F447125

General Info

Members Datasets Scaffolds Average Seq Length
453 252 906 240

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100695219|Ga0070680_1006952191
Length 264
Sequence VDRSNDPAGGLRAVSSPPEFDLHFYFDPVCPFAWMTSKWVRMVAAQRDYRVDWRFISLRLLNADVDYASHFPPEYEDGHTAGLRLLRVAARVRSEHGRPAVGPLYSAIGGRIFDTPRDVDPLSASSLGPRGRLGEARRMLEPLLRDAGLPTDLADALDDAAFDDGIRAETEEALALTGRDVGTPILHFQPPGGTAFFGPVISRLPSADDAAPLWDHVIALAAFPGFAEIKRSLRERPQLVSFGIDTESVGKEEDWHGGSRRLKK

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
155 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
162 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
163 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
164 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
165 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
166 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
173 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
174 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
185 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
186 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
187 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
188 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
189 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
190 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
191 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
217 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
218 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
219 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
220 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
227 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
231 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
236 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
237 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
238 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
239 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
240 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
241 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
242 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
243 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
244 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
245 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
246 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
247 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
248 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
249 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
250 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
251 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
252 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.13
Metatranscriptomes 0.44
Isolates 2.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.06
Nodule 0
Rhizoplane 11.04
Rhizosphere 77.26
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100695219 3300005336 Bacteria 875
2 LJQas_1007464 3300000549 Bacteria 1344
3 Ga0070676_10025306 3300005328 Bacteria 3353
4 Ga0070683_100023197 3300005329 Bacteria 5549
5 Ga0070683_100126084 3300005329 Bacteria 2421
6 Ga0070690_100066642 3300005330 Bacteria 2331
7 Ga0070677_10144696 3300005333 Bacteria 1100
8 Ga0068869_100448385 3300005334 Bacteria 1069
9 Ga0070666_10229104 3300005335 Bacteria 1312
10 Ga0070666_10302972 3300005335 Bacteria 1138
11 Ga0070682_100115617 3300005337 Bacteria 1794
12 Ga0068868_100001223 3300005338 Bacteria 17643
13 Ga0068868_100006841 3300005338 Bacteria 8098
14 Ga0068868_100431922 3300005338 Bacteria 1142
15 Ga0070689_100032780 3300005340 Bacteria 3954
16 Ga0070691_10009126 3300005341 Bacteria 4534
17 Ga0070687_100241661 3300005343 Bacteria 1117
18 Ga0070692_10032070 3300005345 Bacteria 2639
19 Ga0070668_100000668 3300005347 Bacteria 23244
20 Ga0070668_100003548 3300005347 Bacteria 11507
21 Ga0070668_100394100 3300005347 Bacteria 1181
22 Ga0070669_100007008 3300005353 Bacteria 8101
23 Ga0070669_100302993 3300005353 Bacteria 1286
24 Ga0070671_100004655 3300005355 Bacteria 10880
25 Ga0070671_100100725 3300005355 Bacteria 2424
26 Ga0070671_100130552 3300005355 Bacteria 2116
27 Ga0070674_100000670 3300005356 Bacteria 17325
28 Ga0070673_100170531 3300005364 Bacteria 1857
29 Ga0070688_100111996 3300005365 Bacteria 1816
30 Ga0070688_100117043 3300005365 Bacteria 1780
31 Ga0070667_100000022 3300005367 Bacteria 204861
32 Ga0070667_100035614 3300005367 Bacteria 4171
33 Ga0070667_100098790 3300005367 Bacteria 2519
34 Ga0070667_100297343 3300005367 Bacteria 1453
35 Ga0070703_10117507 3300005406 Bacteria 960
36 Ga0070709_10041362 3300005434 Bacteria 2840
37 Ga0070709_10041815 3300005434 Bacteria 2826
38 Ga0070714_100250410 3300005435 Bacteria 1638
39 Ga0070710_10004825 3300005437 Bacteria 6377
40 Ga0070701_10019804 3300005438 Bacteria 3183
41 Ga0070711_100000314 3300005439 Bacteria 25098
42 Ga0070711_100017624 3300005439 Bacteria 4549
43 Ga0070705_100028759 3300005440 Bacteria 3048
44 Ga0070705_100065607 3300005440 Bacteria 2174
45 Ga0070700_100001750 3300005441 Bacteria 10914
46 Ga0070700_100329531 3300005441 Bacteria 1125
47 Ga0070694_100053128 3300005444 Bacteria 2741
48 Ga0070694_100253959 3300005444 Bacteria 1331
49 Ga0070663_100036819 3300005455 Bacteria 3401
50 Ga0070663_100078319 3300005455 Bacteria 2423
51 Ga0070678_100000573 3300005456 Bacteria 18054
52 Ga0070678_100050012 3300005456 Bacteria 3020
53 Ga0070681_10191960 3300005458 Bacteria 1962
54 Ga0068867_100000498 3300005459 Bacteria 26212
55 Ga0068867_100028621 3300005459 Bacteria 4012
56 Ga0070685_10020934 3300005466 Bacteria 3547
57 Ga0070679_100403084 3300005530 Bacteria 1313
58 Ga0068853_100002702 3300005539 Bacteria 13376
59 Ga0070695_100000790 3300005545 Bacteria 17051
60 Ga0070695_100021994 3300005545 Bacteria 3908
61 Ga0070696_100081194 3300005546 Bacteria 2297
62 Ga0070696_100437598 3300005546 Bacteria 1030
63 Ga0070693_100052951 3300005547 Bacteria 2328
64 Ga0070665_100073216 3300005548 Bacteria 3433
65 Ga0070704_100002466 3300005549 Bacteria 10390
66 Ga0070704_100063896 3300005549 Bacteria 2643
67 Ga0070704_100074700 3300005549 Bacteria 2473
68 Ga0068855_100099263 3300005563 Bacteria 3354
69 Ga0068855_100192727 3300005563 Bacteria 2298
70 Ga0068857_100652303 3300005577 Bacteria 997
71 Ga0068854_100000891 3300005578 Bacteria 17935
72 Ga0068854_100041307 3300005578 Bacteria 3258
73 Ga0068856_100068010 3300005614 Bacteria 3521
74 Ga0068856_100069711 3300005614 Bacteria 3477
75 Ga0068856_100511312 3300005614 Bacteria 1222
76 Ga0070702_100000125 3300005615 Bacteria 23573
77 Ga0070702_100077403 3300005615 Bacteria 1982
78 Ga0068859_100001103 3300005617 Bacteria 27518
79 Ga0068859_100008459 3300005617 Bacteria 10419
80 Ga0068864_100232839 3300005618 Bacteria 1704
81 Ga0068866_10005126 3300005718 Bacteria 5398
82 Ga0068866_10027301 3300005718 Bacteria 2705
83 Ga0068861_100004013 3300005719 Bacteria 9854
84 Ga0068863_100000141 3300005841 Bacteria 75574
85 Ga0068863_100514081 3300005841 Bacteria 1180
86 Ga0068858_100004199 3300005842 Bacteria 14180
87 Ga0068858_100016842 3300005842 Bacteria 6863
88 Ga0068860_100000038 3300005843 Bacteria 232936
89 Ga0068860_100001829 3300005843 Bacteria 22655
90 Ga0068860_100108041 3300005843 Bacteria 2659
91 Ga0068862_100000064 3300005844 Bacteria 124473
92 Ga0068862_100001560 3300005844 Bacteria 20916
93 Ga0068862_100375622 3300005844 Bacteria 1324
94 Ga0068862_100528052 3300005844 Bacteria 1124
95 Ga0075365_10013421 3300006038 Bacteria 4899
96 Ga0075365_10107493 3300006038 Bacteria 1916
97 Ga0075368_10057407 3300006042 Bacteria 1554
98 Ga0075363_100005063 3300006048 Bacteria 5828
99 Ga0075363_100069808 3300006048 Bacteria 1907
100 Ga0075363_100127838 3300006048 Bacteria 1424
101 Ga0075363_100186104 3300006048 Bacteria 1183
102 Ga0075364_10031536 3300006051 Bacteria 3405
103 Ga0070715_10023479 3300006163 Bacteria 2417
104 Ga0070715_10027762 3300006163 Bacteria 2264
105 Ga0070716_100003886 3300006173 Bacteria 7091
106 Ga0070712_100081606 3300006175 Bacteria 2343
107 Ga0075362_10014376 3300006177 Bacteria 3193
108 Ga0075362_10020823 3300006177 Bacteria 2744
109 Ga0075369_10028435 3300006186 Bacteria 2343
110 Ga0097621_100101631 3300006237 Bacteria 2419
111 Ga0075370_10007486 3300006353 Bacteria 5565
112 Ga0068871_100124134 3300006358 Bacteria 2184
113 Ga0068871_100190596 3300006358 Bacteria 1766
114 Ga0075428_100101283 3300006844 Bacteria 3140
115 Ga0068865_100000861 3300006881 Bacteria 17226
116 Ga0068865_100051664 3300006881 Bacteria 2846
117 Ga0068865_100079839 3300006881 Bacteria 2344
118 Ga0097620_100001103 3300006931 Bacteria 27518
119 Ga0097620_100008459 3300006931 Bacteria 10419
120 Ga0099795_10049314 3300007788 Bacteria 1528
121 Ga0105250_10055958 3300009092 Bacteria 1583
122 Ga0105250_10164692 3300009092 Bacteria 926
123 Ga0105245_10005820 3300009098 Bacteria 10820
124 Ga0105245_10157631 3300009098 Bacteria 2151
125 Ga0105247_10000021 3300009101 Bacteria 229443
126 Ga0105247_10006766 3300009101 Bacteria 7072
127 Ga0114129_10230541 3300009147 Bacteria 2494
128 Ga0105243_10007672 3300009148 Bacteria 8289
129 Ga0105243_10270834 3300009148 Bacteria 1525
130 Ga0105243_10557224 3300009148 Bacteria 1096
131 Ga0105241_10046942 3300009174 Bacteria 3282
132 Ga0105242_10001151 3300009176 Bacteria 20832
133 Ga0105242_10303525 3300009176 Bacteria 1458
134 Ga0105248_10000141 3300009177 Bacteria 82929
135 Ga0105248_10014177 3300009177 Bacteria 8775
136 Ga0105248_10041187 3300009177 Bacteria 5178
137 Ga0105237_10007916 3300009545 Bacteria 11582
138 Ga0105238_10049395 3300009551 Bacteria 4237
139 Ga0105238_10475451 3300009551 Bacteria 1248
140 Ga0105249_10000060 3300009553 Bacteria 153462
141 Ga0105249_10013183 3300009553 Bacteria 7294
142 Ga0105249_10100746 3300009553 Bacteria 2716
143 Ga0105249_10117770 3300009553 Bacteria 2520
144 Ga0105249_10228067 3300009553 Bacteria 1836
145 Ga0099796_10021990 3300010159 Bacteria 1972
146 Ga0105239_10001194 3300010375 Bacteria 35507
147 Ga0105239_10019191 3300010375 Bacteria 7552
148 Ga0105239_10123145 3300010375 Bacteria 2881
149 Ga0105246_10071028 3300011119 Bacteria 2450
150 Ga0157374_10046311 3300013296 Bacteria 4027
151 Ga0157374_10510651 3300013296 Bacteria 1207
152 Ga0157378_10019709 3300013297 Bacteria 5931
153 Ga0157378_10191555 3300013297 Bacteria 1929
154 Ga0163162_10006909 3300013306 Bacteria 11007
155 Ga0163162_10007550 3300013306 Bacteria 10590
156 Ga0163162_10237972 3300013306 Bacteria 1951
157 Ga0157372_10006040 3300013307 Bacteria 12867
158 Ga0157372_11022718 3300013307 Bacteria 957
159 Ga0157375_10014110 3300013308 Bacteria 7125
160 Ga0157375_10094534 3300013308 Bacteria 3058
161 Ga0157375_10141814 3300013308 Bacteria 2530
162 Ga0163163_10020671 3300014325 Bacteria 6204
163 Ga0163163_10264690 3300014325 Bacteria 1770
164 Ga0157380_10004610 3300014326 Bacteria 9573
165 Ga0157380_10224338 3300014326 Bacteria 1683
166 Ga0182008_10189319 3300014497 Bacteria 1044
167 Ga0157377_10180876 3300014745 Bacteria 1326
168 Ga0157379_10054029 3300014968 Bacteria 3589
169 Ga0157379_10229457 3300014968 Bacteria 1683
170 Ga0157379_10298212 3300014968 Bacteria 1469
171 Ga0157376_10144790 3300014969 Bacteria 2136
172 Ga0163161_10003677 3300017792 Bacteria 10756
173 Ga0163161_10071532 3300017792 Bacteria 2538
174 Ga0206353_11551927 3300020082 Bacteria 1573
175 Ga0206353_11581302 3300020082 Bacteria 1185
176 Ga0207653_10098009 3300025885 Bacteria 1034
177 Ga0207692_10001050 3300025898 Bacteria 10096
178 Ga0207642_10019925 3300025899 Bacteria 2608
179 Ga0207642_10216622 3300025899 Bacteria 1067
180 Ga0207710_10000027 3300025900 Bacteria 307001
181 Ga0207710_10007991 3300025900 Bacteria 4472
182 Ga0207688_10001427 3300025901 Bacteria 12464
183 Ga0207688_10013926 3300025901 Bacteria 4372
184 Ga0207688_10149124 3300025901 Bacteria 1380
185 Ga0207680_10006959 3300025903 Bacteria 5487
186 Ga0207680_10254141 3300025903 Bacteria 1215
187 Ga0207647_10144367 3300025904 Bacteria 1394
188 Ga0207685_10001415 3300025905 Bacteria 5007
189 Ga0207699_10016435 3300025906 Bacteria 3872
190 Ga0207695_10613427 3300025913 Bacteria 969
191 Ga0207671_10017190 3300025914 Bacteria 5587
192 Ga0207693_10000698 3300025915 Bacteria 30147
193 Ga0207693_10004121 3300025915 Bacteria 12340
194 Ga0207663_10001329 3300025916 Bacteria 11434
195 Ga0207662_10119071 3300025918 Bacteria 1654
196 Ga0207652_10193483 3300025921 Bacteria 1829
197 Ga0207681_10000514 3300025923 Bacteria 26878
198 Ga0207650_10059990 3300025925 Bacteria 2838
199 Ga0207659_10097819 3300025926 Bacteria 2205
200 Ga0207687_10004034 3300025927 Bacteria 9835
201 Ga0207687_10037105 3300025927 Bacteria 3323
202 Ga0207687_10074433 3300025927 Bacteria 2434
203 Ga0207644_10079177 3300025931 Bacteria 2424
204 Ga0207690_10034042 3300025932 Bacteria 3280
205 Ga0207690_10650904 3300025932 Bacteria 863
206 Ga0207706_10069770 3300025933 Bacteria 3091
207 Ga0207706_10124411 3300025933 Bacteria 2269
208 Ga0207686_10133006 3300025934 Bacteria 1708
209 Ga0207709_10003375 3300025935 Bacteria 9536
210 Ga0207670_10060258 3300025936 Bacteria 2585
211 Ga0207669_10006430 3300025937 Bacteria 5369
212 Ga0207669_10154496 3300025937 Bacteria 1612
213 Ga0207704_10000279 3300025938 Bacteria 24450
214 Ga0207704_10152095 3300025938 Bacteria 1634
215 Ga0207704_10169874 3300025938 Bacteria 1563
216 Ga0207704_10492823 3300025938 Bacteria 986
217 Ga0207665_10007190 3300025939 Bacteria 7366
218 Ga0207665_10019560 3300025939 Bacteria 4452
219 Ga0207711_10000636 3300025941 Bacteria 35192
220 Ga0207711_10038627 3300025941 Bacteria 4060
221 Ga0207711_10056465 3300025941 Bacteria 3374
222 Ga0207689_10075009 3300025942 Bacteria 2780
223 Ga0207661_10107271 3300025944 Bacteria 2356
224 Ga0207661_10114805 3300025944 Bacteria 2284
225 Ga0207661_10283471 3300025944 Bacteria 1481
226 Ga0207667_10107090 3300025949 Bacteria 2883
227 Ga0207667_10146790 3300025949 Bacteria 2428
228 Ga0207712_10000051 3300025961 Bacteria 153466
229 Ga0207712_10003208 3300025961 Bacteria 10395
230 Ga0207668_10000917 3300025972 Bacteria 17754
231 Ga0207668_10001144 3300025972 Bacteria 15788
232 Ga0207640_10008756 3300025981 Bacteria 5632
233 Ga0207640_10033813 3300025981 Bacteria 3184
234 Ga0207658_10000070 3300025986 Bacteria 113173
235 Ga0207658_10028503 3300025986 Bacteria 3932
236 Ga0207658_10084690 3300025986 Bacteria 2440
237 Ga0207658_10667997 3300025986 Bacteria 937
238 Ga0207677_10017261 3300026023 Bacteria 4298
239 Ga0207677_10152639 3300026023 Bacteria 1784
240 Ga0207703_10049501 3300026035 Bacteria 3397
241 Ga0207703_10253878 3300026035 Bacteria 1586
242 Ga0207639_10017157 3300026041 Bacteria 5130
243 Ga0207678_10022201 3300026067 Bacteria 5561
244 Ga0207678_10385123 3300026067 Bacteria 1212
245 Ga0207708_10003268 3300026075 Bacteria 11950
246 Ga0207708_10080582 3300026075 Bacteria 2501
247 Ga0207641_10000162 3300026088 Bacteria 94111
248 Ga0207641_10522984 3300026088 Bacteria 1154
249 Ga0207648_10006557 3300026089 Bacteria 11560
250 Ga0207676_10202215 3300026095 Bacteria 1756
251 Ga0207674_10112809 3300026116 Bacteria 2692
252 Ga0207675_100001052 3300026118 Bacteria 27348
253 Ga0207675_100092177 3300026118 Bacteria 2849
254 Ga0207675_101067072 3300026118 Bacteria 827
255 Ga0207683_10001365 3300026121 Bacteria 22077
256 Ga0207683_10053782 3300026121 Bacteria 3531
257 Ga0207683_10165487 3300026121 Bacteria 2001
258 Ga0207683_10677055 3300026121 Bacteria 956
259 Ga0268266_10125064 3300028379 Bacteria 2293
260 Ga0268266_10304713 3300028379 Bacteria 1487
261 Ga0268265_10000028 3300028380 Bacteria 236467
262 Ga0268265_10049741 3300028380 Bacteria 3154
263 Ga0268265_10520618 3300028380 Bacteria 1124
264 Ga0268264_10000092 3300028381 Bacteria 232950
265 Ga0268264_10006370 3300028381 Bacteria 9948
266 Ga0307413_10033979 3300031824 Bacteria 2910
267 Ga0307407_10198449 3300031903 Bacteria 1343
268 Ga0307409_100019542 3300031995 Bacteria 4590
269 Ga0307409_100084310 3300031995 Bacteria 2580
270 Ga0307409_100119086 3300031995 Bacteria 2232
271 Ga0307409_100396818 3300031995 Bacteria 1316
272 Ga0307416_100012227 3300032002 Bacteria 5770
273 Ga0307416_100027719 3300032002 Bacteria 4200
274 Ga0307416_100138170 3300032002 Bacteria 2209
275 Ga0307416_100483621 3300032002 Bacteria 1299
276 Ga0307415_100001465 3300032126 Bacteria 11304
277 Ga0316583_10034476 3300032133 Bacteria 1796
278 Ga0373951_0010229 3300035091 Bacteria 2106
279 Ga0373939_0022327 3300035114 Bacteria 1743
280 Ga0373939_0175484 3300035114 Bacteria 796
281 Ga0373942_0025760 3300035207 Bacteria 1518
282 Ga0373931_0010264 3300035691 Bacteria 4499
283 Ga0373931_0075260 3300035691 Bacteria 1851
284 Ga0373925_0000515 3300037068 Bacteria 38779
285 Ga0373925_0041343 3300037068 Bacteria 3417
286 Ga0395899_0001373 3300037312 Bacteria 20884
287 Ga0439439_0079131 3300041406 Bacteria 887
288 Ga0439465_0009928 3300041413 Bacteria 2997
289 Ga0439465_0016695 3300041413 Bacteria 2290
290 Ga0439431_0021118 3300041997 Bacteria 1561
291 Ga0439431_0062213 3300041997 Bacteria 984
292 Ga0439442_023700 3300042002 Bacteria 1276
293 Ga0439452_042782 3300042010 Bacteria 1060
294 Ga0439459_0009738 3300042438 Bacteria 1664
295 Ga0466972_0026839 3300044658 Bacteria 2853
296 Ga0466972_0026921 3300044658 Bacteria 2848
297 Ga0466972_0135134 3300044658 Bacteria 1161
298 Ga0466965_0005457 3300044683 Bacteria 5733
299 Ga0466966_0020697 3300044684 Bacteria 4323
300 Ga0466966_0045653 3300044684 Bacteria 2800
301 Ga0466966_0326326 3300044684 Bacteria 922
302 Ga0466961_0055388 3300044693 Bacteria 2528
303 Ga0466963_0046433 3300044694 Bacteria 2864
304 Ga0466963_0192342 3300044694 Bacteria 1425
305 Ga0466963_0223182 3300044694 Bacteria 1320
306 Ga0466963_0255565 3300044694 Bacteria 1230
307 Ga0466964_0017760 3300044706 Bacteria 2725
308 Ga0466964_0230464 3300044706 Bacteria 904
309 Ga0466971_0029425 3300044719 Bacteria 2457
310 Ga0466970_0024024 3300044765 Bacteria 3186
311 Ga0466957_0078210 3300044842 Bacteria 2056
312 Ga0466957_0170007 3300044842 Bacteria 1419
313 Ga0466957_0172089 3300044842 Bacteria 1411
314 Ga0466957_0380648 3300044842 Bacteria 962
315 Ga0466960_0012491 3300044901 Bacteria 3585
316 Ga0466960_0052608 3300044901 Bacteria 1971
317 Ga0466960_0154496 3300044901 Bacteria 1228
318 Ga0466959_0070895 3300045049 Bacteria 2524
319 Ga0466959_0175885 3300045049 Bacteria 1499
320 Ga0466958_0035562 3300045836 Bacteria 2976
321 Ga0466958_0218966 3300045836 Bacteria 1214
322 Ga0466958_0303858 3300045836 Bacteria 1024
323 Ga0466967_0009366 3300045976 Bacteria 7261
324 Ga0466967_0047441 3300045976 Bacteria 3745
325 Ga0495592_0028594 3300046454 Bacteria 4221
326 Ga0495590_0114530 3300046457 Bacteria 964
327 Ga0495629_0139906 3300046459 Bacteria 1684
328 Ga0495638_0014169 3300046460 Bacteria 5398
329 Ga0495641_0159200 3300046461 Bacteria 1010
330 Ga0495650_0012693 3300046471 Bacteria 4514
331 Ga0495584_0386895 3300046491 Bacteria 711
332 Ga0495583_0027169 3300046506 Bacteria 2827
333 Ga0495648_0007578 3300046524 Bacteria 8670
334 Ga0495654_0140620 3300046530 Bacteria 1076
335 Ga0495665_0149026 3300046531 Bacteria 1221
336 Ga0495640_0182131 3300046533 Bacteria 1338
337 Ga0495668_0126960 3300046616 Bacteria 1396
338 Ga0495668_0269878 3300046616 Bacteria 932
339 Ga0495611_0136542 3300046648 Bacteria 1145
340 Ga0495588_0216601 3300046674 Bacteria 1011
341 Ga0495658_0351167 3300046683 Bacteria 937
342 Ga0495613_0265045 3300046689 Bacteria 1196
343 Ga0495624_0342131 3300046690 Bacteria 900
344 Ga0495649_0225637 3300046694 Bacteria 968
345 Ga0495581_0187061 3300047315 Bacteria 1211
346 Ga0495672_0025201 3300047320 Bacteria 3813
347 Ga0495672_0167449 3300047320 Bacteria 1124
348 Ga0495673_0000867 3300047469 Bacteria 28018
349 Ga0496100_0000369 3300048903 Bacteria 21896
350 Ga0496100_0004153 3300048903 Bacteria 7639
351 Ga0496100_0009912 3300048903 Bacteria 5372
352 Ga0496100_0014002 3300048903 Bacteria 4645
353 Ga0496101_0000037 3300048904 Bacteria 166198
354 Ga0496101_0000155 3300048904 Bacteria 58347
355 Ga0496101_0002507 3300048904 Bacteria 11283
356 Ga0496101_0142014 3300048904 Bacteria 1831
357 Ga0496102_0000083 3300048905 Bacteria 138102
358 Ga0496102_0001513 3300048905 Bacteria 20513
359 Ga0496102_0006522 3300048905 Bacteria 9955
360 Ga0496102_0079763 3300048905 Bacteria 3015
361 Ga0496102_0149464 3300048905 Bacteria 2194
362 Ga0496102_0388409 3300048905 Bacteria 1313
363 Ga0496103_0000060 3300048906 Bacteria 138526
364 Ga0496103_0002754 3300048906 Bacteria 10958
365 Ga0496103_0003146 3300048906 Bacteria 10142
366 Ga0496104_0010542 3300048907 Bacteria 8253
367 Ga0496104_0151709 3300048907 Bacteria 2224
368 Ga0496105_0002962 3300048908 Bacteria 12463
369 Ga0496105_0447546 3300048908 Bacteria 1020
370 Ga0496106_0003043 3300048909 Bacteria 12492
371 Ga0496106_0006966 3300048909 Bacteria 8357
372 Ga0496106_0012327 3300048909 Bacteria 6309
373 Ga0496106_0100478 3300048909 Bacteria 2243
374 Ga0496107_0001655 3300048910 Bacteria 13925
375 Ga0496107_0008525 3300048910 Bacteria 7096
376 Ga0496107_0032009 3300048910 Bacteria 3757
377 Ga0496107_0073059 3300048910 Bacteria 2494
378 Ga0496107_0242401 3300048910 Bacteria 1341
379 Ga0496108_0005182 3300048911 Bacteria 10530
380 Ga0496108_0052405 3300048911 Bacteria 3419
381 Ga0496108_0149116 3300048911 Bacteria 2018
382 Ga0496108_0167081 3300048911 Bacteria 1903
383 Ga0496108_0706883 3300048911 Bacteria 874
384 Ga0496109_0012186 3300048912 Bacteria 7418
385 Ga0496109_0013047 3300048912 Bacteria 7187
386 Ga0496109_0726130 3300048912 Bacteria 931
387 Ga0496112_0004227 3300048915 Bacteria 12117
388 Ga0496112_0016825 3300048915 Bacteria 6861
389 Ga0496112_0076272 3300048915 Bacteria 3316
390 Ga0496112_0240547 3300048915 Bacteria 1763
391 Ga0496113_0448683 3300048916 Bacteria 1036
392 Ga0496114_0002622 3300048917 Bacteria 13723
393 Ga0496114_0012397 3300048917 Bacteria 6823
394 Ga0496114_0078195 3300048917 Bacteria 2791
395 Ga0496114_0393584 3300048917 Bacteria 1227
396 Ga0496115_0003099 3300048918 Bacteria 11941
397 Ga0496115_0007064 3300048918 Bacteria 8248
398 Ga0496115_0841902 3300048918 Bacteria 711
399 Ga0496116_0000159 3300048919 Bacteria 138102
400 Ga0496116_0017466 3300048919 Bacteria 5566
401 Ga0496117_0000167 3300048920 Bacteria 138102
402 Ga0496117_0010422 3300048920 Bacteria 8477
403 Ga0496118_0000121 3300048921 Bacteria 138102
404 Ga0496118_0001713 3300048921 Bacteria 31982
405 Ga0496119_0007537 3300048922 Bacteria 9778
406 Ga0496119_0034420 3300048922 Bacteria 3336
407 Ga0496120_0009204 3300048923 Bacteria 7038
408 Ga0496120_0033542 3300048923 Bacteria 3083
409 Ga0496121_0000690 3300048924 Bacteria 62907
410 Ga0496121_0002665 3300048924 Bacteria 26757
411 Ga0496125_0203652 3300048928 Bacteria 1292
412 Ga0496126_0000146 3300048929 Bacteria 163476
413 Ga0496126_0002739 3300048929 Bacteria 23276
414 Ga0496126_0003503 3300048929 Bacteria 19786
415 Ga0501067_0251824 3300049583 Bacteria 983
416 Ga0501070_0273170 3300049586 Bacteria 1380
417 nmdc:mga03683_29558_c1 3300050489 Bacteria 2186
418 nmdc:mga03n38_32214_c1 3300050490 Bacteria 2219
419 nmdc:mga03n38_92023_c1 3300050490 Bacteria 1446
420 nmdc:mga00v17_26788_c1 3300050491 Bacteria 3362
421 nmdc:mga00v17_46606_c1 3300050491 Bacteria 2623
422 nmdc:mga0yw44_77787_c1 3300050492 Bacteria 2073
423 nmdc:mga06z11_10243_c1 3300050494 Bacteria 3983
424 nmdc:mga07m45_12473_c1 3300050496 Bacteria 4493
425 nmdc:mga07m45_128295_c1 3300050496 Bacteria 1467
426 nmdc:mga07m45_24163_c1 3300050496 Bacteria 3327
427 nmdc:mga07m45_29068_c1 3300050496 Bacteria 3054
428 nmdc:mga05p37_47407_c2 3300050507 Bacteria 2222
429 nmdc:mga0qj67_214455_c1 3300050509 Bacteria 1563
430 nmdc:mga06r32_93167_c1 3300050510 Bacteria 2946
431 nmdc:mga0sz30_10822_c1 3300050516 Bacteria 3505
432 nmdc:mga0sz30_41992_c1 3300050516 Bacteria 1923
433 nmdc:mga0sz30_85631_c1 3300050516 Bacteria 1367
434 Ga0495655_0016012 3300053083 Bacteria 1606
435 Ga0500643_010166 3300053087 Bacteria 3529
436 Ga0500643_078657 3300053087 Bacteria 908
437 Ga0500646_0024263 3300053090 Bacteria 1632
438 Ga0500616_0024637 3300053153 Bacteria 3341
439 Ga0500616_0146117 3300053153 Bacteria 1100
440 Ga0500633_0113943 3300053160 Bacteria 1003
441 Ga0466962_0017235 3300061719 Bacteria 3480
442 Ga0466962_0127585 3300061719 Bacteria 1229
443 2523383773 2523231044 Bacteria 6434991
444 2558907930 2558860112 Bacteria 9931328
445 2623498033 2622736605 Bacteria 4992138
446 2795787195 2795385470 Bacteria 8317180
447 2816504455 2816332139 Bacteria 9138787
448 2819693239 2818991462 Bacteria 4320267
449 2880502502 2880495981 Bacteria 7340502
450 2902795697 2902792274 Bacteria 7270173
451 2905928529 2905926851 Bacteria 4423176
452 2917736305 2917736166 Bacteria 9690793
453 8054478835 8054472261 Bacteria 7464355
454 Ga0070680_100695219
455 LJQas_1007464
456 Ga0070676_10025306
457 Ga0070683_100023197
458 Ga0070683_100126084
459 Ga0070690_100066642
460 Ga0070677_10144696
461 Ga0068869_100448385
462 Ga0070666_10229104
463 Ga0070666_10302972
464 Ga0070682_100115617
465 Ga0068868_100001223
466 Ga0068868_100006841
467 Ga0068868_100431922
468 Ga0070689_100032780
469 Ga0070691_10009126
470 Ga0070687_100241661
471 Ga0070692_10032070
472 Ga0070668_100000668
473 Ga0070668_100003548
474 Ga0070668_100394100
475 Ga0070669_100007008
476 Ga0070669_100302993
477 Ga0070671_100004655
478 Ga0070671_100100725
479 Ga0070671_100130552
480 Ga0070674_100000670
481 Ga0070673_100170531
482 Ga0070688_100111996
483 Ga0070688_100117043
484 Ga0070667_100000022
485 Ga0070667_100035614
486 Ga0070667_100098790
487 Ga0070667_100297343
488 Ga0070703_10117507
489 Ga0070709_10041362
490 Ga0070709_10041815
491 Ga0070714_100250410
492 Ga0070710_10004825
493 Ga0070701_10019804
494 Ga0070711_100000314
495 Ga0070711_100017624
496 Ga0070705_100028759
497 Ga0070705_100065607
498 Ga0070700_100001750
499 Ga0070700_100329531
500 Ga0070694_100053128
501 Ga0070694_100253959
502 Ga0070663_100036819
503 Ga0070663_100078319
504 Ga0070678_100000573
505 Ga0070678_100050012
506 Ga0070681_10191960
507 Ga0068867_100000498
508 Ga0068867_100028621
509 Ga0070685_10020934
510 Ga0070679_100403084
511 Ga0068853_100002702
512 Ga0070695_100000790
513 Ga0070695_100021994
514 Ga0070696_100081194
515 Ga0070696_100437598
516 Ga0070693_100052951
517 Ga0070665_100073216
518 Ga0070704_100002466
519 Ga0070704_100063896
520 Ga0070704_100074700
521 Ga0068855_100099263
522 Ga0068855_100192727
523 Ga0068857_100652303
524 Ga0068854_100000891
525 Ga0068854_100041307
526 Ga0068856_100068010
527 Ga0068856_100069711
528 Ga0068856_100511312
529 Ga0070702_100000125
530 Ga0070702_100077403
531 Ga0068859_100001103
532 Ga0068859_100008459
533 Ga0068864_100232839
534 Ga0068866_10005126
535 Ga0068866_10027301
536 Ga0068861_100004013
537 Ga0068863_100000141
538 Ga0068863_100514081
539 Ga0068858_100004199
540 Ga0068858_100016842
541 Ga0068860_100000038
542 Ga0068860_100001829
543 Ga0068860_100108041
544 Ga0068862_100000064
545 Ga0068862_100001560
546 Ga0068862_100375622
547 Ga0068862_100528052
548 Ga0075365_10013421
549 Ga0075365_10107493
550 Ga0075368_10057407
551 Ga0075363_100005063
552 Ga0075363_100069808
553 Ga0075363_100127838
554 Ga0075363_100186104
555 Ga0075364_10031536
556 Ga0070715_10023479
557 Ga0070715_10027762
558 Ga0070716_100003886
559 Ga0070712_100081606
560 Ga0075362_10014376
561 Ga0075362_10020823
562 Ga0075369_10028435
563 Ga0097621_100101631
564 Ga0075370_10007486
565 Ga0068871_100124134
566 Ga0068871_100190596
567 Ga0075428_100101283
568 Ga0068865_100000861
569 Ga0068865_100051664
570 Ga0068865_100079839
571 Ga0097620_100001103
572 Ga0097620_100008459
573 Ga0099795_10049314
574 Ga0105250_10055958
575 Ga0105250_10164692
576 Ga0105245_10005820
577 Ga0105245_10157631
578 Ga0105247_10000021
579 Ga0105247_10006766
580 Ga0114129_10230541
581 Ga0105243_10007672
582 Ga0105243_10270834
583 Ga0105243_10557224
584 Ga0105241_10046942
585 Ga0105242_10001151
586 Ga0105242_10303525
587 Ga0105248_10000141
588 Ga0105248_10014177
589 Ga0105248_10041187
590 Ga0105237_10007916
591 Ga0105238_10049395
592 Ga0105238_10475451
593 Ga0105249_10000060
594 Ga0105249_10013183
595 Ga0105249_10100746
596 Ga0105249_10117770
597 Ga0105249_10228067
598 Ga0099796_10021990
599 Ga0105239_10001194
600 Ga0105239_10019191
601 Ga0105239_10123145
602 Ga0105246_10071028
603 Ga0157374_10046311
604 Ga0157374_10510651
605 Ga0157378_10019709
606 Ga0157378_10191555
607 Ga0163162_10006909
608 Ga0163162_10007550
609 Ga0163162_10237972
610 Ga0157372_10006040
611 Ga0157372_11022718
612 Ga0157375_10014110
613 Ga0157375_10094534
614 Ga0157375_10141814
615 Ga0163163_10020671
616 Ga0163163_10264690
617 Ga0157380_10004610
618 Ga0157380_10224338
619 Ga0182008_10189319
620 Ga0157377_10180876
621 Ga0157379_10054029
622 Ga0157379_10229457
623 Ga0157379_10298212
624 Ga0157376_10144790
625 Ga0163161_10003677
626 Ga0163161_10071532
627 Ga0206353_11551927
628 Ga0206353_11581302
629 Ga0207653_10098009
630 Ga0207692_10001050
631 Ga0207642_10019925
632 Ga0207642_10216622
633 Ga0207710_10000027
634 Ga0207710_10007991
635 Ga0207688_10001427
636 Ga0207688_10013926
637 Ga0207688_10149124
638 Ga0207680_10006959
639 Ga0207680_10254141
640 Ga0207647_10144367
641 Ga0207685_10001415
642 Ga0207699_10016435
643 Ga0207695_10613427
644 Ga0207671_10017190
645 Ga0207693_10000698
646 Ga0207693_10004121
647 Ga0207663_10001329
648 Ga0207662_10119071
649 Ga0207652_10193483
650 Ga0207681_10000514
651 Ga0207650_10059990
652 Ga0207659_10097819
653 Ga0207687_10004034
654 Ga0207687_10037105
655 Ga0207687_10074433
656 Ga0207644_10079177
657 Ga0207690_10034042
658 Ga0207690_10650904
659 Ga0207706_10069770
660 Ga0207706_10124411
661 Ga0207686_10133006
662 Ga0207709_10003375
663 Ga0207670_10060258
664 Ga0207669_10006430
665 Ga0207669_10154496
666 Ga0207704_10000279
667 Ga0207704_10152095
668 Ga0207704_10169874
669 Ga0207704_10492823
670 Ga0207665_10007190
671 Ga0207665_10019560
672 Ga0207711_10000636
673 Ga0207711_10038627
674 Ga0207711_10056465
675 Ga0207689_10075009
676 Ga0207661_10107271
677 Ga0207661_10114805
678 Ga0207661_10283471
679 Ga0207667_10107090
680 Ga0207667_10146790
681 Ga0207712_10000051
682 Ga0207712_10003208
683 Ga0207668_10000917
684 Ga0207668_10001144
685 Ga0207640_10008756
686 Ga0207640_10033813
687 Ga0207658_10000070
688 Ga0207658_10028503
689 Ga0207658_10084690
690 Ga0207658_10667997
691 Ga0207677_10017261
692 Ga0207677_10152639
693 Ga0207703_10049501
694 Ga0207703_10253878
695 Ga0207639_10017157
696 Ga0207678_10022201
697 Ga0207678_10385123
698 Ga0207708_10003268
699 Ga0207708_10080582
700 Ga0207641_10000162
701 Ga0207641_10522984
702 Ga0207648_10006557
703 Ga0207676_10202215
704 Ga0207674_10112809
705 Ga0207675_100001052
706 Ga0207675_100092177
707 Ga0207675_101067072
708 Ga0207683_10001365
709 Ga0207683_10053782
710 Ga0207683_10165487
711 Ga0207683_10677055
712 Ga0268266_10125064
713 Ga0268266_10304713
714 Ga0268265_10000028
715 Ga0268265_10049741
716 Ga0268265_10520618
717 Ga0268264_10000092
718 Ga0268264_10006370
719 Ga0307413_10033979
720 Ga0307407_10198449
721 Ga0307409_100019542
722 Ga0307409_100084310
723 Ga0307409_100119086
724 Ga0307409_100396818
725 Ga0307416_100012227
726 Ga0307416_100027719
727 Ga0307416_100138170
728 Ga0307416_100483621
729 Ga0307415_100001465
730 Ga0316583_10034476
731 Ga0373951_0010229
732 Ga0373939_0022327
733 Ga0373939_0175484
734 Ga0373942_0025760
735 Ga0373931_0010264
736 Ga0373931_0075260
737 Ga0373925_0000515
738 Ga0373925_0041343
739 Ga0395899_0001373
740 Ga0439439_0079131
741 Ga0439465_0009928
742 Ga0439465_0016695
743 Ga0439431_0021118
744 Ga0439431_0062213
745 Ga0439442_023700
746 Ga0439452_042782
747 Ga0439459_0009738
748 Ga0466972_0026839
749 Ga0466972_0026921
750 Ga0466972_0135134
751 Ga0466965_0005457
752 Ga0466966_0020697
753 Ga0466966_0045653
754 Ga0466966_0326326
755 Ga0466961_0055388
756 Ga0466963_0046433
757 Ga0466963_0192342
758 Ga0466963_0223182
759 Ga0466963_0255565
760 Ga0466964_0017760
761 Ga0466964_0230464
762 Ga0466971_0029425
763 Ga0466970_0024024
764 Ga0466957_0078210
765 Ga0466957_0170007
766 Ga0466957_0172089
767 Ga0466957_0380648
768 Ga0466960_0012491
769 Ga0466960_0052608
770 Ga0466960_0154496
771 Ga0466959_0070895
772 Ga0466959_0175885
773 Ga0466958_0035562
774 Ga0466958_0218966
775 Ga0466958_0303858
776 Ga0466967_0009366
777 Ga0466967_0047441
778 Ga0495592_0028594
779 Ga0495590_0114530
780 Ga0495629_0139906
781 Ga0495638_0014169
782 Ga0495641_0159200
783 Ga0495650_0012693
784 Ga0495584_0386895
785 Ga0495583_0027169
786 Ga0495648_0007578
787 Ga0495654_0140620
788 Ga0495665_0149026
789 Ga0495640_0182131
790 Ga0495668_0126960
791 Ga0495668_0269878
792 Ga0495611_0136542
793 Ga0495588_0216601
794 Ga0495658_0351167
795 Ga0495613_0265045
796 Ga0495624_0342131
797 Ga0495649_0225637
798 Ga0495581_0187061
799 Ga0495672_0025201
800 Ga0495672_0167449
801 Ga0495673_0000867
802 Ga0496100_0000369
803 Ga0496100_0004153
804 Ga0496100_0009912
805 Ga0496100_0014002
806 Ga0496101_0000037
807 Ga0496101_0000155
808 Ga0496101_0002507
809 Ga0496101_0142014
810 Ga0496102_0000083
811 Ga0496102_0001513
812 Ga0496102_0006522
813 Ga0496102_0079763
814 Ga0496102_0149464
815 Ga0496102_0388409
816 Ga0496103_0000060
817 Ga0496103_0002754
818 Ga0496103_0003146
819 Ga0496104_0010542
820 Ga0496104_0151709
821 Ga0496105_0002962
822 Ga0496105_0447546
823 Ga0496106_0003043
824 Ga0496106_0006966
825 Ga0496106_0012327
826 Ga0496106_0100478
827 Ga0496107_0001655
828 Ga0496107_0008525
829 Ga0496107_0032009
830 Ga0496107_0073059
831 Ga0496107_0242401
832 Ga0496108_0005182
833 Ga0496108_0052405
834 Ga0496108_0149116
835 Ga0496108_0167081
836 Ga0496108_0706883
837 Ga0496109_0012186
838 Ga0496109_0013047
839 Ga0496109_0726130
840 Ga0496112_0004227
841 Ga0496112_0016825
842 Ga0496112_0076272
843 Ga0496112_0240547
844 Ga0496113_0448683
845 Ga0496114_0002622
846 Ga0496114_0012397
847 Ga0496114_0078195
848 Ga0496114_0393584
849 Ga0496115_0003099
850 Ga0496115_0007064
851 Ga0496115_0841902
852 Ga0496116_0000159
853 Ga0496116_0017466
854 Ga0496117_0000167
855 Ga0496117_0010422
856 Ga0496118_0000121
857 Ga0496118_0001713
858 Ga0496119_0007537
859 Ga0496119_0034420
860 Ga0496120_0009204
861 Ga0496120_0033542
862 Ga0496121_0000690
863 Ga0496121_0002665
864 Ga0496125_0203652
865 Ga0496126_0000146
866 Ga0496126_0002739
867 Ga0496126_0003503
868 Ga0501067_0251824
869 Ga0501070_0273170
870 nmdc:mga03683_29558_c1
871 nmdc:mga03n38_32214_c1
872 nmdc:mga03n38_92023_c1
873 nmdc:mga00v17_26788_c1
874 nmdc:mga00v17_46606_c1
875 nmdc:mga0yw44_77787_c1
876 nmdc:mga06z11_10243_c1
877 nmdc:mga07m45_12473_c1
878 nmdc:mga07m45_128295_c1
879 nmdc:mga07m45_24163_c1
880 nmdc:mga07m45_29068_c1
881 nmdc:mga05p37_47407_c2
882 nmdc:mga0qj67_214455_c1
883 nmdc:mga06r32_93167_c1
884 nmdc:mga0sz30_10822_c1
885 nmdc:mga0sz30_41992_c1
886 nmdc:mga0sz30_85631_c1
887 Ga0495655_0016012
888 Ga0500643_010166
889 Ga0500643_078657
890 Ga0500646_0024263
891 Ga0500616_0024637
892 Ga0500616_0146117
893 Ga0500633_0113943
894 Ga0466962_0017235
895 Ga0466962_0127585
896 2523383773
897 2558907930
898 2623498033
899 2795787195
900 2816504455
901 2819693239
902 2880502502
903 2902795697
904 2905928529
905 2917736305
906 8054478835

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22234

Rv2466c-like

Mycothiol-dependent nitroreductase Rv2466c

29

231

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zil-assembly1.cif.gz_B crystal structure of rv2466c and oxidoreductase from mycobacterium tuberculosis in its reduced state 0.9035 6 198
4nxi-assembly1.cif.gz_B rv2466c mediates the activation of tp053 to kill replicating and non-replicating mycobacterium tuberculosis 0.8995 6 198
4wkw-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein from mycobacterium leprae determined by iodide sad phasing 0.8583 6 212
4nxi-assembly1.cif.gz_A rv2466c mediates the activation of tp053 to kill replicating and non-replicating mycobacterium tuberculosis 0.8543 6 218
7asw-assembly1.cif.gz_A crystal structure of chloroplastic thioredoxin z defines a novel type-specific target recognition 0.8451 6 38
ID Description Score Start End Superfamily
4wkwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8365 6 220 3.40.30.10
af_P9WLE7_3_196_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8158 6 199 3.40.30.10
4wkwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7935 6 220 3.40.30.10
af_Q8I3H6_76_168_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7735 4 46 3.40.30.10
af_Q8H2V6_78_188_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.771 6 39 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A6G2JQK6-F1-model_v4 Disulfide bond formation protein DsbA 0.972 7 101
AF-A0A6G3V3V1-F1-model_v4 deleted 0.9714 1 153
AF-A0A7K0U307-F1-model_v4 Disulfide bond formation protein DsbA 0.9572 1 97
AF-A0A350RKE3-F1-model_v4 Disulfide bond formation protein DsbA 0.9505 7 75
AF-A0A6G3V3V1-F1-model_v4 deleted 0.947 1 153

Map