F447040

General Info

Members Datasets Scaffolds Average Seq Length
452 246 904 293

Family's Representative Sequence

Representative Sequence 3300044719|Ga0466971_0025960|Ga0466971_0025960_56_928
Length 266
Sequence MTIADLIASARNGSQRAAGRLLSLIESDRRDEVLAVIEPAPIDVIGITGPPGAGKSTTIAALVGAYRARGSRVAVLAVDPSSPFSGGALLGDRIRMTAHINDSDVLIRSVATRGHLGGLAAAVPAAIRLLGADPTIVILNPGAGDAVQAAKAGVLEVADIVAVNKADREGAEQTVRDLRAETKAPIVSLVAARGEGVPELMAAIDDHQRTDSRGRRLARARAQILSLAQTRLRTEPDLDRLAEAVVDGHDDPYTAAEKLLAPRQPE

Samples

Sample ID Description Type Environment
1 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
142 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
143 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
144 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
166 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
208 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
218 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
219 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
220 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
221 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
222 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
223 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
226 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
227 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
228 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
229 2547132424 Nocardia nova SH22a Isolate Unclassified
230 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
231 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
232 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
233 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
234 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
235 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
236 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
237 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
238 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
239 2773857922 Frankia sp. CcI49 Isolate Nodule
240 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
241 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
242 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
243 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
244 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
245 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
246 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.8
Metatranscriptomes 0
Isolates 4.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.93
Nodule 0.66
Rhizoplane 8.63
Rhizosphere 66.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466971_0025960 3300044719 Bacteria 2617
2 JGI24750J21931_1001356 3300002070 Bacteria 3075
3 JGI24744J21845_10000032 3300002077 Bacteria 16140
4 Ga0070666_10027913 3300005335 Bacteria 3701
5 Ga0070680_100223617 3300005336 Bacteria 1589
6 Ga0070682_100136134 3300005337 Bacteria 1669
7 Ga0070682_100140647 3300005337 Bacteria 1645
8 Ga0070682_100192259 3300005337 Bacteria 1433
9 Ga0068868_100000580 3300005338 Bacteria 24531
10 Ga0068868_100086363 3300005338 Bacteria 2522
11 Ga0068868_100315148 3300005338 Bacteria 1331
12 Ga0070691_10009621 3300005341 Bacteria 4412
13 Ga0070692_10026676 3300005345 Bacteria 2858
14 Ga0070668_100018953 3300005347 Bacteria 5170
15 Ga0070668_100136661 3300005347 Bacteria 1972
16 Ga0070669_100003319 3300005353 Bacteria 11565
17 Ga0070669_100014029 3300005353 Bacteria 5697
18 Ga0070675_100143679 3300005354 Bacteria 2041
19 Ga0070671_100045094 3300005355 Bacteria 3665
20 Ga0070674_100002296 3300005356 Bacteria 10558
21 Ga0070659_100021093 3300005366 Bacteria 4956
22 Ga0070667_100000679 3300005367 Bacteria 32958
23 Ga0070667_100004487 3300005367 Bacteria 11776
24 Ga0070667_100014438 3300005367 Bacteria 6527
25 Ga0070667_100084078 3300005367 Bacteria 2727
26 Ga0070703_10044955 3300005406 Bacteria 1391
27 Ga0070709_10081654 3300005434 Bacteria 2111
28 Ga0070714_100025201 3300005435 Bacteria 4907
29 Ga0070714_100433276 3300005435 Bacteria 1247
30 Ga0070710_10017207 3300005437 Bacteria 3695
31 Ga0070710_10019592 3300005437 Bacteria 3499
32 Ga0070711_100003082 3300005439 Bacteria 9632
33 Ga0070705_100003700 3300005440 Bacteria 7489
34 Ga0070700_100004233 3300005441 Bacteria 7491
35 Ga0070663_100015257 3300005455 Bacteria 4954
36 Ga0070678_100000938 3300005456 Bacteria 14978
37 Ga0070678_100243940 3300005456 Bacteria 1503
38 Ga0070662_100003256 3300005457 Bacteria 10100
39 Ga0068867_100012996 3300005459 Bacteria 5891
40 Ga0070685_10010992 3300005466 Bacteria 4723
41 Ga0070685_10151227 3300005466 Bacteria 1471
42 Ga0070686_100281020 3300005544 Bacteria 1228
43 Ga0070695_100238913 3300005545 Bacteria 1317
44 Ga0070696_100001497 3300005546 Bacteria 15326
45 Ga0070693_100007815 3300005547 Bacteria 5243
46 Ga0070665_100009543 3300005548 Bacteria 9816
47 Ga0070665_100036411 3300005548 Bacteria 4949
48 Ga0070665_100168516 3300005548 Bacteria 2192
49 Ga0070704_100000443 3300005549 Bacteria 19456
50 Ga0068855_100123934 3300005563 Bacteria 2956
51 Ga0068854_100000515 3300005578 Bacteria 23453
52 Ga0068856_100220048 3300005614 Bacteria 1914
53 Ga0070702_100000388 3300005615 Bacteria 15624
54 Ga0068852_100354167 3300005616 Bacteria 1434
55 Ga0068859_100004705 3300005617 Bacteria 13869
56 Ga0068859_100008485 3300005617 Bacteria 10396
57 Ga0068859_100065412 3300005617 Bacteria 3670
58 Ga0068864_100089645 3300005618 Bacteria 2710
59 Ga0068864_100207209 3300005618 Bacteria 1804
60 Ga0068864_100422587 3300005618 Bacteria 1270
61 Ga0068866_10015834 3300005718 Bacteria 3359
62 Ga0068861_100002353 3300005719 Bacteria 12296
63 Ga0068861_100185629 3300005719 Bacteria 1734
64 Ga0068861_100262241 3300005719 Bacteria 1480
65 Ga0068863_100000768 3300005841 Bacteria 32211
66 Ga0068863_100024342 3300005841 Bacteria 5775
67 Ga0068863_100062140 3300005841 Bacteria 3533
68 Ga0068858_100011931 3300005842 Bacteria 8191
69 Ga0068858_100286334 3300005842 Bacteria 1570
70 Ga0068860_100000232 3300005843 Bacteria 85501
71 Ga0068860_100006227 3300005843 Bacteria 11990
72 Ga0068862_100000055 3300005844 Bacteria 142386
73 Ga0068862_100006669 3300005844 Bacteria 9579
74 Ga0081455_10028658 3300005937 Bacteria 5084
75 Ga0075365_10017332 3300006038 Bacteria 4404
76 Ga0075365_10280015 3300006038 Bacteria 1173
77 Ga0075365_10357869 3300006038 Bacteria 1029
78 Ga0075368_10003352 3300006042 Bacteria 5337
79 Ga0075363_100000250 3300006048 Bacteria 15257
80 Ga0075363_100000371 3300006048 Bacteria 13560
81 Ga0075363_100001893 3300006048 Bacteria 8272
82 Ga0075363_100003374 3300006048 Bacteria 6783
83 Ga0075363_100029953 3300006048 Bacteria 2813
84 Ga0075363_100125922 3300006048 Bacteria 1434
85 Ga0075364_10001126 3300006051 Bacteria 14276
86 Ga0075364_10003076 3300006051 Bacteria 9425
87 Ga0075364_10006803 3300006051 Bacteria 6745
88 Ga0075364_10008737 3300006051 Bacteria 6060
89 Ga0075364_10014229 3300006051 Bacteria 4912
90 Ga0075364_10017051 3300006051 Bacteria 4529
91 Ga0075364_10046480 3300006051 Bacteria 2826
92 Ga0075364_10053760 3300006051 Bacteria 2632
93 Ga0075364_10054298 3300006051 Bacteria 2620
94 Ga0070715_10004616 3300006163 Bacteria 4539
95 Ga0070716_100003511 3300006173 Bacteria 7392
96 Ga0070712_100005346 3300006175 Bacteria 7950
97 Ga0070712_100123766 3300006175 Bacteria 1950
98 Ga0075367_10022459 3300006178 Bacteria 3539
99 Ga0075367_10040261 3300006178 Bacteria 2728
100 Ga0075367_10106661 3300006178 Bacteria 1717
101 Ga0075369_10000324 3300006186 Bacteria 14241
102 Ga0075369_10006461 3300006186 Bacteria 4434
103 Ga0075369_10009268 3300006186 Bacteria 3818
104 Ga0075369_10010059 3300006186 Bacteria 3694
105 Ga0075369_10013506 3300006186 Bacteria 3243
106 Ga0075369_10016147 3300006186 Bacteria 3008
107 Ga0075369_10027769 3300006186 Bacteria 2367
108 Ga0075369_10178757 3300006186 Bacteria 976
109 Ga0097621_100404105 3300006237 Bacteria 1223
110 Ga0075370_10000639 3300006353 Bacteria 13581
111 Ga0075370_10164460 3300006353 Bacteria 1303
112 Ga0075370_10167128 3300006353 Bacteria 1292
113 Ga0068871_100219186 3300006358 Bacteria 1648
114 Ga0075430_100087184 3300006846 Bacteria 2612
115 Ga0075430_100244065 3300006846 Bacteria 1488
116 Ga0075431_100056144 3300006847 Bacteria 4062
117 Ga0068865_100002422 3300006881 Bacteria 11018
118 Ga0068865_100200746 3300006881 Bacteria 1548
119 Ga0097620_100004705 3300006931 Bacteria 13869
120 Ga0097620_100008485 3300006931 Bacteria 10396
121 Ga0097620_100065409 3300006931 Bacteria 3670
122 Ga0105250_10080671 3300009092 Bacteria 1319
123 Ga0105245_10003366 3300009098 Bacteria 14328
124 Ga0105245_10006970 3300009098 Bacteria 9911
125 Ga0105245_10217192 3300009098 Bacteria 1843
126 Ga0105245_10671357 3300009098 Bacteria 1068
127 Ga0105247_10000029 3300009101 Bacteria 198763
128 Ga0105247_10000896 3300009101 Bacteria 22411
129 Ga0114129_10100678 3300009147 Bacteria 3998
130 Ga0105243_10001403 3300009148 Bacteria 21306
131 Ga0105243_10053595 3300009148 Bacteria 3200
132 Ga0105241_10030369 3300009174 Bacteria 4037
133 Ga0105241_10168790 3300009174 Bacteria 1806
134 Ga0105242_10000154 3300009176 Bacteria 50757
135 Ga0105242_10175303 3300009176 Bacteria 1887
136 Ga0105248_10000136 3300009177 Bacteria 85507
137 Ga0105248_10115536 3300009177 Bacteria 3027
138 Ga0105248_10407103 3300009177 Bacteria 1532
139 Ga0105237_10017165 3300009545 Bacteria 7507
140 Ga0105237_10020703 3300009545 Bacteria 6774
141 Ga0105249_10000077 3300009553 Bacteria 141905
142 Ga0105249_10012263 3300009553 Bacteria 7552
143 Ga0105249_10068926 3300009553 Bacteria 3263
144 Ga0105239_10007085 3300010375 Bacteria 12907
145 Ga0105239_10074759 3300010375 Bacteria 3725
146 Ga0105239_10158127 3300010375 Bacteria 2531
147 Ga0157369_10141139 3300013105 Bacteria 2549
148 Ga0157374_10003772 3300013296 Bacteria 12742
149 Ga0157374_10073852 3300013296 Bacteria 3219
150 Ga0157378_10006764 3300013297 Bacteria 10019
151 Ga0157378_10235143 3300013297 Bacteria 1748
152 Ga0163162_10010831 3300013306 Bacteria 8873
153 Ga0163162_10026544 3300013306 Bacteria 5725
154 Ga0163162_10120548 3300013306 Bacteria 2727
155 Ga0157372_10024936 3300013307 Bacteria 6500
156 Ga0157375_10000360 3300013308 Bacteria 41433
157 Ga0157375_10134763 3300013308 Bacteria 2592
158 Ga0163163_10011260 3300014325 Bacteria 8105
159 Ga0157380_10000198 3300014326 Bacteria 35239
160 Ga0182008_10199607 3300014497 Bacteria 1017
161 Ga0157377_10003096 3300014745 Bacteria 7475
162 Ga0157377_10013231 3300014745 Bacteria 4173
163 Ga0157379_10005346 3300014968 Bacteria 11035
164 Ga0163161_10001293 3300017792 Bacteria 18669
165 Ga0213876_10026232 3300021384 Bacteria 3073
166 Ga0213876_10034834 3300021384 Bacteria 2655
167 Ga0213876_10075840 3300021384 Bacteria 1776
168 Ga0209051_1000011 3300025303 Bacteria 610828
169 Ga0207642_10000793 3300025899 Bacteria 9805
170 Ga0207642_10098404 3300025899 Bacteria 1462
171 Ga0207710_10000046 3300025900 Bacteria 198754
172 Ga0207710_10028242 3300025900 Bacteria 2435
173 Ga0207688_10000490 3300025901 Bacteria 19049
174 Ga0207688_10001081 3300025901 Bacteria 13962
175 Ga0207680_10145903 3300025903 Bacteria 1573
176 Ga0207685_10005973 3300025905 Bacteria 3270
177 Ga0207699_10056247 3300025906 Bacteria 2344
178 Ga0207654_10023474 3300025911 Bacteria 3304
179 Ga0207671_10029394 3300025914 Bacteria 4103
180 Ga0207671_10204620 3300025914 Bacteria 1542
181 Ga0207693_10003656 3300025915 Bacteria 13127
182 Ga0207693_10017004 3300025915 Bacteria 5807
183 Ga0207663_10001094 3300025916 Bacteria 12456
184 Ga0207660_10204428 3300025917 Bacteria 1544
185 Ga0207652_10130564 3300025921 Bacteria 2241
186 Ga0207652_10451944 3300025921 Bacteria 1158
187 Ga0207646_10179248 3300025922 Bacteria 1914
188 Ga0207681_10002502 3300025923 Bacteria 11674
189 Ga0207681_10116618 3300025923 Bacteria 1951
190 Ga0207687_10070369 3300025927 Bacteria 2498
191 Ga0207700_10318343 3300025928 Bacteria 1347
192 Ga0207664_10047292 3300025929 Bacteria 3379
193 Ga0207664_10117511 3300025929 Bacteria 2220
194 Ga0207664_10180354 3300025929 Bacteria 1813
195 Ga0207644_10038754 3300025931 Bacteria 3359
196 Ga0207706_10001079 3300025933 Bacteria 27701
197 Ga0207686_10003023 3300025934 Bacteria 9063
198 Ga0207709_10001668 3300025935 Bacteria 14959
199 Ga0207669_10000085 3300025937 Bacteria 47505
200 Ga0207669_10160565 3300025937 Bacteria 1587
201 Ga0207704_10001197 3300025938 Bacteria 11568
202 Ga0207665_10001261 3300025939 Bacteria 17077
203 Ga0207711_10000111 3300025941 Bacteria 85466
204 Ga0207711_10016364 3300025941 Bacteria 6164
205 Ga0207711_10240861 3300025941 Bacteria 1658
206 Ga0207667_10028562 3300025949 Bacteria 6057
207 Ga0207712_10000017 3300025961 Bacteria 337943
208 Ga0207712_10004582 3300025961 Bacteria 8724
209 Ga0207668_10003089 3300025972 Bacteria 9763
210 Ga0207668_10290685 3300025972 Bacteria 1344
211 Ga0207640_10001274 3300025981 Bacteria 13695
212 Ga0207658_10000612 3300025986 Bacteria 31708
213 Ga0207658_10002337 3300025986 Bacteria 13930
214 Ga0207658_10096209 3300025986 Bacteria 2309
215 Ga0207677_10004137 3300026023 Bacteria 7762
216 Ga0207703_10007578 3300026035 Bacteria 8605
217 Ga0207703_10179201 3300026035 Bacteria 1869
218 Ga0207639_10027934 3300026041 Bacteria 4114
219 Ga0207678_10012143 3300026067 Bacteria 7565
220 Ga0207678_10050445 3300026067 Bacteria 3595
221 Ga0207708_10000329 3300026075 Bacteria 37329
222 Ga0207708_10042797 3300026075 Bacteria 3451
223 Ga0207702_10088524 3300026078 Bacteria 2705
224 Ga0207641_10000378 3300026088 Bacteria 53027
225 Ga0207648_10000112 3300026089 Bacteria 78746
226 Ga0207648_10266619 3300026089 Bacteria 1529
227 Ga0207676_10187796 3300026095 Bacteria 1816
228 Ga0207676_10254690 3300026095 Bacteria 1582
229 Ga0207675_100000117 3300026118 Bacteria 64829
230 Ga0207675_100057801 3300026118 Bacteria 3619
231 Ga0207683_10001010 3300026121 Bacteria 25655
232 Ga0207683_10103155 3300026121 Bacteria 2547
233 Ga0207683_10120536 3300026121 Bacteria 2354
234 Ga0207698_10071841 3300026142 Bacteria 2748
235 Ga0268266_10007856 3300028379 Bacteria 9555
236 Ga0268266_10009705 3300028379 Bacteria 8459
237 Ga0268266_10045058 3300028379 Bacteria 3772
238 Ga0268265_10000067 3300028380 Bacteria 142389
239 Ga0268265_10101702 3300028380 Bacteria 2322
240 Ga0268264_10000146 3300028381 Bacteria 165733
241 Ga0268264_10008994 3300028381 Bacteria 8288
242 Ga0265327_10002845 3300031251 Bacteria 17454
243 Ga0307413_10043101 3300031824 Bacteria 2657
244 Ga0307409_100084939 3300031995 Bacteria 2572
245 Ga0436364_0857146 3300037853 Bacteria 1528
246 Ga0436364_1324400 3300037853 Bacteria 12797
247 Ga0436364_1366944 3300037853 Bacteria 2317
248 Ga0436365_0119824 3300039437 Bacteria 1788
249 Ga0436365_1627569 3300039437 Bacteria 24179
250 Ga0436365_1677585 3300039437 Bacteria 13537
251 Ga0436361_0780316 3300039447 Bacteria 1276
252 Ga0439461_0000333 3300041410 Bacteria 6704
253 Ga0439466_0009818 3300041411 Bacteria 3565
254 Ga0439466_0020154 3300041411 Bacteria 2380
255 Ga0439466_0025547 3300041411 Bacteria 2062
256 Ga0439465_0014100 3300041413 Bacteria 2490
257 Ga0439465_0031070 3300041413 Bacteria 1700
258 Ga0439431_0001214 3300041997 Bacteria 5638
259 Ga0439431_0027823 3300041997 Bacteria 1391
260 Ga0466972_0024180 3300044658 Bacteria 3015
261 Ga0466972_0028340 3300044658 Bacteria 2763
262 Ga0466965_0020424 3300044683 Bacteria 3184
263 Ga0466965_0021653 3300044683 Bacteria 3096
264 Ga0466965_0024990 3300044683 Bacteria 2890
265 Ga0466965_0036117 3300044683 Bacteria 2423
266 Ga0466966_0041934 3300044684 Bacteria 2940
267 Ga0466966_0124186 3300044684 Bacteria 1584
268 Ga0466961_0012523 3300044693 Bacteria 5428
269 Ga0466971_0006534 3300044719 Bacteria 5068
270 Ga0466968_0001773 3300044735 Bacteria 7781
271 Ga0466968_0004509 3300044735 Bacteria 5209
272 Ga0466968_0011644 3300044735 Bacteria 3431
273 Ga0466970_0053525 3300044765 Bacteria 2155
274 Ga0466970_0194719 3300044765 Bacteria 1127
275 Ga0466957_0007979 3300044842 Bacteria 6006
276 Ga0466957_0013945 3300044842 Bacteria 4673
277 Ga0466957_0021222 3300044842 Bacteria 3825
278 Ga0466960_0001264 3300044901 Bacteria 9161
279 Ga0466960_0002264 3300044901 Bacteria 7196
280 Ga0466960_0002440 3300044901 Bacteria 7007
281 Ga0466959_0006371 3300045049 Bacteria 8170
282 Ga0466959_0022063 3300045049 Bacteria 4702
283 Ga0466959_0089345 3300045049 Bacteria 2213
284 Ga0466959_0103386 3300045049 Bacteria 2038
285 Ga0466959_0182410 3300045049 Bacteria 1468
286 Ga0466967_0001542 3300045976 Bacteria 13484
287 Ga0466967_0004333 3300045976 Bacteria 9545
288 Ga0466967_0020106 3300045976 Bacteria 5387
289 Ga0466967_0204936 3300045976 Bacteria 1869
290 Ga0466967_0282854 3300045976 Bacteria 1592
291 Ga0466967_0363132 3300045976 Bacteria 1403
292 Ga0466967_0529239 3300045976 Bacteria 1159
293 Ga0495603_0034983 3300046455 Bacteria 3019
294 Ga0495638_0002021 3300046460 Bacteria 17284
295 Ga0495638_0027057 3300046460 Bacteria 3714
296 Ga0495594_0109976 3300046499 Bacteria 1554
297 Ga0495648_0024211 3300046524 Bacteria 4141
298 Ga0495640_0303454 3300046533 Bacteria 991
299 Ga0495635_0087570 3300046663 Bacteria 2131
300 Ga0495635_0178222 3300046663 Bacteria 1445
301 Ga0495658_0050052 3300046683 Bacteria 2362
302 Ga0495581_0063702 3300047315 Bacteria 2130
303 Ga0495604_0225873 3300047317 Bacteria 1287
304 Ga0495674_0045722 3300047319 Bacteria 3887
305 Ga0495672_0011179 3300047320 Bacteria 6347
306 Ga0495672_0097180 3300047320 Bacteria 1604
307 Ga0495673_0007303 3300047469 Bacteria 6374
308 Ga0496100_0002292 3300048903 Bacteria 9678
309 Ga0496100_0004606 3300048903 Bacteria 7327
310 Ga0496100_0145459 3300048903 Bacteria 1685
311 Ga0496101_0001416 3300048904 Bacteria 14347
312 Ga0496101_0004046 3300048904 Bacteria 9162
313 Ga0496101_0247021 3300048904 Bacteria 1390
314 Ga0496102_0000268 3300048905 Bacteria 66717
315 Ga0496102_0002915 3300048905 Bacteria 14509
316 Ga0496103_0000237 3300048906 Bacteria 53762
317 Ga0496103_0003826 3300048906 Bacteria 9159
318 Ga0496103_0119413 3300048906 Bacteria 1679
319 Ga0496104_0027681 3300048907 Bacteria 5248
320 Ga0496104_0092184 3300048907 Bacteria 2897
321 Ga0496105_0004957 3300048908 Bacteria 10066
322 Ga0496105_0200963 3300048908 Bacteria 1627
323 Ga0496106_0000556 3300048909 Bacteria 26561
324 Ga0496106_0002016 3300048909 Bacteria 15280
325 Ga0496106_0078583 3300048909 Bacteria 2532
326 Ga0496106_0213628 3300048909 Bacteria 1537
327 Ga0496107_0002431 3300048910 Bacteria 12070
328 Ga0496107_0008347 3300048910 Bacteria 7166
329 Ga0496107_0271149 3300048910 Bacteria 1263
330 Ga0496108_0000759 3300048911 Bacteria 25117
331 Ga0496108_0250911 3300048911 Bacteria 1539
332 Ga0496108_0257535 3300048911 Bacteria 1518
333 Ga0496109_0002063 3300048912 Bacteria 16675
334 Ga0496109_0036789 3300048912 Bacteria 4420
335 Ga0496110_0012303 3300048913 Bacteria 7035
336 Ga0496112_0072516 3300048915 Bacteria 3404
337 Ga0496112_0115814 3300048915 Bacteria 2650
338 Ga0496112_0181236 3300048915 Bacteria 2070
339 Ga0496112_0213206 3300048915 Bacteria 1888
340 Ga0496113_0000755 3300048916 Bacteria 16642
341 Ga0496113_0150456 3300048916 Bacteria 1836
342 Ga0496113_0265651 3300048916 Bacteria 1371
343 Ga0496114_0008299 3300048917 Bacteria 8230
344 Ga0496114_0009223 3300048917 Bacteria 7823
345 Ga0496114_0076318 3300048917 Bacteria 2824
346 Ga0496115_0038322 3300048918 Bacteria 3803
347 Ga0496116_0005366 3300048919 Bacteria 11931
348 Ga0496117_0001548 3300048920 Bacteria 32660
349 Ga0496117_0018036 3300048920 Bacteria 5870
350 Ga0496118_0000185 3300048921 Bacteria 109095
351 Ga0496118_0001284 3300048921 Bacteria 38348
352 Ga0496119_0010736 3300048922 Bacteria 7676
353 Ga0496121_0002754 3300048924 Bacteria 26134
354 Ga0496122_0106608 3300048925 Bacteria 1854
355 Ga0496123_0015102 3300048926 Bacteria 6354
356 Ga0496125_0022578 3300048928 Bacteria 5837
357 Ga0496125_0068376 3300048928 Bacteria 2795
358 Ga0496126_0002221 3300048929 Bacteria 26860
359 Ga0496126_0003959 3300048929 Bacteria 18114
360 Ga0496126_0004250 3300048929 Bacteria 17244
361 Ga0496126_0036178 3300048929 Bacteria 4619
362 Ga0496126_0058696 3300048929 Bacteria 3467
363 Ga0501032_0087766 3300049569 Bacteria 2065
364 Ga0501033_0012647 3300049570 Bacteria 6439
365 Ga0501034_0003163 3300049571 Bacteria 18924
366 Ga0501034_0104888 3300049571 Bacteria 2820
367 Ga0501037_0001502 3300049573 Bacteria 17059
368 Ga0501037_0006647 3300049573 Bacteria 8458
369 Ga0501038_0001711 3300049574 Bacteria 20376
370 Ga0501039_0000526 3300049575 Bacteria 27681
371 Ga0501043_0000633 3300049579 Bacteria 31114
372 Ga0501043_0066359 3300049579 Bacteria 2834
373 Ga0501043_0155548 3300049579 Bacteria 1788
374 Ga0501046_0001136 3300049580 Bacteria 25942
375 Ga0501047_0015589 3300049581 Bacteria 7241
376 Ga0501047_0053710 3300049581 Bacteria 3897
377 Ga0501048_0001774 3300049582 Bacteria 16425
378 Ga0501068_0036597 3300049584 Bacteria 2936
379 Ga0501070_0000448 3300049586 Bacteria 37506
380 Ga0501070_0000622 3300049586 Bacteria 32559
381 Ga0501073_0034562 3300049589 Bacteria 3597
382 Ga0501080_0335908 3300049742 Bacteria 1366
383 Ga0501035_0000147 3300049822 Bacteria 85803
384 Ga0501035_0003391 3300049822 Bacteria 15239
385 Ga0501044_0000152 3300049823 Bacteria 85715
386 Ga0501044_0001366 3300049823 Bacteria 28620
387 Ga0501044_0019884 3300049823 Bacteria 7173
388 Ga0501044_0314911 3300049823 Bacteria 1491
389 Ga0501044_0528476 3300049823 Bacteria 1079
390 nmdc:mga03683_12053_c1 3300050489 Bacteria 3146
391 nmdc:mga03n38_1468_c1 3300050490 Bacteria 6783
392 nmdc:mga03n38_63146_c1 3300050490 Bacteria 1692
393 nmdc:mga03n38_784_c1 3300050490 Bacteria 8440
394 nmdc:mga03n38_8563_c1 3300050490 Bacteria 3679
395 nmdc:mga00v17_12608_c1 3300050491 Bacteria 4668
396 nmdc:mga00v17_13093_c1 3300050491 Bacteria 4596
397 nmdc:mga00v17_190441_c1 3300050491 Bacteria 1325
398 nmdc:mga00v17_22499_c1 3300050491 Bacteria 3637
399 nmdc:mga00v17_329_c1 3300050491 Bacteria 26668
400 nmdc:mga00v17_9401_c1 3300050491 Bacteria 5288
401 nmdc:mga0yw44_116796_c1 3300050492 Bacteria 1715
402 nmdc:mga0yw44_12785_c1 3300050492 Bacteria 4390
403 nmdc:mga0yw44_130877_c1 3300050492 Bacteria 1624
404 nmdc:mga0yw44_131057_c1 3300050492 Bacteria 1623
405 nmdc:mga0yw44_13432_c1 3300050492 Bacteria 4312
406 nmdc:mga0yw44_16132_c1 3300050492 Bacteria 4028
407 nmdc:mga06z11_108906_c1 3300050494 Bacteria 1531
408 nmdc:mga06z11_26863_c1 3300050494 Bacteria 2745
409 nmdc:mga06z11_5655_c1 3300050494 Bacteria 5036
410 nmdc:mga04h51_9097_c1 3300050495 Bacteria 2678
411 nmdc:mga07m45_150831_c1 3300050496 Bacteria 1348
412 nmdc:mga07m45_22982_c1 3300050496 Bacteria 3406
413 nmdc:mga05p37_49723_c1 3300050507 Bacteria 5157
414 nmdc:mga0qj67_78842_c1 3300050509 Bacteria 2637
415 nmdc:mga0qj67_88643_c1 3300050509 Bacteria 2484
416 nmdc:mga06r32_35846_c1 3300050510 Bacteria 4681
417 nmdc:mga0sz30_1699_c2 3300050516 Bacteria 6694
418 nmdc:mga0sz30_31624_c1 3300050516 Bacteria 2191
419 Ga0500610_0001392 3300053079 Bacteria 8209
420 Ga0500578_0136562 3300053086 Bacteria 1535
421 Ga0500643_004742 3300053087 Bacteria 6038
422 Ga0500643_052332 3300053087 Bacteria 1164
423 Ga0500556_0004661 3300053104 Bacteria 3892
424 Ga0500608_050962 3300053122 Bacteria 1989
425 Ga0500652_006032 3300053131 Bacteria 3867
426 Ga0500652_017391 3300053131 Bacteria 2635
427 Ga0500616_0001970 3300053153 Bacteria 18263
428 Ga0500616_0041435 3300053153 Bacteria 2471
429 Ga0500627_0122667 3300053158 Bacteria 1172
430 Ga0500645_000181 3300053730 Bacteria 49626
431 Ga0500645_065972 3300053730 Bacteria 1042
432 Ga0466962_0001728 3300061719 Bacteria 10266
433 Ga0466962_0026204 3300061719 Bacteria 2800
434 2523382983 2523231044 Bacteria 6434991
435 2548696597 2547132424 Bacteria 8348532
436 2644635942 2643221715 Bacteria 6671032
437 2686539983 2684623035 Bacteria 8032739
438 2689994291 2687453743 Bacteria 8361025
439 2738666974 2738541264 Bacteria 5935393
440 2738707854 2738541274 Bacteria 6909446
441 2738890824 2738541308 Bacteria 7020677
442 2739145818 2738541356 Bacteria 5935017
443 2739334193 2738543028 Bacteria 6917070
444 2744955432 2744054611 Bacteria 5611514
445 2774854311 2773857922 Bacteria 9757215
446 2842140201 2842134933 Bacteria 5847019
447 2895888800 2895880812 Bacteria 11255272
448 2902802023 2902799365 Bacteria 5419524
449 2902811976 2902810491 Bacteria 6794147
450 2919713511 2919713450 Bacteria 7431245
451 2929216834 2929212328 Bacteria 7708288
452 2939588871 2939582691 Bacteria 7088898
453 Ga0466971_0025960
454 JGI24750J21931_1001356
455 JGI24744J21845_10000032
456 Ga0070666_10027913
457 Ga0070680_100223617
458 Ga0070682_100136134
459 Ga0070682_100140647
460 Ga0070682_100192259
461 Ga0068868_100000580
462 Ga0068868_100086363
463 Ga0068868_100315148
464 Ga0070691_10009621
465 Ga0070692_10026676
466 Ga0070668_100018953
467 Ga0070668_100136661
468 Ga0070669_100003319
469 Ga0070669_100014029
470 Ga0070675_100143679
471 Ga0070671_100045094
472 Ga0070674_100002296
473 Ga0070659_100021093
474 Ga0070667_100000679
475 Ga0070667_100004487
476 Ga0070667_100014438
477 Ga0070667_100084078
478 Ga0070703_10044955
479 Ga0070709_10081654
480 Ga0070714_100025201
481 Ga0070714_100433276
482 Ga0070710_10017207
483 Ga0070710_10019592
484 Ga0070711_100003082
485 Ga0070705_100003700
486 Ga0070700_100004233
487 Ga0070663_100015257
488 Ga0070678_100000938
489 Ga0070678_100243940
490 Ga0070662_100003256
491 Ga0068867_100012996
492 Ga0070685_10010992
493 Ga0070685_10151227
494 Ga0070686_100281020
495 Ga0070695_100238913
496 Ga0070696_100001497
497 Ga0070693_100007815
498 Ga0070665_100009543
499 Ga0070665_100036411
500 Ga0070665_100168516
501 Ga0070704_100000443
502 Ga0068855_100123934
503 Ga0068854_100000515
504 Ga0068856_100220048
505 Ga0070702_100000388
506 Ga0068852_100354167
507 Ga0068859_100004705
508 Ga0068859_100008485
509 Ga0068859_100065412
510 Ga0068864_100089645
511 Ga0068864_100207209
512 Ga0068864_100422587
513 Ga0068866_10015834
514 Ga0068861_100002353
515 Ga0068861_100185629
516 Ga0068861_100262241
517 Ga0068863_100000768
518 Ga0068863_100024342
519 Ga0068863_100062140
520 Ga0068858_100011931
521 Ga0068858_100286334
522 Ga0068860_100000232
523 Ga0068860_100006227
524 Ga0068862_100000055
525 Ga0068862_100006669
526 Ga0081455_10028658
527 Ga0075365_10017332
528 Ga0075365_10280015
529 Ga0075365_10357869
530 Ga0075368_10003352
531 Ga0075363_100000250
532 Ga0075363_100000371
533 Ga0075363_100001893
534 Ga0075363_100003374
535 Ga0075363_100029953
536 Ga0075363_100125922
537 Ga0075364_10001126
538 Ga0075364_10003076
539 Ga0075364_10006803
540 Ga0075364_10008737
541 Ga0075364_10014229
542 Ga0075364_10017051
543 Ga0075364_10046480
544 Ga0075364_10053760
545 Ga0075364_10054298
546 Ga0070715_10004616
547 Ga0070716_100003511
548 Ga0070712_100005346
549 Ga0070712_100123766
550 Ga0075367_10022459
551 Ga0075367_10040261
552 Ga0075367_10106661
553 Ga0075369_10000324
554 Ga0075369_10006461
555 Ga0075369_10009268
556 Ga0075369_10010059
557 Ga0075369_10013506
558 Ga0075369_10016147
559 Ga0075369_10027769
560 Ga0075369_10178757
561 Ga0097621_100404105
562 Ga0075370_10000639
563 Ga0075370_10164460
564 Ga0075370_10167128
565 Ga0068871_100219186
566 Ga0075430_100087184
567 Ga0075430_100244065
568 Ga0075431_100056144
569 Ga0068865_100002422
570 Ga0068865_100200746
571 Ga0097620_100004705
572 Ga0097620_100008485
573 Ga0097620_100065409
574 Ga0105250_10080671
575 Ga0105245_10003366
576 Ga0105245_10006970
577 Ga0105245_10217192
578 Ga0105245_10671357
579 Ga0105247_10000029
580 Ga0105247_10000896
581 Ga0114129_10100678
582 Ga0105243_10001403
583 Ga0105243_10053595
584 Ga0105241_10030369
585 Ga0105241_10168790
586 Ga0105242_10000154
587 Ga0105242_10175303
588 Ga0105248_10000136
589 Ga0105248_10115536
590 Ga0105248_10407103
591 Ga0105237_10017165
592 Ga0105237_10020703
593 Ga0105249_10000077
594 Ga0105249_10012263
595 Ga0105249_10068926
596 Ga0105239_10007085
597 Ga0105239_10074759
598 Ga0105239_10158127
599 Ga0157369_10141139
600 Ga0157374_10003772
601 Ga0157374_10073852
602 Ga0157378_10006764
603 Ga0157378_10235143
604 Ga0163162_10010831
605 Ga0163162_10026544
606 Ga0163162_10120548
607 Ga0157372_10024936
608 Ga0157375_10000360
609 Ga0157375_10134763
610 Ga0163163_10011260
611 Ga0157380_10000198
612 Ga0182008_10199607
613 Ga0157377_10003096
614 Ga0157377_10013231
615 Ga0157379_10005346
616 Ga0163161_10001293
617 Ga0213876_10026232
618 Ga0213876_10034834
619 Ga0213876_10075840
620 Ga0209051_1000011
621 Ga0207642_10000793
622 Ga0207642_10098404
623 Ga0207710_10000046
624 Ga0207710_10028242
625 Ga0207688_10000490
626 Ga0207688_10001081
627 Ga0207680_10145903
628 Ga0207685_10005973
629 Ga0207699_10056247
630 Ga0207654_10023474
631 Ga0207671_10029394
632 Ga0207671_10204620
633 Ga0207693_10003656
634 Ga0207693_10017004
635 Ga0207663_10001094
636 Ga0207660_10204428
637 Ga0207652_10130564
638 Ga0207652_10451944
639 Ga0207646_10179248
640 Ga0207681_10002502
641 Ga0207681_10116618
642 Ga0207687_10070369
643 Ga0207700_10318343
644 Ga0207664_10047292
645 Ga0207664_10117511
646 Ga0207664_10180354
647 Ga0207644_10038754
648 Ga0207706_10001079
649 Ga0207686_10003023
650 Ga0207709_10001668
651 Ga0207669_10000085
652 Ga0207669_10160565
653 Ga0207704_10001197
654 Ga0207665_10001261
655 Ga0207711_10000111
656 Ga0207711_10016364
657 Ga0207711_10240861
658 Ga0207667_10028562
659 Ga0207712_10000017
660 Ga0207712_10004582
661 Ga0207668_10003089
662 Ga0207668_10290685
663 Ga0207640_10001274
664 Ga0207658_10000612
665 Ga0207658_10002337
666 Ga0207658_10096209
667 Ga0207677_10004137
668 Ga0207703_10007578
669 Ga0207703_10179201
670 Ga0207639_10027934
671 Ga0207678_10012143
672 Ga0207678_10050445
673 Ga0207708_10000329
674 Ga0207708_10042797
675 Ga0207702_10088524
676 Ga0207641_10000378
677 Ga0207648_10000112
678 Ga0207648_10266619
679 Ga0207676_10187796
680 Ga0207676_10254690
681 Ga0207675_100000117
682 Ga0207675_100057801
683 Ga0207683_10001010
684 Ga0207683_10103155
685 Ga0207683_10120536
686 Ga0207698_10071841
687 Ga0268266_10007856
688 Ga0268266_10009705
689 Ga0268266_10045058
690 Ga0268265_10000067
691 Ga0268265_10101702
692 Ga0268264_10000146
693 Ga0268264_10008994
694 Ga0265327_10002845
695 Ga0307413_10043101
696 Ga0307409_100084939
697 Ga0436364_0857146
698 Ga0436364_1324400
699 Ga0436364_1366944
700 Ga0436365_0119824
701 Ga0436365_1627569
702 Ga0436365_1677585
703 Ga0436361_0780316
704 Ga0439461_0000333
705 Ga0439466_0009818
706 Ga0439466_0020154
707 Ga0439466_0025547
708 Ga0439465_0014100
709 Ga0439465_0031070
710 Ga0439431_0001214
711 Ga0439431_0027823
712 Ga0466972_0024180
713 Ga0466972_0028340
714 Ga0466965_0020424
715 Ga0466965_0021653
716 Ga0466965_0024990
717 Ga0466965_0036117
718 Ga0466966_0041934
719 Ga0466966_0124186
720 Ga0466961_0012523
721 Ga0466971_0006534
722 Ga0466968_0001773
723 Ga0466968_0004509
724 Ga0466968_0011644
725 Ga0466970_0053525
726 Ga0466970_0194719
727 Ga0466957_0007979
728 Ga0466957_0013945
729 Ga0466957_0021222
730 Ga0466960_0001264
731 Ga0466960_0002264
732 Ga0466960_0002440
733 Ga0466959_0006371
734 Ga0466959_0022063
735 Ga0466959_0089345
736 Ga0466959_0103386
737 Ga0466959_0182410
738 Ga0466967_0001542
739 Ga0466967_0004333
740 Ga0466967_0020106
741 Ga0466967_0204936
742 Ga0466967_0282854
743 Ga0466967_0363132
744 Ga0466967_0529239
745 Ga0495603_0034983
746 Ga0495638_0002021
747 Ga0495638_0027057
748 Ga0495594_0109976
749 Ga0495648_0024211
750 Ga0495640_0303454
751 Ga0495635_0087570
752 Ga0495635_0178222
753 Ga0495658_0050052
754 Ga0495581_0063702
755 Ga0495604_0225873
756 Ga0495674_0045722
757 Ga0495672_0011179
758 Ga0495672_0097180
759 Ga0495673_0007303
760 Ga0496100_0002292
761 Ga0496100_0004606
762 Ga0496100_0145459
763 Ga0496101_0001416
764 Ga0496101_0004046
765 Ga0496101_0247021
766 Ga0496102_0000268
767 Ga0496102_0002915
768 Ga0496103_0000237
769 Ga0496103_0003826
770 Ga0496103_0119413
771 Ga0496104_0027681
772 Ga0496104_0092184
773 Ga0496105_0004957
774 Ga0496105_0200963
775 Ga0496106_0000556
776 Ga0496106_0002016
777 Ga0496106_0078583
778 Ga0496106_0213628
779 Ga0496107_0002431
780 Ga0496107_0008347
781 Ga0496107_0271149
782 Ga0496108_0000759
783 Ga0496108_0250911
784 Ga0496108_0257535
785 Ga0496109_0002063
786 Ga0496109_0036789
787 Ga0496110_0012303
788 Ga0496112_0072516
789 Ga0496112_0115814
790 Ga0496112_0181236
791 Ga0496112_0213206
792 Ga0496113_0000755
793 Ga0496113_0150456
794 Ga0496113_0265651
795 Ga0496114_0008299
796 Ga0496114_0009223
797 Ga0496114_0076318
798 Ga0496115_0038322
799 Ga0496116_0005366
800 Ga0496117_0001548
801 Ga0496117_0018036
802 Ga0496118_0000185
803 Ga0496118_0001284
804 Ga0496119_0010736
805 Ga0496121_0002754
806 Ga0496122_0106608
807 Ga0496123_0015102
808 Ga0496125_0022578
809 Ga0496125_0068376
810 Ga0496126_0002221
811 Ga0496126_0003959
812 Ga0496126_0004250
813 Ga0496126_0036178
814 Ga0496126_0058696
815 Ga0501032_0087766
816 Ga0501033_0012647
817 Ga0501034_0003163
818 Ga0501034_0104888
819 Ga0501037_0001502
820 Ga0501037_0006647
821 Ga0501038_0001711
822 Ga0501039_0000526
823 Ga0501043_0000633
824 Ga0501043_0066359
825 Ga0501043_0155548
826 Ga0501046_0001136
827 Ga0501047_0015589
828 Ga0501047_0053710
829 Ga0501048_0001774
830 Ga0501068_0036597
831 Ga0501070_0000448
832 Ga0501070_0000622
833 Ga0501073_0034562
834 Ga0501080_0335908
835 Ga0501035_0000147
836 Ga0501035_0003391
837 Ga0501044_0000152
838 Ga0501044_0001366
839 Ga0501044_0019884
840 Ga0501044_0314911
841 Ga0501044_0528476
842 nmdc:mga03683_12053_c1
843 nmdc:mga03n38_1468_c1
844 nmdc:mga03n38_63146_c1
845 nmdc:mga03n38_784_c1
846 nmdc:mga03n38_8563_c1
847 nmdc:mga00v17_12608_c1
848 nmdc:mga00v17_13093_c1
849 nmdc:mga00v17_190441_c1
850 nmdc:mga00v17_22499_c1
851 nmdc:mga00v17_329_c1
852 nmdc:mga00v17_9401_c1
853 nmdc:mga0yw44_116796_c1
854 nmdc:mga0yw44_12785_c1
855 nmdc:mga0yw44_130877_c1
856 nmdc:mga0yw44_131057_c1
857 nmdc:mga0yw44_13432_c1
858 nmdc:mga0yw44_16132_c1
859 nmdc:mga06z11_108906_c1
860 nmdc:mga06z11_26863_c1
861 nmdc:mga06z11_5655_c1
862 nmdc:mga04h51_9097_c1
863 nmdc:mga07m45_150831_c1
864 nmdc:mga07m45_22982_c1
865 nmdc:mga05p37_49723_c1
866 nmdc:mga0qj67_78842_c1
867 nmdc:mga0qj67_88643_c1
868 nmdc:mga06r32_35846_c1
869 nmdc:mga0sz30_1699_c2
870 nmdc:mga0sz30_31624_c1
871 Ga0500610_0001392
872 Ga0500578_0136562
873 Ga0500643_004742
874 Ga0500643_052332
875 Ga0500556_0004661
876 Ga0500608_050962
877 Ga0500652_006032
878 Ga0500652_017391
879 Ga0500616_0001970
880 Ga0500616_0041435
881 Ga0500627_0122667
882 Ga0500645_000181
883 Ga0500645_065972
884 Ga0466962_0001728
885 Ga0466962_0026204
886 2523382983
887 2548696597
888 2644635942
889 2686539983
890 2689994291
891 2738666974
892 2738707854
893 2738890824
894 2739145818
895 2739334193
896 2744955432
897 2774854311
898 2842140201
899 2895888800
900 2902802023
901 2902811976
902 2919713511
903 2929216834
904 2939588871

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03308

MeaB

Methylmalonyl Co-A mutase-associated GTPase MeaB

19

133

0.92

PF03308

MeaB

Methylmalonyl Co-A mutase-associated GTPase MeaB

131

244

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lc1-assembly1.cif.gz_A meab, a bacterial homolog of mmaa, bound to gdp and crystallized in the presence of gdp and [alf4]- 0.8041 1 286
5cjt-assembly1.cif.gz_B isobutyryl-coa mutase fused with bound adenosylcobalamin, gdp, mg (holo-icmf/gdp), and substrate isobutyryl-coenzyme a 0.7994 7 232
2qm8-assembly1.cif.gz_B meab, a bacterial homolog of mmaa, in the nucleotide free form 0.7963 1 286
2qm7-assembly1.cif.gz_A meab, a bacterial homolog of mmaa, bound to gdp 0.7909 1 286
4jyb-assembly1.cif.gz_B meab, a bacterial homolog of mmaa, bound to gmppnp 0.7896 2 287
ID Description Score Start End Superfamily
af_Q9VP84_8_188_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8952 46 74 3.40.50.300
3tk1A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8315 41 234 3.40.50.300
af_E9AG50_57_268_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.828 39 234 3.40.50.300
2wwwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8168 41 234 3.40.50.300
3tk1A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8107 41 234 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1E3TH07-F1-model_v4 LAO/AO transport system ATPase [Frankia sp. EAN1pec] 0.9597 1 286 GO:0003924
GO:0005525
GO:0016887
AF-A1TCX7-F1-model_v4 LAO/AO transport system ATPase 0.9596 2 291 GO:0003924
GO:0005525
GO:0016887
AF-A0A6H0SAM0-F1-model_v4 Methylmalonyl Co-A mutase-associated GTPase MeaB 0.9542 1 286 GO:0005525
GO:0016787
AF-A1TCX7-F1-model_v4 LAO/AO transport system ATPase 0.9499 2 291 GO:0003924
GO:0005525
GO:0016887
AF-G8RXJ3-F1-model_v4 Methylmalonyl-CoA mutase auxilliary protein, metallochaperone 0.9497 1 291 GO:0005525
GO:0016787

Map