F447044

General Info

Members Datasets Scaffolds Average Seq Length
452 287 904 245

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0053928|Ga0495603_0053928_1144_2007
Length 277
Sequence VNATRAEYCVIACAEAWRGDGEVLASPMGLIPSIGARLARRTFSPDLLLTDGEALLVRLDGTTEGWLPYRRHLTAVTGGRRHVMMGASQIDRFGNQNIACVGDWSRPRRQLLGVRGAPVNTLNNPTSYWIPRHSPRVFVERVDMVCGVGYDRAAAAGPSATRFHRLPRVVTDLAVLDFATPDHSMRLVSVHPGVTAEQVGEATGFGLIIPDEVPFTREPTLEELELIRTVIDPEGLRNREVPDPRSAAGEGRDVTGGGXXARHRETPGRAHGTPGPR

Samples

Sample ID Description Type Environment
1 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
80 3300028019 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 Metagenome Unclassified
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
85 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
86 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
89 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
94 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
95 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
96 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
97 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
112 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
113 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
116 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
117 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
118 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
119 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
120 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
121 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
122 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
145 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
161 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
167 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
184 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
185 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
195 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
196 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
197 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
198 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
233 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
234 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
237 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
238 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
239 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
240 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
241 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
242 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
243 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
245 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
246 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
247 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
248 2558860280 Kutzneria sp. 744 Isolate Unclassified
249 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
250 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
251 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
252 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
253 2643221647 Streptomyces sp. Root369 Isolate Unclassified
254 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
255 2643221714 Streptomyces sp. Root264 Isolate Unclassified
256 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
257 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
258 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
259 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
260 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
261 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
262 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
263 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
264 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
265 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
266 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
267 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
268 2867428634 Streptomyces sp. RP5T Isolate Unclassified
269 2867475112 Streptomyces sp. TM32 Isolate Unclassified
270 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
271 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
272 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
273 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
274 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
275 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
276 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
277 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
278 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
279 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
280 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
281 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
282 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
283 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
284 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
285 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
286 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
287 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.04
Metatranscriptomes 0.44
Isolates 9.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.98
Nodule 0.44
Rhizoplane 1.77
Rhizosphere 81.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495603_0053928 3300046455 Bacteria 2385
2 JGI25406J46586_10001476 3300003203 Bacteria 11075
3 rootL2_10035128 3300003322 Bacteria 1553
4 Ga0006562J51391_1094202 3300003578 Bacteria 7930
5 Ga0006562J51391_1094203 3300003578 Bacteria 6250
6 Ga0070668_100002771 3300005347 Bacteria 12883
7 Ga0070669_100197531 3300005353 Bacteria 1581
8 Ga0070674_100208095 3300005356 Bacteria 1514
9 Ga0070713_100029417 3300005436 Bacteria 4351
10 Ga0070713_100078059 3300005436 Bacteria 2817
11 Ga0070710_10000941 3300005437 Bacteria 13841
12 Ga0070711_100008906 3300005439 Bacteria 6160
13 Ga0070708_100000533 3300005445 Bacteria 28660
14 Ga0070708_100025454 3300005445 Bacteria 5058
15 Ga0070708_100084995 3300005445 Bacteria 2871
16 Ga0070681_10095021 3300005458 Bacteria 2929
17 Ga0070685_10069426 3300005466 Bacteria 2084
18 Ga0070706_100015516 3300005467 Bacteria 7038
19 Ga0070707_100167375 3300005468 Bacteria 2142
20 Ga0070698_100092049 3300005471 Bacteria 3013
21 Ga0070699_100065417 3300005518 Bacteria 3155
22 Ga0070684_100632558 3300005535 Bacteria 996
23 Ga0070697_100021918 3300005536 Bacteria 5067
24 Ga0068853_100023230 3300005539 Bacteria 5188
25 Ga0070696_100056143 3300005546 Bacteria 2746
26 Ga0068855_100279107 3300005563 Bacteria 1856
27 Ga0068857_100498572 3300005577 Bacteria 1142
28 Ga0068856_100065507 3300005614 Bacteria 3591
29 Ga0068859_100704923 3300005617 Bacteria 1100
30 Ga0068863_100426893 3300005841 Bacteria 1299
31 Ga0068862_100058276 3300005844 Bacteria 3313
32 Ga0068862_100255464 3300005844 Bacteria 1598
33 Ga0081455_10152403 3300005937 Bacteria 1781
34 Ga0081539_10000086 3300005985 Bacteria 217801
35 Ga0081539_10119633 3300005985 Bacteria 1310
36 Ga0070717_10175941 3300006028 Bacteria 1863
37 Ga0070717_10253449 3300006028 Bacteria 1555
38 Ga0075368_10016792 3300006042 Bacteria 2731
39 Ga0075363_100021875 3300006048 Bacteria 3228
40 Ga0070715_10032449 3300006163 Bacteria 2128
41 Ga0070712_100063620 3300006175 Bacteria 2613
42 Ga0070712_100360557 3300006175 Bacteria 1192
43 Ga0070712_100575053 3300006175 Bacteria 951
44 Ga0075367_10041724 3300006178 Bacteria 2683
45 Ga0075370_10037124 3300006353 Bacteria 2739
46 Ga0075370_10101652 3300006353 Bacteria 1664
47 Ga0075428_100000246 3300006844 Bacteria 53194
48 Ga0075428_100007298 3300006844 Bacteria 12243
49 Ga0075430_100238156 3300006846 Bacteria 1508
50 Ga0075430_100378877 3300006846 Bacteria 1168
51 Ga0075431_100725407 3300006847 Bacteria 970
52 Ga0075434_100104182 3300006871 Bacteria 2846
53 Ga0075434_100466456 3300006871 Bacteria 1284
54 Ga0075429_100209032 3300006880 Bacteria 1710
55 Ga0075436_100127541 3300006914 Bacteria 1783
56 Ga0097620_100704770 3300006931 Bacteria 1100
57 Ga0075435_100018908 3300007076 Bacteria 5250
58 Ga0075435_100038861 3300007076 Bacteria 3796
59 Ga0111539_10006278 3300009094 Bacteria 15343
60 Ga0105245_10186758 3300009098 Bacteria 1983
61 Ga0114129_11204131 3300009147 Bacteria 943
62 Ga0105241_10148216 3300009174 Bacteria 1917
63 Ga0105248_10238229 3300009177 Bacteria 2048
64 Ga0105237_10274347 3300009545 Bacteria 1689
65 Ga0157369_10432533 3300013105 Bacteria 1364
66 Ga0157372_10160063 3300013307 Bacteria 2602
67 Ga0157375_11180244 3300013308 Bacteria 898
68 Ga0163163_10852198 3300014325 Bacteria 975
69 Ga0182008_10021672 3300014497 Bacteria 3299
70 Ga0157379_10380828 3300014968 Bacteria 1294
71 Ga0182007_10003573 3300015262 Bacteria 7313
72 Ga0213871_10019135 3300021441 Bacteria 1683
73 Ga0207426_1010084 3300025302 Bacteria 3692
74 Ga0207692_10276051 3300025898 Bacteria 1015
75 Ga0207647_10008520 3300025904 Bacteria 7344
76 Ga0207699_10000735 3300025906 Bacteria 15624
77 Ga0207684_10032822 3300025910 Bacteria 4415
78 Ga0207684_10340556 3300025910 Bacteria 1291
79 Ga0207684_10399794 3300025910 Bacteria 1181
80 Ga0207707_10457204 3300025912 Bacteria 1092
81 Ga0207693_10020378 3300025915 Bacteria 5275
82 Ga0207693_10100580 3300025915 Bacteria 2267
83 Ga0207693_10180847 3300025915 Bacteria 1659
84 Ga0207693_10182880 3300025915 Bacteria 1650
85 Ga0207663_10007454 3300025916 Bacteria 5674
86 Ga0207663_10013981 3300025916 Bacteria 4381
87 Ga0207646_10157142 3300025922 Bacteria 2051
88 Ga0207681_10214995 3300025923 Bacteria 1484
89 Ga0207700_10000684 3300025928 Bacteria 19741
90 Ga0207700_10001294 3300025928 Bacteria 14230
91 Ga0207664_10027194 3300025929 Bacteria 4333
92 Ga0207665_10008759 3300025939 Bacteria 6658
93 Ga0207665_10019094 3300025939 Bacteria 4504
94 Ga0207668_10107347 3300025972 Bacteria 2087
95 Ga0207668_10457563 3300025972 Bacteria 1090
96 Ga0207658_10376179 3300025986 Bacteria 1243
97 Ga0207703_10201168 3300026035 Bacteria 1770
98 Ga0207639_10015967 3300026041 Bacteria 5304
99 Ga0207641_10129527 3300026088 Bacteria 2264
100 Ga0207674_10309191 3300026116 Bacteria 1530
101 Ga0207683_10139081 3300026121 Bacteria 2187
102 Ga0209813_10103433 3300027866 Bacteria 972
103 Ga0224573_1006956 3300028019 Bacteria 837
104 Ga0268266_10149056 3300028379 Bacteria 2107
105 Ga0268265_10113345 3300028380 Bacteria 2219
106 Ga0268265_10220116 3300028380 Bacteria 1660
107 Ga0307515_10001023 3300028794 Bacteria 63806
108 Ga0307515_10002179 3300028794 Bacteria 43016
109 Ga0307515_10203948 3300028794 Bacteria 1844
110 Ga0307511_10001886 3300030521 Bacteria 22019
111 Ga0307511_10003945 3300030521 Bacteria 15158
112 Ga0307511_10054508 3300030521 Bacteria 3151
113 Ga0307511_10055830 3300030521 Bacteria 3095
114 Ga0307512_10010153 3300030522 Bacteria 9002
115 Ga0307512_10021058 3300030522 Bacteria 5887
116 Ga0307512_10133995 3300030522 Bacteria 1542
117 Ga0307509_10007990 3300031507 Bacteria 13634
118 Ga0307509_10039611 3300031507 Bacteria 5132
119 Ga0307509_10114193 3300031507 Bacteria 2696
120 Ga0307509_10191029 3300031507 Bacteria 1899
121 Ga0307508_10008345 3300031616 Bacteria 9576
122 Ga0307508_10019546 3300031616 Bacteria 6156
123 Ga0307508_10303860 3300031616 Bacteria 1188
124 Ga0307508_10318124 3300031616 Bacteria 1148
125 Ga0307514_10024896 3300031649 Bacteria 4840
126 Ga0307514_10045858 3300031649 Bacteria 3417
127 Ga0307514_10108412 3300031649 Bacteria 1975
128 Ga0307516_10001391 3300031730 Bacteria 33410
129 Ga0307516_10010098 3300031730 Bacteria 10438
130 Ga0307516_10145386 3300031730 Bacteria 2137
131 Ga0307413_10205548 3300031824 Bacteria 1426
132 Ga0307518_10031900 3300031838 Bacteria 3819
133 Ga0307416_100095372 3300032002 Bacteria 2569
134 Ga0307507_10019990 3300033179 Bacteria 7515
135 Ga0307507_10024114 3300033179 Bacteria 6645
136 Ga0307507_10204041 3300033179 Bacteria 1362
137 Ga0307510_10034112 3300033180 Bacteria 5704
138 Ga0307510_10075136 3300033180 Bacteria 3333
139 Ga0307510_10270551 3300033180 Bacteria 1175
140 Ga0373929_0025497 3300035085 Bacteria 1228
141 Ga0373940_0004858 3300035088 Bacteria 2869
142 Ga0373940_0035773 3300035088 Bacteria 1345
143 Ga0373936_0006547 3300035113 Bacteria 4386
144 Ga0373941_0000662 3300035115 Bacteria 6973
145 Ga0373941_0022090 3300035115 Bacteria 1802
146 Ga0373954_0028782 3300035118 Bacteria 2555
147 Ga0373956_0004840 3300035119 Bacteria 5390
148 Ga0373957_0011993 3300035120 Bacteria 2907
149 Ga0373946_0352048 3300035171 Bacteria 736
150 Ga0373942_0000794 3300035207 Bacteria 8718
151 Ga0373935_0000105 3300035692 Bacteria 37756
152 Ga0373935_0170419 3300035692 Bacteria 1489
153 Ga0373935_0533252 3300035692 Bacteria 854
154 Ga0373947_0000030 3300035725 Bacteria 78635
155 Ga0373925_0269203 3300037068 Bacteria 1370
156 Ga0395898_0009610 3300037466 Bacteria 10154
157 Ga0436365_0336731 3300039437 Bacteria 1157
158 Ga0436365_0558344 3300039437 Bacteria 2531
159 Ga0436365_1423511 3300039437 Bacteria 1269
160 Ga0436360_0487802 3300039438 Bacteria 3972
161 Ga0436361_0992401 3300039447 Bacteria 3053
162 Ga0436362_0365108 3300039453 Bacteria 3383
163 Ga0436362_0561730 3300039453 Bacteria 9368
164 Ga0436362_0848906 3300039453 Bacteria 2625
165 Ga0439439_0009177 3300041406 Bacteria 2348
166 Ga0451791_1070518 3300041451 Bacteria 1501
167 Ga0451853_1594502 3300041512 Bacteria 6701
168 Ga0451853_1633729 3300041512 Bacteria 2753
169 Ga0451853_2679169 3300041512 Bacteria 1885
170 Ga0439448_0003884 3300042005 Bacteria 4183
171 Ga0439449_0000442 3300042007 Bacteria 15380
172 Ga0439449_0010521 3300042007 Bacteria 3496
173 Ga0439457_001457 3300042014 Bacteria 7106
174 Ga0450894_000344 3300042131 Bacteria 8207
175 Ga0450896_000776 3300042133 Bacteria 3586
176 Ga0450898_000918 3300042134 Bacteria 3698
177 Ga0450906_028154 3300042145 Bacteria 995
178 Ga0466969_0009928 3300044656 Bacteria 5047
179 Ga0466969_0042877 3300044656 Bacteria 2256
180 Ga0466965_0000328 3300044683 Bacteria 15868
181 Ga0466966_0004959 3300044684 Bacteria 8748
182 Ga0466961_0001263 3300044693 Bacteria 15604
183 Ga0466961_0011189 3300044693 Bacteria 5736
184 Ga0466963_0002567 3300044694 Bacteria 10186
185 Ga0466963_0168880 3300044694 Bacteria 1524
186 Ga0466964_0004936 3300044706 Bacteria 4930
187 Ga0466964_0252729 3300044706 Bacteria 870
188 Ga0466971_0000643 3300044719 Bacteria 13885
189 Ga0466971_0053632 3300044719 Bacteria 1817
190 Ga0466968_0041479 3300044735 Bacteria 1943
191 Ga0466970_0000784 3300044765 Bacteria 15349
192 Ga0466957_0000472 3300044842 Bacteria 19985
193 Ga0466960_0112184 3300044901 Bacteria 1418
194 Ga0466959_0001522 3300045049 Bacteria 14235
195 Ga0466959_0085252 3300045049 Bacteria 2274
196 Ga0466959_0227286 3300045049 Bacteria 1292
197 Ga0466958_0000634 3300045836 Bacteria 15090
198 Ga0466967_0213420 3300045976 Bacteria 1831
199 Ga0495617_032859 3300046452 Bacteria 1742
200 Ga0495592_0006615 3300046454 Bacteria 8640
201 Ga0495603_0047873 3300046455 Bacteria 2545
202 Ga0495629_0018200 3300046459 Bacteria 5032
203 Ga0495629_0029856 3300046459 Bacteria 3864
204 Ga0495629_0035001 3300046459 Bacteria 3550
205 Ga0495629_0069702 3300046459 Bacteria 2454
206 Ga0495629_0079647 3300046459 Bacteria 2287
207 Ga0495629_0091299 3300046459 Bacteria 2125
208 Ga0495638_0012365 3300046460 Bacteria 5853
209 Ga0495638_0206114 3300046460 Bacteria 1107
210 Ga0495641_0020834 3300046461 Bacteria 3313
211 Ga0495651_0010135 3300046462 Bacteria 7239
212 Ga0495651_0050441 3300046462 Bacteria 3210
213 Ga0495651_0290547 3300046462 Bacteria 1100
214 Ga0495653_0037247 3300046463 Bacteria 3823
215 Ga0495653_0157266 3300046463 Bacteria 1581
216 Ga0495653_0431818 3300046463 Bacteria 832
217 Ga0495582_0014173 3300046473 Bacteria 4387
218 Ga0495582_0016091 3300046473 Bacteria 4100
219 Ga0495582_0063046 3300046473 Bacteria 2048
220 Ga0495582_0337547 3300046473 Bacteria 867
221 Ga0495605_0008869 3300046474 Bacteria 5669
222 Ga0495639_0011817 3300046475 Bacteria 3765
223 Ga0495639_0081474 3300046475 Bacteria 1508
224 Ga0495662_0003574 3300046476 Bacteria 7854
225 Ga0495662_0009872 3300046476 Bacteria 4689
226 Ga0495662_0089213 3300046476 Bacteria 1502
227 Ga0495662_0119615 3300046476 Bacteria 1292
228 Ga0495664_0002328 3300046477 Bacteria 10181
229 Ga0495664_0044645 3300046477 Bacteria 2626
230 Ga0495585_0052049 3300046492 Bacteria 2267
231 Ga0495594_0008394 3300046499 Bacteria 5323
232 Ga0495594_0032811 3300046499 Bacteria 2820
233 Ga0495594_0077633 3300046499 Bacteria 1853
234 Ga0495607_0043973 3300046501 Bacteria 2636
235 Ga0495606_0005742 3300046507 Bacteria 11732
236 Ga0495606_0267649 3300046507 Bacteria 940
237 Ga0495608_0089284 3300046511 Bacteria 1995
238 Ga0495610_0042111 3300046512 Bacteria 2287
239 Ga0495610_0154646 3300046512 Bacteria 975
240 Ga0495618_0071106 3300046514 Bacteria 2213
241 Ga0495618_0405122 3300046514 Bacteria 833
242 Ga0495620_0030329 3300046515 Bacteria 2491
243 Ga0495628_0034441 3300046516 Bacteria 4073
244 Ga0495628_0124054 3300046516 Bacteria 1979
245 Ga0495628_0160523 3300046516 Bacteria 1708
246 Ga0495628_0193526 3300046516 Bacteria 1535
247 Ga0495630_0081602 3300046517 Bacteria 2440
248 Ga0495631_0009264 3300046518 Bacteria 4925
249 Ga0495632_0035576 3300046519 Bacteria 2540
250 Ga0495632_0052331 3300046519 Bacteria 2008
251 Ga0495637_0064909 3300046520 Bacteria 1488
252 Ga0495666_0052156 3300046526 Bacteria 1964
253 Ga0495652_0069267 3300046529 Bacteria 2954
254 Ga0495652_0090878 3300046529 Bacteria 2497
255 Ga0495652_0095641 3300046529 Bacteria 2420
256 Ga0495665_0002302 3300046531 Bacteria 10322
257 Ga0495640_0069724 3300046533 Bacteria 2364
258 Ga0495640_0075586 3300046533 Bacteria 2249
259 Ga0495587_0017545 3300046536 Bacteria 4446
260 Ga0495587_0255451 3300046536 Bacteria 985
261 Ga0495609_0042577 3300046538 Bacteria 2039
262 Ga0495597_0036210 3300046542 Bacteria 2223
263 Ga0495597_0133652 3300046542 Bacteria 1027
264 Ga0495645_0026887 3300046543 Bacteria 4179
265 Ga0495645_0034309 3300046543 Bacteria 3702
266 Ga0495622_0009969 3300046557 Bacteria 4394
267 Ga0495667_0066942 3300046559 Bacteria 2348
268 Ga0495667_0229906 3300046559 Bacteria 1182
269 Ga0495668_0042237 3300046616 Bacteria 2538
270 Ga0495634_0014109 3300046642 Bacteria 5768
271 Ga0495634_0098766 3300046642 Bacteria 1888
272 Ga0495611_0071371 3300046648 Bacteria 1587
273 Ga0495611_0183405 3300046648 Bacteria 977
274 Ga0495625_0230896 3300046660 Bacteria 1208
275 Ga0495625_0240578 3300046660 Bacteria 1178
276 Ga0495635_0013819 3300046663 Bacteria 5647
277 Ga0495635_0019345 3300046663 Bacteria 4749
278 Ga0495635_0020363 3300046663 Bacteria 4621
279 Ga0495588_0151086 3300046674 Bacteria 1227
280 Ga0495588_0342886 3300046674 Bacteria 785
281 Ga0495657_0008798 3300046675 Bacteria 7692
282 Ga0495657_0020933 3300046675 Bacteria 4699
283 Ga0495657_0046558 3300046675 Bacteria 2935
284 Ga0495657_0196877 3300046675 Bacteria 1229
285 Ga0495657_0230114 3300046675 Bacteria 1121
286 Ga0495623_0307847 3300046679 Bacteria 873
287 Ga0495646_0008763 3300046680 Bacteria 6426
288 Ga0495646_0112749 3300046680 Bacteria 1547
289 Ga0495658_0026250 3300046683 Bacteria 3120
290 Ga0495613_0008460 3300046689 Bacteria 7634
291 Ga0495613_0011963 3300046689 Bacteria 6449
292 Ga0495613_0078488 3300046689 Bacteria 2401
293 Ga0495613_0093208 3300046689 Bacteria 2180
294 Ga0495613_0123741 3300046689 Bacteria 1855
295 Ga0495613_0144003 3300046689 Bacteria 1701
296 Ga0495613_0154305 3300046689 Bacteria 1636
297 Ga0495613_0235512 3300046689 Bacteria 1281
298 Ga0495624_0055962 3300046690 Bacteria 2483
299 Ga0495624_0069691 3300046690 Bacteria 2190
300 Ga0495624_0133177 3300046690 Bacteria 1524
301 Ga0495624_0171603 3300046690 Bacteria 1323
302 Ga0495624_0383672 3300046690 Bacteria 844
303 Ga0495671_0005347 3300046692 Bacteria 7533
304 Ga0495649_0018624 3300046694 Bacteria 3903
305 Ga0495649_0070796 3300046694 Bacteria 1869
306 Ga0495589_0021400 3300046794 Bacteria 3305
307 Ga0495589_0031434 3300046794 Bacteria 2672
308 Ga0495589_0033646 3300046794 Bacteria 2573
309 Ga0495600_0031532 3300046809 Bacteria 3434
310 Ga0495600_0083050 3300046809 Bacteria 2091
311 Ga0495581_0009392 3300047315 Bacteria 5659
312 Ga0495581_0010613 3300047315 Bacteria 5324
313 Ga0495581_0012683 3300047315 Bacteria 4882
314 Ga0495604_0000463 3300047317 Bacteria 36017
315 Ga0495604_0015229 3300047317 Bacteria 6139
316 Ga0495604_0152330 3300047317 Bacteria 1641
317 Ga0495604_0260274 3300047317 Bacteria 1179
318 Ga0495636_0001674 3300047318 Bacteria 8448
319 Ga0495636_0003560 3300047318 Bacteria 6038
320 Ga0495636_0041283 3300047318 Bacteria 1915
321 Ga0495674_0013019 3300047319 Bacteria 7830
322 Ga0495674_0023360 3300047319 Bacteria 5700
323 Ga0495674_0043757 3300047319 Bacteria 3983
324 Ga0495672_0002597 3300047320 Bacteria 16370
325 Ga0495672_0061371 3300047320 Bacteria 2167
326 Ga0495676_0015381 3300047321 Bacteria 6814
327 Ga0495676_0043000 3300047321 Bacteria 3701
328 Ga0495676_0070095 3300047321 Bacteria 2702
329 Ga0495680_0024972 3300047322 Bacteria 4948
330 Ga0495680_0051895 3300047322 Bacteria 3199
331 Ga0495683_0013639 3300047323 Bacteria 4246
332 Ga0495683_0186032 3300047323 Bacteria 945
333 Ga0495687_001642 3300047443 Bacteria 20129
334 Ga0495687_011964 3300047443 Bacteria 4625
335 Ga0495675_0015034 3300047444 Bacteria 4894
336 Ga0495675_0037656 3300047444 Bacteria 3081
337 Ga0495675_0086600 3300047444 Bacteria 1969
338 Ga0495685_004583 3300047447 Bacteria 4478
339 Ga0495685_006806 3300047447 Bacteria 3758
340 Ga0495685_022494 3300047447 Bacteria 2170
341 Ga0495681_0002257 3300047470 Bacteria 13855
342 Ga0495684_0066462 3300047471 Bacteria 2742
343 Ga0495684_0241134 3300047471 Bacteria 1319
344 Ga0495686_0223361 3300047472 Bacteria 1070
345 Ga0495593_0005975 3300047673 Bacteria 7169
346 Ga0495593_0049341 3300047673 Bacteria 2233
347 Ga0495602_0017076 3300048088 Bacteria 7281
348 Ga0495602_0042907 3300048088 Bacteria 4117
349 Ga0495614_0004823 3300048089 Bacteria 6086
350 Ga0495614_0019312 3300048089 Bacteria 2949
351 Ga0495614_0072334 3300048089 Bacteria 1487
352 Ga0495614_0235718 3300048089 Bacteria 834
353 Ga0496101_0231813 3300048904 Bacteria 1435
354 Ga0496102_0211272 3300048905 Bacteria 1829
355 Ga0496103_0162170 3300048906 Bacteria 1434
356 Ga0496105_0088866 3300048908 Bacteria 2552
357 Ga0496112_0373212 3300048915 Bacteria 1368
358 Ga0496114_0613398 3300048917 Bacteria 959
359 Ga0496115_0108222 3300048918 Bacteria 2282
360 Ga0501038_0006474 3300049574 Bacteria 10839
361 Ga0501038_0271792 3300049574 Bacteria 1336
362 Ga0501038_0385111 3300049574 Bacteria 1087
363 Ga0501039_0206523 3300049575 Bacteria 1544
364 Ga0501040_0064839 3300049576 Bacteria 2515
365 Ga0501043_0058411 3300049579 Bacteria 3028
366 Ga0501043_0240531 3300049579 Bacteria 1396
367 Ga0501047_0037941 3300049581 Bacteria 4660
368 Ga0501068_0008968 3300049584 Bacteria 5580
369 Ga0501070_0253631 3300049586 Bacteria 1439
370 Ga0501070_0571223 3300049586 Bacteria 904
371 Ga0501070_0598708 3300049586 Bacteria 879
372 Ga0501072_0392565 3300049588 Bacteria 1101
373 Ga0501079_0203961 3300049741 Bacteria 1545
374 Ga0501035_0124773 3300049822 Bacteria 2248
375 Ga0501035_0211656 3300049822 Bacteria 1658
376 Ga0501044_0003264 3300049823 Bacteria 18246
377 Ga0501044_0014833 3300049823 Bacteria 8400
378 Ga0501045_0070549 3300049824 Bacteria 2571
379 nmdc:mga06z11_89097_c1 3300050494 Bacteria 1672
380 nmdc:mga04h51_7073_c1 3300050495 Bacteria 2943
381 nmdc:mga09592_304392_c1 3300050508 Bacteria 1382
382 nmdc:mga06r32_91337_c1 3300050510 Bacteria 2976
383 nmdc:mga08y16_53254_c1 3300050511 Bacteria 4232
384 nmdc:mga0n895_443871_c1 3300050512 Bacteria 1310
385 nmdc:mga0n895_77740_c1 3300050512 Bacteria 3302
386 nmdc:mga0rr50_11099_c1 3300050513 Bacteria 5748
387 nmdc:mga0rr50_178055_c1 3300050513 Bacteria 1737
388 nmdc:mga0rr50_792581_c1 3300050513 Bacteria 808
389 nmdc:mga08x19_105684_c1 3300050514 Bacteria 1872
390 nmdc:mga08x19_210896_c1 3300050514 Bacteria 1333
391 nmdc:mga0a205_761147_c1 3300050515 Bacteria 817
392 Ga0495601_0026301 3300053077 Bacteria 3592
393 Ga0495601_0041825 3300053077 Bacteria 2874
394 Ga0495601_0067060 3300053077 Bacteria 2285
395 Ga0495612_0004424 3300053078 Bacteria 5827
396 Ga0495612_0070606 3300053078 Bacteria 1456
397 Ga0495595_0154946 3300053084 Bacteria 1128
398 Ga0495619_0019574 3300053085 Bacteria 4304
399 Ga0495619_0026427 3300053085 Bacteria 3734
400 Ga0500566_0261670 3300053094 Bacteria 835
401 Ga0500640_020802 3300053095 Bacteria 2824
402 Ga0500553_035329 3300053101 Bacteria 2478
403 Ga0500568_0000030 3300053139 Bacteria 159567
404 Ga0500573_0062595 3300053140 Bacteria 2130
405 Ga0500577_0128390 3300053142 Bacteria 1060
406 Ga0500600_0069073 3300053149 Bacteria 1943
407 Ga0500600_0076462 3300053149 Bacteria 1822
408 Ga0500624_010347 3300053157 Bacteria 1342
409 Ga0466962_0000306 3300061719 Bacteria 21050
410 2515494356 2515154088 Bacteria 5526283
411 2515757443 2515154137 Bacteria 5711575
412 2516088922 2515154203 Bacteria 5458536
413 2559423995 2558860280 Bacteria 11429938
414 2585306697 2582581313 Bacteria 10042643
415 2585314201 2582581314 Bacteria 11452267
416 2616694175 2616644814 Bacteria 11555299
417 2643945266 2643221587 Bacteria 7586415
418 2644271014 2643221647 Bacteria 10741251
419 2644432165 2643221677 Bacteria 7584031
420 2644629495 2643221714 Bacteria 9015452
421 2753265817 2751185782 Bacteria 11227053
422 2785345048 2784746763 Bacteria 9783172
423 2808840488 2808606359 Bacteria 9866990
424 2808919068 2808606375 Bacteria 9466072
425 2811847500 2808606982 Bacteria 7791042
426 2812359692 2811994879 Bacteria 9313447
427 2852638328 2852635781 Bacteria 8251373
428 2862183054 2862178590 Bacteria 8583590
429 2862288803 2862281513 Bacteria 9621493
430 2862392454 2862382967 Bacteria 10317375
431 2863406309 2863404153 Bacteria 9672205
432 2866557233 2866552031 Bacteria 5824618
433 2867435158 2867428634 Bacteria 9590268
434 2867476507 2867475112 Bacteria 6909112
435 2875393213 2875391855 Bacteria 7600475
436 2919473067 2919468124 Bacteria 9133025
437 2935395529 2935390628 Bacteria 7043367
438 2946066218 2946064051 Bacteria 8957905
439 2946074484 2946072368 Bacteria 8999607
440 2947231155 2947224130 Bacteria 9938529
441 2954387916 2954380949 Bacteria 10050426
442 2954698726 2954691527 Bacteria 10720516
443 2954703496 2954701450 Bacteria 10834262
444 2954717701 2954711539 Bacteria 10867210
445 2954727667 2954721474 Bacteria 10456478
446 2954734135 2954731030 Bacteria 10243860
447 2954746560 2954740390 Bacteria 10229294
448 2954753019 2954749733 Bacteria 10366972
449 2954765677 2954759201 Bacteria 9358192
450 8008561998 8008558824 Bacteria 10610750
451 8054167576 8054160619 Bacteria 7783213
452 8056210780 8056207758 Bacteria 8639239
453 Ga0495603_0053928
454 JGI25406J46586_10001476
455 rootL2_10035128
456 Ga0006562J51391_1094202
457 Ga0006562J51391_1094203
458 Ga0070668_100002771
459 Ga0070669_100197531
460 Ga0070674_100208095
461 Ga0070713_100029417
462 Ga0070713_100078059
463 Ga0070710_10000941
464 Ga0070711_100008906
465 Ga0070708_100000533
466 Ga0070708_100025454
467 Ga0070708_100084995
468 Ga0070681_10095021
469 Ga0070685_10069426
470 Ga0070706_100015516
471 Ga0070707_100167375
472 Ga0070698_100092049
473 Ga0070699_100065417
474 Ga0070684_100632558
475 Ga0070697_100021918
476 Ga0068853_100023230
477 Ga0070696_100056143
478 Ga0068855_100279107
479 Ga0068857_100498572
480 Ga0068856_100065507
481 Ga0068859_100704923
482 Ga0068863_100426893
483 Ga0068862_100058276
484 Ga0068862_100255464
485 Ga0081455_10152403
486 Ga0081539_10000086
487 Ga0081539_10119633
488 Ga0070717_10175941
489 Ga0070717_10253449
490 Ga0075368_10016792
491 Ga0075363_100021875
492 Ga0070715_10032449
493 Ga0070712_100063620
494 Ga0070712_100360557
495 Ga0070712_100575053
496 Ga0075367_10041724
497 Ga0075370_10037124
498 Ga0075370_10101652
499 Ga0075428_100000246
500 Ga0075428_100007298
501 Ga0075430_100238156
502 Ga0075430_100378877
503 Ga0075431_100725407
504 Ga0075434_100104182
505 Ga0075434_100466456
506 Ga0075429_100209032
507 Ga0075436_100127541
508 Ga0097620_100704770
509 Ga0075435_100018908
510 Ga0075435_100038861
511 Ga0111539_10006278
512 Ga0105245_10186758
513 Ga0114129_11204131
514 Ga0105241_10148216
515 Ga0105248_10238229
516 Ga0105237_10274347
517 Ga0157369_10432533
518 Ga0157372_10160063
519 Ga0157375_11180244
520 Ga0163163_10852198
521 Ga0182008_10021672
522 Ga0157379_10380828
523 Ga0182007_10003573
524 Ga0213871_10019135
525 Ga0207426_1010084
526 Ga0207692_10276051
527 Ga0207647_10008520
528 Ga0207699_10000735
529 Ga0207684_10032822
530 Ga0207684_10340556
531 Ga0207684_10399794
532 Ga0207707_10457204
533 Ga0207693_10020378
534 Ga0207693_10100580
535 Ga0207693_10180847
536 Ga0207693_10182880
537 Ga0207663_10007454
538 Ga0207663_10013981
539 Ga0207646_10157142
540 Ga0207681_10214995
541 Ga0207700_10000684
542 Ga0207700_10001294
543 Ga0207664_10027194
544 Ga0207665_10008759
545 Ga0207665_10019094
546 Ga0207668_10107347
547 Ga0207668_10457563
548 Ga0207658_10376179
549 Ga0207703_10201168
550 Ga0207639_10015967
551 Ga0207641_10129527
552 Ga0207674_10309191
553 Ga0207683_10139081
554 Ga0209813_10103433
555 Ga0224573_1006956
556 Ga0268266_10149056
557 Ga0268265_10113345
558 Ga0268265_10220116
559 Ga0307515_10001023
560 Ga0307515_10002179
561 Ga0307515_10203948
562 Ga0307511_10001886
563 Ga0307511_10003945
564 Ga0307511_10054508
565 Ga0307511_10055830
566 Ga0307512_10010153
567 Ga0307512_10021058
568 Ga0307512_10133995
569 Ga0307509_10007990
570 Ga0307509_10039611
571 Ga0307509_10114193
572 Ga0307509_10191029
573 Ga0307508_10008345
574 Ga0307508_10019546
575 Ga0307508_10303860
576 Ga0307508_10318124
577 Ga0307514_10024896
578 Ga0307514_10045858
579 Ga0307514_10108412
580 Ga0307516_10001391
581 Ga0307516_10010098
582 Ga0307516_10145386
583 Ga0307413_10205548
584 Ga0307518_10031900
585 Ga0307416_100095372
586 Ga0307507_10019990
587 Ga0307507_10024114
588 Ga0307507_10204041
589 Ga0307510_10034112
590 Ga0307510_10075136
591 Ga0307510_10270551
592 Ga0373929_0025497
593 Ga0373940_0004858
594 Ga0373940_0035773
595 Ga0373936_0006547
596 Ga0373941_0000662
597 Ga0373941_0022090
598 Ga0373954_0028782
599 Ga0373956_0004840
600 Ga0373957_0011993
601 Ga0373946_0352048
602 Ga0373942_0000794
603 Ga0373935_0000105
604 Ga0373935_0170419
605 Ga0373935_0533252
606 Ga0373947_0000030
607 Ga0373925_0269203
608 Ga0395898_0009610
609 Ga0436365_0336731
610 Ga0436365_0558344
611 Ga0436365_1423511
612 Ga0436360_0487802
613 Ga0436361_0992401
614 Ga0436362_0365108
615 Ga0436362_0561730
616 Ga0436362_0848906
617 Ga0439439_0009177
618 Ga0451791_1070518
619 Ga0451853_1594502
620 Ga0451853_1633729
621 Ga0451853_2679169
622 Ga0439448_0003884
623 Ga0439449_0000442
624 Ga0439449_0010521
625 Ga0439457_001457
626 Ga0450894_000344
627 Ga0450896_000776
628 Ga0450898_000918
629 Ga0450906_028154
630 Ga0466969_0009928
631 Ga0466969_0042877
632 Ga0466965_0000328
633 Ga0466966_0004959
634 Ga0466961_0001263
635 Ga0466961_0011189
636 Ga0466963_0002567
637 Ga0466963_0168880
638 Ga0466964_0004936
639 Ga0466964_0252729
640 Ga0466971_0000643
641 Ga0466971_0053632
642 Ga0466968_0041479
643 Ga0466970_0000784
644 Ga0466957_0000472
645 Ga0466960_0112184
646 Ga0466959_0001522
647 Ga0466959_0085252
648 Ga0466959_0227286
649 Ga0466958_0000634
650 Ga0466967_0213420
651 Ga0495617_032859
652 Ga0495592_0006615
653 Ga0495603_0047873
654 Ga0495629_0018200
655 Ga0495629_0029856
656 Ga0495629_0035001
657 Ga0495629_0069702
658 Ga0495629_0079647
659 Ga0495629_0091299
660 Ga0495638_0012365
661 Ga0495638_0206114
662 Ga0495641_0020834
663 Ga0495651_0010135
664 Ga0495651_0050441
665 Ga0495651_0290547
666 Ga0495653_0037247
667 Ga0495653_0157266
668 Ga0495653_0431818
669 Ga0495582_0014173
670 Ga0495582_0016091
671 Ga0495582_0063046
672 Ga0495582_0337547
673 Ga0495605_0008869
674 Ga0495639_0011817
675 Ga0495639_0081474
676 Ga0495662_0003574
677 Ga0495662_0009872
678 Ga0495662_0089213
679 Ga0495662_0119615
680 Ga0495664_0002328
681 Ga0495664_0044645
682 Ga0495585_0052049
683 Ga0495594_0008394
684 Ga0495594_0032811
685 Ga0495594_0077633
686 Ga0495607_0043973
687 Ga0495606_0005742
688 Ga0495606_0267649
689 Ga0495608_0089284
690 Ga0495610_0042111
691 Ga0495610_0154646
692 Ga0495618_0071106
693 Ga0495618_0405122
694 Ga0495620_0030329
695 Ga0495628_0034441
696 Ga0495628_0124054
697 Ga0495628_0160523
698 Ga0495628_0193526
699 Ga0495630_0081602
700 Ga0495631_0009264
701 Ga0495632_0035576
702 Ga0495632_0052331
703 Ga0495637_0064909
704 Ga0495666_0052156
705 Ga0495652_0069267
706 Ga0495652_0090878
707 Ga0495652_0095641
708 Ga0495665_0002302
709 Ga0495640_0069724
710 Ga0495640_0075586
711 Ga0495587_0017545
712 Ga0495587_0255451
713 Ga0495609_0042577
714 Ga0495597_0036210
715 Ga0495597_0133652
716 Ga0495645_0026887
717 Ga0495645_0034309
718 Ga0495622_0009969
719 Ga0495667_0066942
720 Ga0495667_0229906
721 Ga0495668_0042237
722 Ga0495634_0014109
723 Ga0495634_0098766
724 Ga0495611_0071371
725 Ga0495611_0183405
726 Ga0495625_0230896
727 Ga0495625_0240578
728 Ga0495635_0013819
729 Ga0495635_0019345
730 Ga0495635_0020363
731 Ga0495588_0151086
732 Ga0495588_0342886
733 Ga0495657_0008798
734 Ga0495657_0020933
735 Ga0495657_0046558
736 Ga0495657_0196877
737 Ga0495657_0230114
738 Ga0495623_0307847
739 Ga0495646_0008763
740 Ga0495646_0112749
741 Ga0495658_0026250
742 Ga0495613_0008460
743 Ga0495613_0011963
744 Ga0495613_0078488
745 Ga0495613_0093208
746 Ga0495613_0123741
747 Ga0495613_0144003
748 Ga0495613_0154305
749 Ga0495613_0235512
750 Ga0495624_0055962
751 Ga0495624_0069691
752 Ga0495624_0133177
753 Ga0495624_0171603
754 Ga0495624_0383672
755 Ga0495671_0005347
756 Ga0495649_0018624
757 Ga0495649_0070796
758 Ga0495589_0021400
759 Ga0495589_0031434
760 Ga0495589_0033646
761 Ga0495600_0031532
762 Ga0495600_0083050
763 Ga0495581_0009392
764 Ga0495581_0010613
765 Ga0495581_0012683
766 Ga0495604_0000463
767 Ga0495604_0015229
768 Ga0495604_0152330
769 Ga0495604_0260274
770 Ga0495636_0001674
771 Ga0495636_0003560
772 Ga0495636_0041283
773 Ga0495674_0013019
774 Ga0495674_0023360
775 Ga0495674_0043757
776 Ga0495672_0002597
777 Ga0495672_0061371
778 Ga0495676_0015381
779 Ga0495676_0043000
780 Ga0495676_0070095
781 Ga0495680_0024972
782 Ga0495680_0051895
783 Ga0495683_0013639
784 Ga0495683_0186032
785 Ga0495687_001642
786 Ga0495687_011964
787 Ga0495675_0015034
788 Ga0495675_0037656
789 Ga0495675_0086600
790 Ga0495685_004583
791 Ga0495685_006806
792 Ga0495685_022494
793 Ga0495681_0002257
794 Ga0495684_0066462
795 Ga0495684_0241134
796 Ga0495686_0223361
797 Ga0495593_0005975
798 Ga0495593_0049341
799 Ga0495602_0017076
800 Ga0495602_0042907
801 Ga0495614_0004823
802 Ga0495614_0019312
803 Ga0495614_0072334
804 Ga0495614_0235718
805 Ga0496101_0231813
806 Ga0496102_0211272
807 Ga0496103_0162170
808 Ga0496105_0088866
809 Ga0496112_0373212
810 Ga0496114_0613398
811 Ga0496115_0108222
812 Ga0501038_0006474
813 Ga0501038_0271792
814 Ga0501038_0385111
815 Ga0501039_0206523
816 Ga0501040_0064839
817 Ga0501043_0058411
818 Ga0501043_0240531
819 Ga0501047_0037941
820 Ga0501068_0008968
821 Ga0501070_0253631
822 Ga0501070_0571223
823 Ga0501070_0598708
824 Ga0501072_0392565
825 Ga0501079_0203961
826 Ga0501035_0124773
827 Ga0501035_0211656
828 Ga0501044_0003264
829 Ga0501044_0014833
830 Ga0501045_0070549
831 nmdc:mga06z11_89097_c1
832 nmdc:mga04h51_7073_c1
833 nmdc:mga09592_304392_c1
834 nmdc:mga06r32_91337_c1
835 nmdc:mga08y16_53254_c1
836 nmdc:mga0n895_443871_c1
837 nmdc:mga0n895_77740_c1
838 nmdc:mga0rr50_11099_c1
839 nmdc:mga0rr50_178055_c1
840 nmdc:mga0rr50_792581_c1
841 nmdc:mga08x19_105684_c1
842 nmdc:mga08x19_210896_c1
843 nmdc:mga0a205_761147_c1
844 Ga0495601_0026301
845 Ga0495601_0041825
846 Ga0495601_0067060
847 Ga0495612_0004424
848 Ga0495612_0070606
849 Ga0495595_0154946
850 Ga0495619_0019574
851 Ga0495619_0026427
852 Ga0500566_0261670
853 Ga0500640_020802
854 Ga0500553_035329
855 Ga0500568_0000030
856 Ga0500573_0062595
857 Ga0500577_0128390
858 Ga0500600_0069073
859 Ga0500600_0076462
860 Ga0500624_010347
861 Ga0466962_0000306
862 2515494356
863 2515757443
864 2516088922
865 2559423995
866 2585306697
867 2585314201
868 2616694175
869 2643945266
870 2644271014
871 2644432165
872 2644629495
873 2753265817
874 2785345048
875 2808840488
876 2808919068
877 2811847500
878 2812359692
879 2852638328
880 2862183054
881 2862288803
882 2862392454
883 2863406309
884 2866557233
885 2867435158
886 2867476507
887 2875393213
888 2919473067
889 2935395529
890 2946066218
891 2946074484
892 2947231155
893 2954387916
894 2954698726
895 2954703496
896 2954717701
897 2954727667
898 2954734135
899 2954746560
900 2954753019
901 2954765677
902 8008561998
903 8054167576
904 8056210780

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

74

202

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6co6-assembly1.cif.gz_B crystal structure of rhodococcus jostii rha1 ipdab 0.8917 1 228
6co6-assembly1.cif.gz_B crystal structure of rhodococcus jostii rha1 ipdab 0.8845 1 228
6con-assembly2.cif.gz_H crystal structure of mycobacterium tuberculosis ipdab 0.8801 1 228
6con-assembly2.cif.gz_H crystal structure of mycobacterium tuberculosis ipdab 0.8729 1 228
5n01-assembly1.cif.gz_B crystal structure of the decarboxylase aiba/aibb c56n variant 0.8233 1 228
ID Description Score Start End Superfamily
af_P9WPV9_2_244_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8871 1 226 3.40.1080.10
af_P9WPV9_2_244_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8725 1 226 3.40.1080.10
1poiD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8108 1 219 3.40.1080.10
1poiD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.7758 1 219 3.40.1080.10
af_Q2G1C6_278_523_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.7086 3 218 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A7K1AFF5-F1-model_v4 CoA-transferase 0.9927 4 46 GO:0016740
AF-A0A7X6ARJ6-F1-model_v4 CoA-transferase 0.9585 154 209 GO:0016740
AF-A0A356VED6-F1-model_v4 deleted 0.947 161 229
AF-A0A531MGE9-F1-model_v4 CoA-transferase 0.9417 160 225 GO:0016740
AF-A0A3B8L525-F1-model_v4 CoA-transferase 0.9374 162 226

Map