J29686_1000001139 332
39 3300003203 JGI25406J46586_10002512 JGI25406J46586_100025124 332
40 3300005293 Ga0065715_10103824 Ga0065715_101038243 332
41 3300005328 Ga0070676_10075435 Ga0070676_100754352 332
42 3300005331 Ga0070670_100000295 Ga0070670_10000029537 332
43 3300005331 Ga0070670_100305555 Ga0070670_1003055551 332
44 3300005337 Ga0070682_100007638 Ga0070682_1000076383 332
45 3300005353 Ga0070669_100075716 Ga0070669_1000757162 332
46 3300005468 Ga0070707_100011629 Ga0070707_1000116293 332
47 3300005471 Ga0070698_100006632 Ga0070698_1000066326 332
48 3300005518 Ga0070699_100137779 Ga0070699_1001377793 332
49 3300005530 Ga0070679_100119603 Ga0070679_1001196032 332
50 3300005536 Ga0070697_100008628 Ga0070697_1000086283 332
51 3300005539 Ga0068853_100255193 Ga0068853_1002551932 332
52 3300005545 Ga0070695_100251562 Ga0070695_1002515621 332
53 3300005577 Ga0068857_100165127 Ga0068857_1001651273 332
54 3300005615 Ga0070702_100009387 Ga0070702_1000093872 332
55 3300005617 Ga0068859_100167265 Ga0068859_1001672651 332
56 3300005618 Ga0068864_100004638 Ga0068864_1000046387 332
57 3300005618 Ga0068864_100112283 Ga0068864_1001122833 332
58 3300005618 Ga0068864_100142175 Ga0068864_1001421751 332
59 3300005618 Ga0068864_100277317 Ga0068864_1002773172 332
60 3300005840 Ga0068870_10028559 Ga0068870_100285594 332
61 3300005840 Ga0068870_10056933 Ga0068870_100569331 332
62 3300005840 Ga0068870_10162640 Ga0068870_101626402 332
63 3300005841 Ga0068863_100056577 Ga0068863_1000565772 332
64 3300005842 Ga0068858_100441276 Ga0068858_1004412761 332
65 3300005843 Ga0068860_100077129 Ga0068860_1000771294 332
66 3300005985 Ga0081539_10000413 Ga0081539_100004136 332
67 3300006237 Ga0097621_100001200 Ga0097621_1000012002 332
68 3300006358 Ga0068871_100084768 Ga0068871_1000847684 332
69 3300006847 Ga0075431_100230464 Ga0075431_1002304643 332
70 3300006871 Ga0075434_100442728 Ga0075434_1004427281 332
71 3300006931 Ga0097620_100167261 Ga0097620_1001672611 332
72 3300009147 Ga0114129_10165032 Ga0114129_101650324 332
73 3300009174 Ga0105241_10116250 Ga0105241_101162503 332
74 3300009177 Ga0105248_10580733 Ga0105248_105807332 332
75 3300009551 Ga0105238_10041585 Ga0105238_100415853 332
76 3300011119 Ga0105246_10040261 Ga0105246_100402613 332
77 3300013100 Ga0157373_10013171 Ga0157373_100131712 332
78 3300013306 Ga0163162_10124507 Ga0163162_101245072 332
79 3300014325 Ga0163163_10001637 Ga0163163_100016374 332
80 3300014325 Ga0163163_10285081 Ga0163163_102850813 332
81 3300014325 Ga0163163_10356171 Ga0163163_103561712 332
82 3300025904 Ga0207647_10003466 Ga0207647_100034669 332
83 3300025907 Ga0207645_10080822 Ga0207645_100808222 332
84 3300025908 Ga0207643_10004807 Ga0207643_100048074 332
85 3300025908 Ga0207643_10038533 Ga0207643_100385333 332
86 3300025922 Ga0207646_10061815 Ga0207646_100618154 332
87 3300025923 Ga0207681_10111046 Ga0207681_101110463 332
88 3300025924 Ga0207694_10208818 Ga0207694_102088183 332
89 3300025925 Ga0207650_10000001 Ga0207650_10000001744 332
90 3300025936 Ga0207670_10000663 Ga0207670_100006632 332
91 3300025942 Ga0207689_10258284 Ga0207689_102582842 332
92 3300025942 Ga0207689_10312635 Ga0207689_103126352 332
93 3300025961 Ga0207712_10074331 Ga0207712_100743312 332
94 3300026035 Ga0207703_10464752 Ga0207703_104647522 332
95 3300026075 Ga0207708_10062314 Ga0207708_100623143 332
96 3300026075 Ga0207708_10143017 Ga0207708_101430171 332
97 3300026088 Ga0207641_10092585 Ga0207641_100925852 332
98 3300026095 Ga0207676_10001550 Ga0207676_100015507 332
99 3300026116 Ga0207674_10088404 Ga0207674_100884044 332
100 3300026116 Ga0207674_10268565 Ga0207674_102685652 332
101 3300028380 Ga0268265_10162351 Ga0268265_101623513 332
102 3300028380 Ga0268265_10224680 Ga0268265_102246803 332
103 3300028380 Ga0268265_10382255 Ga0268265_103822552 332
104 3300032002 Ga0307416_100146998 Ga0307416_1001469982 332
105 3300035207 Ga0373942_0006082 Ga0373942_0006082_711_1718 332
106 3300049582 Ga0501048_0188941 Ga0501048_0188941_190_1191 332
107 3300050507 nmdc:mga05p37_245820_c1 nmdc:mga05p37_245820_c1_316_1314 332
108 3300050510 nmdc:mga06r32_145096_c1 nmdc:mga06r32_145096_c1_1261_2295 332
109 3300050515 nmdc:mga0a205_255407_c1 nmdc:mga0a205_255407_c1_145_1143 332
110 3300050515 nmdc:mga0a205_289423_c1 nmdc:mga0a205_289423_c1_80_1078 332
111 3300003322 rootL2_10056559 rootL2_100565592 333
112 3300005288 Ga0065714_10064575 Ga0065714_1006457522 333
113 3300005290 Ga0065712_10000114 Ga0065712_1000011423 333
114 3300005290 Ga0065712_10073901 Ga0065712_100739014 333
115 3300005334 Ga0068869_100085043 Ga0068869_1000850433 333
116 3300005336 Ga0070680_100031693 Ga0070680_1000316932 333
117 3300005338 Ga0068868_100123159 Ga0068868_1001231592 333
118 3300005340 Ga0070689_100140527 Ga0070689_1001405272 333
119 3300005344 Ga0070661_100127766 Ga0070661_1001277662 333
120 3300005345 Ga0070692_10021725 Ga0070692_100217253 333
121 3300005355 Ga0070671_100108225 Ga0070671_1001082252 333
122 3300005366 Ga0070659_100000787 Ga0070659_10000078713 333
123 3300005406 Ga0070703_10012561 Ga0070703_100125613 333
124 3300005440 Ga0070705_100020410 Ga0070705_1000204103 333
125 3300005441 Ga0070700_100012395 Ga0070700_1000123953 333
126 3300005444 Ga0070694_100019011 Ga0070694_1000190114 333
127 3300005444 Ga0070694_100082846 Ga0070694_1000828463 333
128 3300005458 Ga0070681_10003445 Ga0070681_100034456 333
129 3300005467 Ga0070706_100000001 Ga0070706_10000000158 333
130 3300005467 Ga0070706_100123226 Ga0070706_1001232262 333
131 3300005467 Ga0070706_100234553 Ga0070706_1002345531 333
132 3300005468 Ga0070707_100181473 Ga0070707_1001814731 333
133 3300005471 Ga0070698_100024930 Ga0070698_1000249304 333
134 3300005471 Ga0070698_100076709 Ga0070698_1000767092 333
135 3300005535 Ga0070684_100142652 Ga0070684_1001426522 333
136 3300005535 Ga0070684_100419411 Ga0070684_1004194111 333
137 3300005536 Ga0070697_100197850 Ga0070697_1001978503 333
138 3300005539 Ga0068853_100007317 Ga0068853_1000073171 333
139 3300005545 Ga0070695_100130804 Ga0070695_1001308042 333
140 3300005545 Ga0070695_100149151 Ga0070695_1001491511 333
141 3300005546 Ga0070696_100041536 Ga0070696_1000415364 333
142 3300005547 Ga0070693_100065953 Ga0070693_1000659531 333
143 3300005547 Ga0070693_100263474 Ga0070693_1002634741 333
144 3300005564 Ga0070664_100005344 Ga0070664_1000053444 333
145 3300005577 Ga0068857_100006954 Ga0068857_1000069546 333
146 3300005614 Ga0068856_100021062 Ga0068856_1000210623 333
147 3300005615 Ga0070702_100046003 Ga0070702_1000460032 333
148 3300005616 Ga0068852_100050164 Ga0068852_1000501643 333
149 3300005617 Ga0068859_100023191 Ga0068859_1000231912 333
150 3300005617 Ga0068859_100027580 Ga0068859_1000275802 333
151 3300005617 Ga0068859_100035885 Ga0068859_1000358852 333
152 3300005617 Ga0068859_100437227 Ga0068859_1004372272 333
153 3300005618 Ga0068864_100012882 Ga0068864_1000128825 333
154 3300005618 Ga0068864_100017277 Ga0068864_1000172772 333
155 3300005618 Ga0068864_100042679 Ga0068864_1000426792 333
156 3300005719 Ga0068861_100001833 Ga0068861_1000018338 333
157 3300005834 Ga0068851_10001817 Ga0068851_100018179 333
158 3300005842 Ga0068858_100031935 Ga0068858_1000319351 333
159 3300005842 Ga0068858_100134833 Ga0068858_1001348332 333
160 3300005842 Ga0068858_100160406 Ga0068858_1001604063 333
161 3300005843 Ga0068860_100026440 Ga0068860_1000264405 333
162 3300005843 Ga0068860_100056294 Ga0068860_1000562942 333
163 3300005843 Ga0068860_100553697 Ga0068860_1005536971 333
164 3300006237 Ga0097621_100078042 Ga0097621_1000780422 333
165 3300006358 Ga0068871_100021093 Ga0068871_1000210934 333
166 3300006844 Ga0075428_100302315 Ga0075428_1003023152 333
167 3300006852 Ga0075433_10098124 Ga0075433_100981241 333
168 3300006852 Ga0075433_10180693 Ga0075433_101806931 333
169 3300006871 Ga0075434_100135232 Ga0075434_1001352322 333
170 3300006880 Ga0075429_100013848 Ga0075429_1000138485 333
171 3300006931 Ga0097620_100023191 Ga0097620_1000231916 333
172 3300006931 Ga0097620_100027580 Ga0097620_1000275802 333
173 3300006931 Ga0097620_100035886 Ga0097620_1000358862 333
174 3300006931 Ga0097620_100437217 Ga0097620_1004372172 333
175 3300009148 Ga0105243_10017614 Ga0105243_100176144 333
176 3300009174 Ga0105241_10185210 Ga0105241_101852102 333
177 3300009176 Ga0105242_10385251 Ga0105242_103852512 333
178 3300009177 Ga0105248_10001862 Ga0105248_100018629 333
179 3300009545 Ga0105237_10002156 Ga0105237_1000215620 333
180 3300009551 Ga0105238_10008655 Ga0105238_100086557 333
181 3300009553 Ga0105249_10024175 Ga0105249_100241754 333
182 3300009553 Ga0105249_10131390 Ga0105249_101313902 333
183 3300011119 Ga0105246_10009597 Ga0105246_100095975 333
184 3300013297 Ga0157378_10121470 Ga0157378_101214702 333
185 3300013297 Ga0157378_10208142 Ga0157378_102081422 333
186 3300013306 Ga0163162_10021746 Ga0163162_100217463 333
187 3300013307 Ga0157372_10045891 Ga0157372_100458914 333
188 3300013308 Ga0157375_10023253 Ga0157375_100232534 333
189 3300014325 Ga0163163_10011850 Ga0163163_100118506 333
190 3300014325 Ga0163163_10021640 Ga0163163_100216401 333
191 3300014325 Ga0163163_10094647 Ga0163163_100946472 333
192 3300014325 Ga0163163_10283278 Ga0163163_102832782 333
193 3300014325 Ga0163163_10622623 Ga0163163_106226232 333
194 3300014968 Ga0157379_10213592 Ga0157379_102135923 333
195 3300025321 Ga0207656_10013961 Ga0207656_100139613 333
196 3300025885 Ga0207653_10007463 Ga0207653_100074632 333
197 3300025910 Ga0207684_10000030 Ga0207684_10000030183 333
198 3300025910 Ga0207684_10227634 Ga0207684_102276342 333
199 3300025911 Ga0207654_10101732 Ga0207654_101017322 333
200 3300025912 Ga0207707_10077889 Ga0207707_100778892 333
201 3300025914 Ga0207671_10003800 Ga0207671_1000380013 333
202 3300025917 Ga0207660_10079579 Ga0207660_100795793 333
203 3300025918 Ga0207662_10049787 Ga0207662_100497872 333
204 3300025920 Ga0207649_10100765 Ga0207649_101007652 333
205 3300025924 Ga0207694_10002731 Ga0207694_100027317 333
206 3300025931 Ga0207644_10103820 Ga0207644_101038202 333
207 3300025931 Ga0207644_10351041 Ga0207644_103510411 333
208 3300025935 Ga0207709_10010743 Ga0207709_100107432 333
209 3300025936 Ga0207670_10176593 Ga0207670_101765931 333
210 3300025936 Ga0207670_10229330 Ga0207670_102293302 333
211 3300025941 Ga0207711_10019506 Ga0207711_100195065 333
212 3300025942 Ga0207689_10102000 Ga0207689_101020003 333
213 3300025945 Ga0207679_10398885 Ga0207679_103988852 333
214 3300025986 Ga0207658_10131505 Ga0207658_101315052 333
215 3300026023 Ga0207677_10031979 Ga0207677_100319794 333
216 3300026035 Ga0207703_10022483 Ga0207703_100224831 333
217 3300026035 Ga0207703_10200228 Ga0207703_102002282 333
218 3300026035 Ga0207703_10341970 Ga0207703_103419702 333
219 3300026041 Ga0207639_10181102 Ga0207639_101811022 333
220 3300026075 Ga0207708_10017769 Ga0207708_100177693 333
221 3300026078 Ga0207702_10288368 Ga0207702_102883681 333
222 3300026095 Ga0207676_10010363 Ga0207676_100103635 333
223 3300026095 Ga0207676_10019802 Ga0207676_100198025 333
224 3300026095 Ga0207676_10088952 Ga0207676_100889522 333
225 3300026116 Ga0207674_10000683 Ga0207674_1000068323 333
226 3300026118 Ga0207675_100002309 Ga0207675_1000023096 333
227 3300026142 Ga0207698_10097564 Ga0207698_100975642 333
228 3300028381 Ga0268264_10015001 Ga0268264_100150016 333
229 3300028381 Ga0268264_10031005 Ga0268264_100310054 333
230 3300032004 Ga0307414_10174314 Ga0307414_101743143 333
231 3300035091 Ga0373951_0001518 Ga0373951_0001518_806_1807 333
232 3300036401 Ga0373937_0031553 Ga0373937_0031553_3076_4080 333
233 3300045051 Ga0451576_0510668 Ga0451576_0510668_235_1239 333
234 3300048905 Ga0496102_0191806 Ga0496102_0191806_235_1236 333
235 3300048909 Ga0496106_0078862 Ga0496106_0078862_147_1148 333
236 3300048910 Ga0496107_0031751 Ga0496107_0031751_2537_3538 333
237 3300048911 Ga0496108_0263853 Ga0496108_0263853_369_1373 333
238 3300048916 Ga0496113_0331940 Ga0496113_0331940_112_1113 333
239 3300049574 Ga0501038_0002091 Ga0501038_0002091_994_1998 333
240 3300050507 nmdc:mga05p37_44785_c1 nmdc:mga05p37_44785_c1_4145_5146 333
241 3300050508 nmdc:mga09592_100822_c1 nmdc:mga09592_100822_c1_1361_2365 333
242 3300050511 nmdc:mga08y16_346795_c1 nmdc:mga08y16_346795_c1_188_1189 333
243 3300050512 nmdc:mga0n895_161153_c1 nmdc:mga0n895_161153_c1_606_1610 333
244 3300050512 nmdc:mga0n895_26275_c1 nmdc:mga0n895_26275_c1_962_1963 333
245 3300050513 nmdc:mga0rr50_70682_c1 nmdc:mga0rr50_70682_c1_721_1725 333
246 3300050515 nmdc:mga0a205_278235_c1 nmdc:mga0a205_278235_c1_331_1332 333
247 3300003203 JGI25406J46586_10018582 JGI25406J46586_100185821 334
248 3300005328 Ga0070676_10088935 Ga0070676_100889352 334
249 3300005330 Ga0070690_100036967 Ga0070690_1000369672 334
250 3300005331 Ga0070670_100064659 Ga0070670_1000646592 334
251 3300005334 Ga0068869_100032487 Ga0068869_1000324872 334
252 3300005336 Ga0070680_100069436 Ga0070680_1000694362 334
253 3300005340 Ga0070689_100164966 Ga0070689_1001649661 334
254 3300005353 Ga0070669_100080361 Ga0070669_1000803614 334
255 3300005353 Ga0070669_100132820 Ga0070669_1001328203 334
256 3300005354 Ga0070675_100294956 Ga0070675_1002949562 334
257 3300005356 Ga0070674_100122022 Ga0070674_1001220222 334
258 3300005364 Ga0070673_100445991 Ga0070673_1004459911 334
259 3300005438 Ga0070701_10128085 Ga0070701_101280852 334
260 3300005440 Ga0070705_100026060 Ga0070705_1000260603 334
261 3300005441 Ga0070700_100000027 Ga0070700_10000002799 334
262 3300005441 Ga0070700_100069769 Ga0070700_1000697693 334
263 3300005444 Ga0070694_100038120 Ga0070694_1000381202 334
264 3300005456 Ga0070678_100119866 Ga0070678_1001198662 334
265 3300005458 Ga0070681_10085769 Ga0070681_100857692 334
266 3300005459 Ga0068867_100009530 Ga0068867_1000095305 334
267 3300005471 Ga0070698_100209953 Ga0070698_1002099533 334
268 3300005471 Ga0070698_100239911 Ga0070698_1002399112 334
269 3300005518 Ga0070699_100002750 Ga0070699_1000027508 334
270 3300005536 Ga0070697_100000288 Ga0070697_10000028817 334
271 3300005544 Ga0070686_100032378 Ga0070686_1000323784 334
272 3300005545 Ga0070695_100024097 Ga0070695_1000240972 334
273 3300005545 Ga0070695_100088332 Ga0070695_1000883323 334
274 3300005545 Ga0070695_100094949 Ga0070695_1000949492 334
275 3300005546 Ga0070696_100011881 Ga0070696_1000118814 334
276 3300005547 Ga0070693_100001810 Ga0070693_1000018103 334
277 3300005549 Ga0070704_100042912 Ga0070704_1000429122 334
278 3300005549 Ga0070704_100313639 Ga0070704_1003136392 334
279 3300005617 Ga0068859_100014258 Ga0068859_1000142586 334
280 3300005617 Ga0068859_100163287 Ga0068859_1001632872 334
281 3300005618 Ga0068864_100106152 Ga0068864_1001061524 334
282 3300005718 Ga0068866_10036414 Ga0068866_100364142 334
283 3300005719 Ga0068861_100162842 Ga0068861_1001628423 334
284 3300005840 Ga0068870_10069106 Ga0068870_100691063 334
285 3300005841 Ga0068863_100133962 Ga0068863_1001339623 334
286 3300005985 Ga0081539_10002856 Ga0081539_1000285620 334
287 3300006173 Ga0070716_100057617 Ga0070716_1000576171 334
288 3300006237 Ga0097621_100073892 Ga0097621_1000738922 334
289 3300006847 Ga0075431_100055499 Ga0075431_1000554992 334
290 3300006847 Ga0075431_100114343 Ga0075431_1001143432 334
291 3300006871 Ga0075434_100082551 Ga0075434_1000825514 334
292 3300006880 Ga0075429_100016223 Ga0075429_1000162232 334
293 3300006880 Ga0075429_100056027 Ga0075429_1000560272 334
294 3300006931 Ga0097620_100014258 Ga0097620_1000142586 334
295 3300006931 Ga0097620_100163287 Ga0097620_1001632872 334
296 3300009093 Ga0105240_10439131 Ga0105240_104391313 334
297 3300009098 Ga0105245_10048260 Ga0105245_100482602 334
298 3300009147 Ga0114129_10028028 Ga0114129_100280284 334
299 3300009147 Ga0114129_10102697 Ga0114129_101026972 334
300 3300009148 Ga0105243_10056408 Ga0105243_100564083 334
301 3300009177 Ga0105248_10011162 Ga0105248_100111626 334
302 3300009553 Ga0105249_10060087 Ga0105249_100600872 334
303 3300011119 Ga0105246_10029418 Ga0105246_100294182 334
304 3300013297 Ga0157378_10015295 Ga0157378_100152954 334
305 3300013297 Ga0157378_10095606 Ga0157378_100956063 334
306 3300013306 Ga0163162_10100016 Ga0163162_101000163 334
307 3300013306 Ga0163162_10195357 Ga0163162_101953572 334
308 3300013306 Ga0163162_10441753 Ga0163162_104417532 334
309 3300014326 Ga0157380_10008690 Ga0157380_100086906 334
310 3300014969 Ga0157376_10006738 Ga0157376_100067382 334
311 3300017792 Ga0163161_10076675 Ga0163161_100766752 334
312 3300025893 Ga0207682_10045561 Ga0207682_100455612 334
313 3300025899 Ga0207642_10195931 Ga0207642_101959311 334
314 3300025907 Ga0207645_10087985 Ga0207645_100879853 334
315 3300025917 Ga0207660_10165981 Ga0207660_101659813 334
316 3300025923 Ga0207681_10112626 Ga0207681_101126262 334
317 3300025931 Ga0207644_10192591 Ga0207644_101925911 334
318 3300025940 Ga0207691_10007495 Ga0207691_100074957 334
319 3300025941 Ga0207711_10007023 Ga0207711_100070234 334
320 3300025942 Ga0207689_10039655 Ga0207689_100396552 334
321 3300025942 Ga0207689_10167714 Ga0207689_101677142 334
322 3300025960 Ga0207651_10011016 Ga0207651_100110162 334
323 3300025960 Ga0207651_10139015 Ga0207651_101390152 334
324 3300025961 Ga0207712_10214645 Ga0207712_102146452 334
325 3300026075 Ga0207708_10000055 Ga0207708_100000558 334
326 3300026075 Ga0207708_10035261 Ga0207708_100352612 334
327 3300026089 Ga0207648_10008567 Ga0207648_100085671 334
328 3300026118 Ga0207675_100151180 Ga0207675_1001511802 334
329 3300026121 Ga0207683_10134040 Ga0207683_101340401 334
330 3300028380 Ga0268265_10026507 Ga0268265_100265074 334
331 3300031548 Ga0307408_100189817 Ga0307408_1001898172 334
332 3300031731 Ga0307405_10035688 Ga0307405_100356882 334
333 3300032002 Ga0307416_100026853 Ga0307416_1000268534 334
334 3300035115 Ga0373941_0018010 Ga0373941_0018010_435_1442 334
335 3300037466 Ga0395898_0025386 Ga0395898_0025386_2386_3393 334
336 3300038443 Ga0395901_0091585 Ga0395901_0091585_1152_2159 334
337 3300042157 Ga0439458_0006852 Ga0439458_0006852_404_1411 334
338 3300048907 Ga0496104_0276312 Ga0496104_0276312_400_1404 334
339 3300048915 Ga0496112_0366298 Ga0496112_0366298_136_1140 334
340 3300049649 Ga0501198_004854 Ga0501198_004854_32_1039 334
341 3300049661 Ga0501217_005003 Ga0501217_005003_770_1777 334
342 3300049668 Ga0501233_031931 Ga0501233_031931_67_1074 334
343 3300049705 Ga0501225_0015668 Ga0501225_0015668_272_1279 334
344 3300050507 nmdc:mga05p37_1659_c1 nmdc:mga05p37_1659_c1_5734_6744 334
345 3300050507 nmdc:mga05p37_60311_c1 nmdc:mga05p37_60311_c1_141_1145 334
346 3300050508 nmdc:mga09592_140980_c1 nmdc:mga09592_140980_c1_1053_2057 334
347 3300050508 nmdc:mga09592_1621_c1 nmdc:mga09592_1621_c1_2069_3079 334
348 3300050509 nmdc:mga0qj67_60141_c1 nmdc:mga0qj67_60141_c1_660_1664 334
349 3300050512 nmdc:mga0n895_89903_c1 nmdc:mga0n895_89903_c1_294_1301 334
350 3300050514 nmdc:mga08x19_55570_c1 nmdc:mga08x19_55570_c1_1338_2342 334
351 3300050515 nmdc:mga0a205_115044_c1 nmdc:mga0a205_115044_c1_10_1014 334
352 3300054114 Ga0501084_0178775 Ga0501084_0178775_277_1281 334
353 3300005364 Ga0070673_100001041 Ga0070673_10000104112 335
354 3300005434 Ga0070709_10122790 Ga0070709_101227902 335
355 3300006173 Ga0070716_100092934 Ga0070716_1000929342 335
356 3300006847 Ga0075431_100206718 Ga0075431_1002067183 335
357 3300009147 Ga0114129_10336475 Ga0114129_103364753 335
358 3300025906 Ga0207699_10293539 Ga0207699_102935392 335
359 3300025960 Ga0207651_10018155 Ga0207651_100181554 335
360 2162886012 MBSR1b_contig_4807613 MBSR1b_0937.00004500 336
361 3300005293 Ga0065715_10100793 Ga0065715_101007933 336
362 3300005293 Ga0065715_10126615 Ga0065715_101266152 336
363 3300005330 Ga0070690_100001160 Ga0070690_1000011605 336
364 3300005330 Ga0070690_100086113 Ga0070690_1000861133 336
365 3300005334 Ga0068869_100135652 Ga0068869_1001356522 336
366 3300005340 Ga0070689_100067174 Ga0070689_1000671742 336
367 3300005353 Ga0070669_100003018 Ga0070669_1000030186 336
368 3300005354 Ga0070675_100292733 Ga0070675_1002927332 336
369 3300005364 Ga0070673_100191866 Ga0070673_1001918661 336
370 3300005365 Ga0070688_100123127 Ga0070688_1001231272 336
371 3300005438 Ga0070701_10040638 Ga0070701_100406383 336
372 3300005444 Ga0070694_100001111 Ga0070694_1000011115 336
373 3300005444 Ga0070694_100051107 Ga0070694_1000511071 336
374 3300005444 Ga0070694_100058713 Ga0070694_1000587132 336
375 3300005444 Ga0070694_100059673 Ga0070694_1000596733 336
376 3300005444 Ga0070694_100230765 Ga0070694_1002307651 336
377 3300005445 Ga0070708_100001780 Ga0070708_1000017806 336
378 3300005457 Ga0070662_100127037 Ga0070662_1001270372 336
379 3300005467 Ga0070706_100002045 Ga0070706_10000204518 336
380 3300005467 Ga0070706_100014846 Ga0070706_1000148465 336
381 3300005467 Ga0070706_100219394 Ga0070706_1002193942 336
382 3300005468 Ga0070707_100089829 Ga0070707_1000898292 336
383 3300005471 Ga0070698_100000060 Ga0070698_10000006010 336
384 3300005471 Ga0070698_100018934 Ga0070698_1000189346 336
385 3300005518 Ga0070699_100002779 Ga0070699_1000027795 336
386 3300005518 Ga0070699_100097768 Ga0070699_1000977683 336
387 3300005536 Ga0070697_100004245 Ga0070697_1000042453 336
388 3300005544 Ga0070686_100009790 Ga0070686_1000097904 336
389 3300005549 Ga0070704_100099491 Ga0070704_1000994913 336
390 3300005549 Ga0070704_100128435 Ga0070704_1001284351 336
391 3300005617 Ga0068859_100060922 Ga0068859_1000609223 336
392 3300005843 Ga0068860_100255846 Ga0068860_1002558462 336
393 3300005844 Ga0068862_100019559 Ga0068862_1000195594 336
394 3300005985 Ga0081539_10000165 Ga0081539_1000016577 336
395 3300006163 Ga0070715_10000017 Ga0070715_1000001742 336
396 3300006173 Ga0070716_100000005 Ga0070716_10000000554 336
397 3300006880 Ga0075429_100006076 Ga0075429_1000060764 336
398 3300006881 Ga0068865_100092982 Ga0068865_1000929821 336
399 3300006881 Ga0068865_100121451 Ga0068865_1001214513 336
400 3300006931 Ga0097620_100060919 Ga0097620_1000609192 336
401 3300009094 Ga0111539_10010638 Ga0111539_100106384 336
402 3300009094 Ga0111539_10212725 Ga0111539_102127252 336
403 3300009147 Ga0114129_10040340 Ga0114129_100403403 336
404 3300009147 Ga0114129_10048037 Ga0114129_100480375 336
405 3300009148 Ga0105243_10000056 Ga0105243_1000005681 336
406 3300009148 Ga0105243_10090577 Ga0105243_100905773 336
407 3300009176 Ga0105242_10000015 Ga0105242_1000001574 336
408 3300009177 Ga0105248_10059270 Ga0105248_100592702 336
409 3300009177 Ga0105248_10417583 Ga0105248_104175831 336
410 3300009553 Ga0105249_10159207 Ga0105249_101592073 336
411 3300010375 Ga0105239_10162452 Ga0105239_101624522 336
412 3300013297 Ga0157378_10005014 Ga0157378_100050142 336
413 3300013297 Ga0157378_10352370 Ga0157378_103523703 336
414 3300013306 Ga0163162_10570158 Ga0163162_105701581 336
415 3300014325 Ga0163163_10222545 Ga0163163_102225452 336
416 3300014326 Ga0157380_10002170 Ga0157380_100021703 336
417 3300017792 Ga0163161_10099730 Ga0163161_100997302 336
418 3300021384 Ga0213876_10000144 Ga0213876_1000014445 336
419 3300021384 Ga0213876_10000303 Ga0213876_1000030315 336
420 3300025885 Ga0207653_10017501 Ga0207653_100175013 336
421 3300025905 Ga0207685_10000017 Ga0207685_1000001772 336
422 3300025907 Ga0207645_10139810 Ga0207645_101398101 336
423 3300025910 Ga0207684_10024833 Ga0207684_100248333 336
424 3300025910 Ga0207684_10081771 Ga0207684_100817713 336
425 3300025922 Ga0207646_10015763 Ga0207646_100157632 336
426 3300025933 Ga0207706_10131663 Ga0207706_101316633 336
427 3300025933 Ga0207706_10200465 Ga0207706_102004652 336
428 3300025934 Ga0207686_10000007 Ga0207686_1000000783 336
429 3300025935 Ga0207709_10000101 Ga0207709_1000010132 336
430 3300025939 Ga0207665_10000012 Ga0207665_1000001254 336
431 3300025942 Ga0207689_10146145 Ga0207689_101461452 336
432 3300025960 Ga0207651_10160508 Ga0207651_101605084 336
433 3300026035 Ga0207703_10104852 Ga0207703_101048522 336
434 3300026075 Ga0207708_10006980 Ga0207708_100069803 336
435 3300026089 Ga0207648_10182252 Ga0207648_101822522 336
436 3300026089 Ga0207648_10199787 Ga0207648_101997872 336
437 3300026095 Ga0207676_10028169 Ga0207676_100281691 336
438 3300026118 Ga0207675_100031432 Ga0207675_1000314322 336
439 3300027907 Ga0207428_10012011 Ga0207428_100120116 336
440 3300027907 Ga0207428_10167197 Ga0207428_101671972 336
441 3300028380 Ga0268265_10095955 Ga0268265_100959551 336
442 3300028381 Ga0268264_10240918 Ga0268264_102409182 336
443 3300032004 Ga0307414_10214839 Ga0307414_102148392 336
444 3300037471 Ga0395905_0011413 Ga0395905_0011413_1540_2553 336
445 3300039437 Ga0436365_0255646 Ga0436365_0255646_22228_23241 336
446 3300039437 Ga0436365_0854233 Ga0436365_0854233_32621_33634 336
447 3300046664 Ga0495659_0003199 Ga0495659_0003199_1069_2079 336
448 3300047471 Ga0495684_0064510 Ga0495684_0064510_579_1592 336
449 3300050507 nmdc:mga05p37_13879_c1 nmdc:mga05p37_13879_c1_38_1048 336
450 3300050507 nmdc:mga05p37_18129_c1 nmdc:mga05p37_18129_c1_2789_3802 336
451 3300050508 nmdc:mga09592_17778_c1 nmdc:mga09592_17778_c1_1179_2189 336
452 3300050511 nmdc:mga08y16_190958_c1 nmdc:mga08y16_190958_c1_1058_2068 336
453 3300050511 nmdc:mga08y16_81366_c1 nmdc:mga08y16_81366_c1_887_1900 336

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

2

227

0.97

PF03450

CO_deh_flav_C

CO dehydrogenase flavoprotein C-terminal domain

239

325

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zoh-assembly1.cif.gz_B-2 crystal structure of glyceraldehyde oxidoreductase 0.8498 3 329
7dqx-assembly1.cif.gz_E crystal structure of xanthine dehydrogenase family protein 0.8477 3 332
7dqx-assembly1.cif.gz_B crystal structure of xanthine dehydrogenase family protein 0.8462 3 332
1t3q-assembly1.cif.gz_F crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 0.8343 3 335
1zxi-assembly1.cif.gz_F reconstituted co dehydrogenase from oligotropha carboxidovorans 0.8301 2 336
ID Description Score Start End Superfamily
5y6qB02 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.9119 232 336 3.30.390.50
af_P77324_1_53_3.30.43.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9112 1 60 3.30.43.10
af_P77324_1_53_3.30.43.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.8957 1 60 3.30.43.10
af_Q46800_181_289_3.30.390.50 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.8952 235 334 3.30.390.50
5y6qB02 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.8878 232 336 3.30.390.50
ID Description Score Start End GO Terms
AF-A0A7W0WH07-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9565 234 334
AF-A0A8B3LK24-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9553 224 336
AF-A0A526YQC9-F1-model_v4 CO dehydrogenase flavoprotein C-terminal domain-containing protein 0.955 233 334
AF-A0A534RPU8-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.954 233 336
AF-A0A150UBQ3-F1-model_v4 FAD-binding molybdopterin dehydrogenase 0.954 243 335

Feature Viewer

pLDDT pTM Quality
76.36 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map