F446937

General Info

Members Datasets Scaffolds Average Seq Length
452 194 904 264

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100176426|Ga0068859_1001764262
Length 305
Sequence MTAPLARYTPEASDTDPSDGRMGFLDHLDELRTRIIRSLIAIGAGMLVSVLFIDRIARFVLAPTLRILPPGTTLIYTKAGEGLSFYMDVALIGGVVLSAPLVMYQVWRFIAPGLYANEKKFAIPFVVLTTAGSLGGALFSHYILFPGMIAFLGTFNPALMKFTPRVEDTFDLYKNLLIGMVVVFQMPTLVFFLAKMRLVTGRFLWRHIKYAILIIFIIAAVLTPSTDPWNQAVFAAPMVGLYLISIGLAWIVGPRREKDASSSPRDSNSLRLVFAAAVLDRAARQSGRRSLLPFPRLGADRYRSS

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
131 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
158 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.97
Rhizosphere 93.36
Stem 0
Stem Tuber 0
Unclassified 23.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100176426 3300005617 Bacteria 2219
2 JGI25406J46586_10068503 3300003203 Bacteria 1121
3 Ga0065715_10274004 3300005293 Unclassified 1103
4 Ga0065707_10000940 3300005295 Bacteria 19288
5 Ga0065707_10134858 3300005295 Bacteria 1859
6 Ga0065707_10284920 3300005295 Bacteria 1038
7 Ga0070683_100152535 3300005329 Bacteria 2191
8 Ga0070690_100093257 3300005330 Unclassified 1986
9 Ga0070670_100261252 3300005331 Bacteria 1509
10 Ga0070677_10069182 3300005333 Unclassified 1480
11 Ga0068869_100306075 3300005334 Unclassified 1285
12 Ga0070666_10036636 3300005335 Bacteria 3258
13 Ga0070666_10060864 3300005335 Unclassified 2556
14 Ga0070666_10192188 3300005335 Bacteria 1434
15 Ga0068868_100056161 3300005338 Bacteria 3108
16 Ga0068868_100084872 3300005338 Bacteria 2543
17 Ga0068868_100124839 3300005338 Unclassified 2102
18 Ga0068868_100211450 3300005338 Bacteria 1621
19 Ga0070668_100305139 3300005347 Bacteria 1336
20 Ga0070671_100008003 3300005355 Bacteria 8462
21 Ga0070674_100087520 3300005356 Bacteria 2240
22 Ga0070673_100004895 3300005364 Bacteria 8527
23 Ga0070673_100069334 3300005364 Bacteria 2826
24 Ga0070673_100237695 3300005364 Unclassified 1583
25 Ga0070673_100300633 3300005364 Bacteria 1413
26 Ga0070667_100006327 3300005367 Bacteria 9843
27 Ga0070709_10081235 3300005434 Bacteria 2115
28 Ga0070713_100021635 3300005436 Bacteria 4952
29 Ga0070694_100282429 3300005444 Bacteria 1266
30 Ga0070708_100159123 3300005445 Bacteria 2104
31 Ga0070708_100177408 3300005445 Bacteria 1991
32 Ga0070708_100299352 3300005445 Bacteria 1514
33 Ga0070708_100516577 3300005445 Bacteria 1127
34 Ga0070678_100042900 3300005456 Bacteria 3219
35 Ga0068867_100084709 3300005459 Bacteria 2395
36 Ga0068867_100172907 3300005459 Unclassified 1712
37 Ga0070685_10106430 3300005466 Bacteria 1721
38 Ga0070706_100322096 3300005467 Bacteria 1441
39 Ga0070706_100565881 3300005467 Bacteria 1057
40 Ga0070707_100248511 3300005468 Bacteria 1731
41 Ga0070698_100030689 3300005471 Bacteria 5572
42 Ga0070698_100140246 3300005471 Bacteria 2369
43 Ga0070698_100180590 3300005471 Unclassified 2049
44 Ga0070698_100326442 3300005471 Bacteria 1465
45 Ga0070698_100416219 3300005471 Bacteria 1278
46 Ga0070699_100215949 3300005518 Bacteria 1708
47 Ga0070699_100374448 3300005518 Unclassified 1285
48 Ga0070679_100025286 3300005530 Bacteria 5825
49 Ga0070697_100016754 3300005536 Bacteria 5764
50 Ga0070672_100545528 3300005543 Bacteria 1006
51 Ga0070686_100001788 3300005544 Bacteria 11989
52 Ga0070686_100024951 3300005544 Bacteria 3589
53 Ga0070686_100091850 3300005544 Bacteria 2032
54 Ga0070686_100236051 3300005544 Bacteria 1329
55 Ga0070696_100310450 3300005546 Bacteria 1211
56 Ga0070696_100397228 3300005546 Bacteria 1078
57 Ga0070665_100004520 3300005548 Bacteria 14572
58 Ga0070665_100025845 3300005548 Bacteria 5913
59 Ga0070704_100001196 3300005549 Bacteria 13586
60 Ga0070704_100038820 3300005549 Bacteria 3265
61 Ga0070704_100106604 3300005549 Unclassified 2124
62 Ga0070664_100637599 3300005564 Bacteria 990
63 Ga0068854_100047843 3300005578 Bacteria 3049
64 Ga0068859_100001016 3300005617 Bacteria 28725
65 Ga0068859_100204708 3300005617 Bacteria 2058
66 Ga0068859_100317337 3300005617 Bacteria 1652
67 Ga0068866_10006661 3300005718 Bacteria 4817
68 Ga0068866_10036747 3300005718 Bacteria 2401
69 Ga0068866_10363502 3300005718 Bacteria 923
70 Ga0068861_100030495 3300005719 Bacteria 3952
71 Ga0068851_10157882 3300005834 Unclassified 1244
72 Ga0068851_10226272 3300005834 Bacteria 1053
73 Ga0068870_10091445 3300005840 Bacteria 1702
74 Ga0068863_100019348 3300005841 Bacteria 6512
75 Ga0068863_100108144 3300005841 Bacteria 2647
76 Ga0068863_100322399 3300005841 Bacteria 1501
77 Ga0068858_100053917 3300005842 Bacteria 3719
78 Ga0068858_100065737 3300005842 Bacteria 3356
79 Ga0068858_100085337 3300005842 Bacteria 2937
80 Ga0068858_100086238 3300005842 Bacteria 2921
81 Ga0068858_100112220 3300005842 Unclassified 2546
82 Ga0068858_100118341 3300005842 Bacteria 2476
83 Ga0068858_100138202 3300005842 Bacteria 2287
84 Ga0068858_100335432 3300005842 Bacteria 1447
85 Ga0068860_100023422 3300005843 Bacteria 5967
86 Ga0068860_100086722 3300005843 Bacteria 2980
87 Ga0068860_100274699 3300005843 Bacteria 1645
88 Ga0068860_100323500 3300005843 Unclassified 1514
89 Ga0068860_100374886 3300005843 Unclassified 1404
90 Ga0068860_100462715 3300005843 Bacteria 1262
91 Ga0068860_100756477 3300005843 Unclassified 984
92 Ga0068862_100038707 3300005844 Bacteria 4046
93 Ga0068862_100144180 3300005844 Bacteria 2115
94 Ga0068862_100428433 3300005844 Bacteria 1243
95 Ga0081455_10157899 3300005937 Unclassified 1741
96 Ga0081539_10005740 3300005985 Bacteria 12411
97 Ga0070717_10052149 3300006028 Unclassified 3369
98 Ga0070717_10103967 3300006028 Bacteria 2415
99 Ga0070715_10172401 3300006163 Bacteria 1079
100 Ga0070716_100053097 3300006173 Bacteria 2310
101 Ga0097621_100004353 3300006237 Bacteria 9845
102 Ga0097621_100012231 3300006237 Bacteria 6352
103 Ga0097621_100022805 3300006237 Bacteria 4864
104 Ga0097621_100031639 3300006237 Bacteria 4200
105 Ga0097621_100033736 3300006237 Bacteria 4079
106 Ga0097621_100174285 3300006237 Unclassified 1856
107 Ga0097621_100197649 3300006237 Bacteria 1744
108 Ga0097621_100559381 3300006237 Bacteria 1042
109 Ga0068871_100000308 3300006358 Bacteria 34022
110 Ga0068871_100001385 3300006358 Bacteria 16232
111 Ga0068871_100004321 3300006358 Bacteria 9870
112 Ga0068871_100040287 3300006358 Unclassified 3741
113 Ga0068871_100168555 3300006358 Bacteria 1876
114 Ga0068871_100729636 3300006358 Bacteria 909
115 Ga0075433_10044797 3300006852 Bacteria 3844
116 Ga0075433_10046012 3300006852 Bacteria 3794
117 Ga0075433_10069722 3300006852 Bacteria 3088
118 Ga0075434_100001575 3300006871 Bacteria 19332
119 Ga0075434_100081401 3300006871 Bacteria 3235
120 Ga0075434_100315087 3300006871 Bacteria 1585
121 Ga0075434_100483525 3300006871 Unclassified 1259
122 Ga0075434_100493099 3300006871 Bacteria 1246
123 Ga0075429_100215267 3300006880 Bacteria 1683
124 Ga0068865_100020279 3300006881 Bacteria 4311
125 Ga0068865_100314119 3300006881 Unclassified 1258
126 Ga0075436_100020214 3300006914 Bacteria 4570
127 Ga0075436_100041298 3300006914 Bacteria 3182
128 Ga0075436_100042817 3300006914 Bacteria 3122
129 Ga0075436_100075298 3300006914 Unclassified 2337
130 Ga0097620_100001016 3300006931 Bacteria 28725
131 Ga0097620_100176415 3300006931 Bacteria 2219
132 Ga0097620_100204711 3300006931 Bacteria 2058
133 Ga0097620_100317372 3300006931 Bacteria 1652
134 Ga0075435_100000417 3300007076 Bacteria 26219
135 Ga0075435_100021913 3300007076 Bacteria 4924
136 Ga0075435_100022519 3300007076 Bacteria 4863
137 Ga0075435_100029100 3300007076 Bacteria 4334
138 Ga0075435_100139810 3300007076 Bacteria 2031
139 Ga0075435_100215217 3300007076 Unclassified 1630
140 Ga0075435_100259678 3300007076 Bacteria 1480
141 Ga0075435_100338218 3300007076 Bacteria 1290
142 Ga0099795_10027802 3300007788 Bacteria 1917
143 Ga0111539_10002954 3300009094 Bacteria 22570
144 Ga0105245_10008432 3300009098 Bacteria 8999
145 Ga0105245_10071035 3300009098 Bacteria 3160
146 Ga0105245_10182904 3300009098 Unclassified 2004
147 Ga0105245_10560791 3300009098 Bacteria 1165
148 Ga0105247_10012013 3300009101 Bacteria 5200
149 Ga0105247_10035535 3300009101 Bacteria 3038
150 Ga0114129_10004143 3300009147 Bacteria 20488
151 Ga0114129_10007298 3300009147 Bacteria 15736
152 Ga0114129_10025472 3300009147 Bacteria 8384
153 Ga0114129_10058479 3300009147 Bacteria 5392
154 Ga0114129_10229058 3300009147 Bacteria 2503
155 Ga0114129_10904596 3300009147 Unclassified 1118
156 Ga0105243_10067815 3300009148 Bacteria 2873
157 Ga0105243_10283357 3300009148 Unclassified 1494
158 Ga0105241_10085870 3300009174 Bacteria 2474
159 Ga0105242_10021871 3300009176 Bacteria 5026
160 Ga0105242_10049571 3300009176 Bacteria 3418
161 Ga0105242_10275362 3300009176 Bacteria 1526
162 Ga0105242_10340099 3300009176 Bacteria 1383
163 Ga0105242_10646507 3300009176 Bacteria 1028
164 Ga0105242_10840017 3300009176 Bacteria 913
165 Ga0105248_10001567 3300009177 Bacteria 25445
166 Ga0105248_10021392 3300009177 Bacteria 7167
167 Ga0105248_10024186 3300009177 Bacteria 6751
168 Ga0105248_10043509 3300009177 Bacteria 5035
169 Ga0105248_10047652 3300009177 Unclassified 4807
170 Ga0105248_10062948 3300009177 Bacteria 4164
171 Ga0105248_10064889 3300009177 Bacteria 4099
172 Ga0105248_10114941 3300009177 Bacteria 3035
173 Ga0105248_10328036 3300009177 Bacteria 1724
174 Ga0105248_10655290 3300009177 Bacteria 1185
175 Ga0105248_11005256 3300009177 Bacteria 942
176 Ga0105238_10232012 3300009551 Bacteria 1822
177 Ga0105238_10642901 3300009551 Unclassified 1070
178 Ga0105249_10012606 3300009553 Bacteria 7454
179 Ga0105246_10222029 3300011119 Bacteria 1482
180 Ga0157374_10093787 3300013296 Bacteria 2867
181 Ga0157374_10284249 3300013296 Unclassified 1634
182 Ga0157378_10007290 3300013297 Bacteria 9657
183 Ga0157378_10012281 3300013297 Bacteria 7497
184 Ga0157378_10367632 3300013297 Bacteria 1409
185 Ga0157378_10552921 3300013297 Bacteria 1156
186 Ga0163162_10005014 3300013306 Bacteria 12755
187 Ga0163162_10694339 3300013306 Unclassified 1140
188 Ga0163162_10734870 3300013306 Unclassified 1107
189 Ga0163162_10756299 3300013306 Bacteria 1091
190 Ga0157372_10133391 3300013307 Bacteria 2859
191 Ga0157375_10018957 3300013308 Bacteria 6247
192 Ga0157375_10055216 3300013308 Bacteria 3916
193 Ga0157375_10269595 3300013308 Bacteria 1864
194 Ga0157375_10703930 3300013308 Bacteria 1164
195 Ga0163163_10259637 3300014325 Bacteria 1788
196 Ga0163163_10898154 3300014325 Bacteria 949
197 Ga0157380_10058409 3300014326 Bacteria 3075
198 Ga0157380_10084033 3300014326 Bacteria 2609
199 Ga0157377_10305225 3300014745 Unclassified 1052
200 Ga0157379_10002823 3300014968 Bacteria 14633
201 Ga0157379_10016425 3300014968 Bacteria 6512
202 Ga0157379_10284994 3300014968 Bacteria 1503
203 Ga0157379_10293183 3300014968 Bacteria 1482
204 Ga0157379_10438285 3300014968 Bacteria 1205
205 Ga0157376_10045942 3300014969 Bacteria 3598
206 Ga0157376_10069771 3300014969 Unclassified 2981
207 Ga0157376_10123547 3300014969 Unclassified 2298
208 Ga0157376_10391915 3300014969 Unclassified 1341
209 Ga0157376_10481530 3300014969 Bacteria 1216
210 Ga0157376_10655631 3300014969 Unclassified 1050
211 Ga0163161_10060183 3300017792 Bacteria 2764
212 Ga0163161_10363908 3300017792 Bacteria 1152
213 Ga0207710_10017308 3300025900 Unclassified 3058
214 Ga0207680_10015060 3300025903 Bacteria 4024
215 Ga0207680_10090930 3300025903 Bacteria 1941
216 Ga0207680_10344151 3300025903 Unclassified 1046
217 Ga0207685_10048611 3300025905 Bacteria 1626
218 Ga0207685_10162854 3300025905 Bacteria 1020
219 Ga0207699_10010686 3300025906 Unclassified 4616
220 Ga0207699_10328793 3300025906 Unclassified 1074
221 Ga0207645_10357515 3300025907 Bacteria 978
222 Ga0207643_10097396 3300025908 Bacteria 1721
223 Ga0207654_10164645 3300025911 Bacteria 1435
224 Ga0207695_10093441 3300025913 Bacteria 3017
225 Ga0207652_10012813 3300025921 Bacteria 6780
226 Ga0207652_10071759 3300025921 Bacteria 3009
227 Ga0207652_10128390 3300025921 Bacteria 2259
228 Ga0207646_10508884 3300025922 Unclassified 1084
229 Ga0207694_10388548 3300025924 Unclassified 1159
230 Ga0207650_10236778 3300025925 Unclassified 1474
231 Ga0207650_10411962 3300025925 Bacteria 1120
232 Ga0207659_10000196 3300025926 Bacteria 35986
233 Ga0207659_10102754 3300025926 Bacteria 2158
234 Ga0207659_10540059 3300025926 Unclassified 990
235 Ga0207687_10015461 3300025927 Bacteria 5005
236 Ga0207700_10051403 3300025928 Bacteria 3075
237 Ga0207644_10078115 3300025931 Bacteria 2439
238 Ga0207686_10030192 3300025934 Unclassified 3206
239 Ga0207686_10037372 3300025934 Unclassified 2929
240 Ga0207686_10104526 3300025934 Bacteria 1897
241 Ga0207709_10397372 3300025935 Unclassified 1053
242 Ga0207669_10091805 3300025937 Unclassified 1979
243 Ga0207704_10135005 3300025938 Bacteria 1716
244 Ga0207691_10022928 3300025940 Bacteria 5883
245 Ga0207691_10046428 3300025940 Bacteria 3991
246 Ga0207691_10159121 3300025940 Bacteria 1982
247 Ga0207711_10029605 3300025941 Bacteria 4620
248 Ga0207711_10045394 3300025941 Unclassified 3755
249 Ga0207711_10063904 3300025941 Bacteria 3178
250 Ga0207711_10147196 3300025941 Unclassified 2122
251 Ga0207711_10181427 3300025941 Bacteria 1915
252 Ga0207711_10202942 3300025941 Bacteria 1810
253 Ga0207711_10428858 3300025941 Bacteria 1230
254 Ga0207711_10648136 3300025941 Bacteria 985
255 Ga0207689_10121149 3300025942 Bacteria 2152
256 Ga0207689_10154457 3300025942 Unclassified 1892
257 Ga0207689_10665044 3300025942 Bacteria 878
258 Ga0207679_10276403 3300025945 Bacteria 1438
259 Ga0207679_10725274 3300025945 Unclassified 903
260 Ga0207667_10449590 3300025949 Unclassified 1309
261 Ga0207651_10009647 3300025960 Bacteria 5301
262 Ga0207651_10077585 3300025960 Unclassified 2379
263 Ga0207651_10178109 3300025960 Unclassified 1684
264 Ga0207651_10268626 3300025960 Bacteria 1404
265 Ga0207668_10127348 3300025972 Bacteria 1939
266 Ga0207640_10372648 3300025981 Bacteria 1154
267 Ga0207658_10074451 3300025986 Bacteria 2580
268 Ga0207658_10493554 3300025986 Bacteria 1090
269 Ga0207677_10116273 3300026023 Bacteria 2002
270 Ga0207677_10220636 3300026023 Unclassified 1520
271 Ga0207703_10120518 3300026035 Bacteria 2252
272 Ga0207703_10272281 3300026035 Bacteria 1534
273 Ga0207703_10401788 3300026035 Bacteria 1271
274 Ga0207703_10461606 3300026035 Bacteria 1188
275 Ga0207703_10512634 3300026035 Bacteria 1127
276 Ga0207703_10519486 3300026035 Unclassified 1120
277 Ga0207703_10616571 3300026035 Bacteria 1027
278 Ga0207703_10621112 3300026035 Bacteria 1023
279 Ga0207703_10696844 3300026035 Unclassified 966
280 Ga0207639_10414150 3300026041 Unclassified 1217
281 Ga0207702_10407111 3300026078 Unclassified 1313
282 Ga0207641_10005092 3300026088 Bacteria 11258
283 Ga0207641_10047233 3300026088 Bacteria 3630
284 Ga0207641_10573294 3300026088 Bacteria 1103
285 Ga0207648_10041426 3300026089 Unclassified 4043
286 Ga0207648_10156029 3300026089 Unclassified 2015
287 Ga0207648_10220249 3300026089 Bacteria 1686
288 Ga0207648_10232865 3300026089 Bacteria 1639
289 Ga0207648_10305392 3300026089 Unclassified 1428
290 Ga0207648_10340843 3300026089 Unclassified 1350
291 Ga0207676_10157050 3300026095 Unclassified 1966
292 Ga0207674_10086479 3300026116 Bacteria 3130
293 Ga0207675_100045811 3300026118 Bacteria 4085
294 Ga0207675_100346703 3300026118 Bacteria 1455
295 Ga0207683_10100650 3300026121 Bacteria 2580
296 Ga0207683_10511186 3300026121 Unclassified 1110
297 Ga0207698_10273547 3300026142 Bacteria 1558
298 Ga0268266_10017050 3300028379 Bacteria 6203
299 Ga0268266_10050970 3300028379 Bacteria 3552
300 Ga0268266_10291966 3300028379 Unclassified 1519
301 Ga0268265_10072937 3300028380 Bacteria 2679
302 Ga0268265_10666794 3300028380 Bacteria 1001
303 Ga0268265_11012616 3300028380 Bacteria 821
304 Ga0268264_10039413 3300028381 Bacteria 3904
305 Ga0268264_10124778 3300028381 Bacteria 2274
306 Ga0268264_10281259 3300028381 Bacteria 1559
307 Ga0268264_10310530 3300028381 Bacteria 1488
308 Ga0268264_10333711 3300028381 Bacteria 1438
309 Ga0265318_10085137 3300028577 Bacteria 1166
310 Ga0265314_10047008 3300031711 Bacteria 3041
311 Ga0265314_10056964 3300031711 Unclassified 2688
312 Ga0373923_0137561 3300035111 Unclassified 1102
313 Ga0373936_0129058 3300035113 Bacteria 1085
314 Ga0373945_0027485 3300035116 Unclassified 1988
315 Ga0373954_0171133 3300035118 Bacteria 1064
316 Ga0373956_0149658 3300035119 Bacteria 1098
317 Ga0373956_0181918 3300035119 Unclassified 994
318 Ga0373943_0066398 3300035170 Unclassified 1816
319 Ga0373946_0044581 3300035171 Bacteria 1831
320 Ga0373946_0056459 3300035171 Bacteria 1658
321 Ga0373955_0274980 3300035172 Bacteria 1013
322 Ga0373924_0003055 3300035410 Bacteria 5709
323 Ga0373924_0005414 3300035410 Bacteria 4518
324 Ga0373935_0035602 3300035692 Bacteria 3108
325 Ga0373935_0176598 3300035692 Bacteria 1464
326 Ga0373935_0292189 3300035692 Unclassified 1150
327 Ga0373927_0095612 3300035695 Bacteria 1931
328 Ga0373947_0030487 3300035725 Unclassified 3169
329 Ga0373947_0070315 3300035725 Bacteria 2144
330 Ga0373937_0066997 3300036401 Bacteria 3308
331 Ga0373937_0165421 3300036401 Bacteria 2074
332 Ga0373937_0199500 3300036401 Bacteria 1881
333 Ga0373937_0235135 3300036401 Unclassified 1726
334 Ga0373925_0035874 3300037068 Bacteria 3660
335 Ga0373925_0040803 3300037068 Bacteria 3438
336 Ga0373925_0040828 3300037068 Unclassified 3437
337 Ga0373925_0088277 3300037068 Bacteria 2368
338 Ga0373925_0115000 3300037068 Bacteria 2083
339 Ga0373925_0264616 3300037068 Unclassified 1382
340 Ga0436365_0795483 3300039437 Unclassified 1327
341 Ga0436365_1493574 3300039437 Bacteria 1877
342 Ga0436363_0065186 3300039450 Unclassified 1055
343 Ga0495592_0015867 3300046454 Bacteria 5715
344 Ga0495592_0041046 3300046454 Unclassified 3469
345 Ga0495592_0157263 3300046454 Bacteria 1567
346 Ga0495651_0256152 3300046462 Bacteria 1193
347 Ga0495580_0050080 3300046472 Bacteria 2954
348 Ga0495580_0101722 3300046472 Unclassified 1998
349 Ga0495639_0204260 3300046475 Unclassified 968
350 Ga0495662_0116587 3300046476 Unclassified 1310
351 Ga0495608_0017078 3300046511 Bacteria 5022
352 Ga0495608_0037953 3300046511 Bacteria 3238
353 Ga0495618_0191830 3300046514 Unclassified 1295
354 Ga0495628_0062980 3300046516 Bacteria 2906
355 Ga0495630_0206557 3300046517 Bacteria 1499
356 Ga0495640_0131972 3300046533 Unclassified 1616
357 Ga0495587_0029362 3300046536 Bacteria 3338
358 Ga0495645_0195272 3300046543 Bacteria 1376
359 Ga0495645_0310724 3300046543 Unclassified 1026
360 Ga0495634_0037693 3300046642 Unclassified 3302
361 Ga0495635_0147832 3300046663 Unclassified 1600
362 Ga0495599_0439381 3300046678 Unclassified 774
363 Ga0495647_0148316 3300046681 Unclassified 1004
364 Ga0495658_0150268 3300046683 Bacteria 1430
365 Ga0495669_0000655 3300046684 Bacteria 15098
366 Ga0495669_0025953 3300046684 Bacteria 2559
367 Ga0495613_0001600 3300046689 Bacteria 17181
368 Ga0495600_0019208 3300046809 Bacteria 4362
369 Ga0495600_0347158 3300046809 Unclassified 930
370 Ga0495674_0016157 3300047319 Bacteria 6965
371 Ga0495684_0000078 3300047471 Bacteria 66716
372 Ga0495684_0000315 3300047471 Bacteria 39623
373 Ga0495602_0267622 3300048088 Unclassified 1265
374 Ga0496100_0011124 3300048903 Bacteria 5110
375 Ga0496100_0100562 3300048903 Bacteria 1992
376 Ga0496100_0453228 3300048903 Bacteria 984
377 Ga0496101_0002334 3300048904 Bacteria 11628
378 Ga0496101_0006105 3300048904 Bacteria 7738
379 Ga0496101_0184650 3300048904 Bacteria 1607
380 Ga0496102_0036498 3300048905 Bacteria 4428
381 Ga0496102_0068260 3300048905 Bacteria 3262
382 Ga0496102_0071896 3300048905 Bacteria 3177
383 Ga0496102_0218201 3300048905 Bacteria 1798
384 Ga0496102_0254140 3300048905 Bacteria 1657
385 Ga0496103_0316859 3300048906 Bacteria 1003
386 Ga0496104_0033302 3300048907 Bacteria 4799
387 Ga0496104_0180163 3300048907 Bacteria 2023
388 Ga0496104_0547055 3300048907 Unclassified 1069
389 Ga0496105_0069104 3300048908 Bacteria 2919
390 Ga0496105_0108428 3300048908 Unclassified 2293
391 Ga0496105_0362572 3300048908 Bacteria 1156
392 Ga0496106_0048994 3300048909 Bacteria 3182
393 Ga0496106_0148774 3300048909 Bacteria 1846
394 Ga0496109_0548279 3300048912 Unclassified 1091
395 Ga0496110_0256201 3300048913 Bacteria 1593
396 Ga0496112_0155941 3300048915 Unclassified 2250
397 Ga0496113_0724890 3300048916 Bacteria 793
398 Ga0496114_0000913 3300048917 Bacteria 22113
399 Ga0496114_0210320 3300048917 Unclassified 1706
400 Ga0496114_0536266 3300048917 Bacteria 1035
401 Ga0501291_018384 3300049514 Unclassified 1087
402 Ga0501039_0287025 3300049575 Unclassified 1294
403 Ga0501041_0024821 3300049577 Bacteria 3600
404 Ga0501048_0358407 3300049582 Bacteria 1040
405 Ga0501076_0076065 3300049592 Unclassified 2692
406 Ga0501076_0239144 3300049592 Bacteria 1485
407 nmdc:mga05p37_18588_c1 3300050507 Bacteria 8400
408 nmdc:mga05p37_201076_c1 3300050507 Bacteria 2413
409 nmdc:mga05p37_23469_c1 3300050507 Bacteria 7485
410 nmdc:mga05p37_4878_c1 3300050507 Bacteria 15701
411 nmdc:mga05p37_50403_c1 3300050507 Bacteria 5120
412 nmdc:mga05p37_98588_c1 3300050507 Bacteria 3599
413 nmdc:mga09592_210638_c1 3300050508 Bacteria 1684
414 nmdc:mga08y16_2554_c1 3300050511 Bacteria 18718
415 nmdc:mga0n895_115750_c1 3300050512 Bacteria 2699
416 nmdc:mga0n895_136922_c1 3300050512 Bacteria 2475
417 nmdc:mga0n895_163742_c1 3300050512 Bacteria 2256
418 nmdc:mga0n895_182670_c1 3300050512 Bacteria 2129
419 nmdc:mga0n895_182_c1 3300050512 Bacteria 38722
420 nmdc:mga0n895_341547_c1 3300050512 Bacteria 1516
421 nmdc:mga0n895_8894_c1 3300050512 Bacteria 8748
422 nmdc:mga0rr50_117884_c1 3300050513 Unclassified 2109
423 nmdc:mga0rr50_12672_c1 3300050513 Bacteria 5459
424 nmdc:mga0rr50_227276_c1 3300050513 Bacteria 1543
425 nmdc:mga0rr50_229313_c1 3300050513 Bacteria 1536
426 nmdc:mga0rr50_25857_c1 3300050513 Bacteria 4088
427 nmdc:mga0rr50_29998_c1 3300050513 Bacteria 3844
428 nmdc:mga0rr50_45_c1 3300050513 Bacteria 74544
429 nmdc:mga0rr50_550032_c1 3300050513 Bacteria 983
430 nmdc:mga08x19_102055_c1 3300050514 Bacteria 1904
431 nmdc:mga08x19_108829_c1 3300050514 Unclassified 1847
432 nmdc:mga08x19_19982_c1 3300050514 Bacteria 4120
433 nmdc:mga08x19_333738_c1 3300050514 Unclassified 1057
434 nmdc:mga08x19_753_c1 3300050514 Bacteria 20724
435 nmdc:mga0a205_27842_c1 3300050515 Bacteria 5399
436 nmdc:mga0a205_29030_c1 3300050515 Bacteria 5292
437 nmdc:mga0a205_51245_c1 3300050515 Bacteria 3984
438 nmdc:mga0a205_87131_c1 3300050515 Bacteria 3017
439 Ga0495601_0010449 3300053077 Bacteria 5524
440 Ga0495601_0021143 3300053077 Bacteria 3982
441 Ga0495601_0047055 3300053077 Bacteria 2715
442 Ga0495601_0065493 3300053077 Bacteria 2313
443 Ga0495601_0100198 3300053077 Bacteria 1871
444 Ga0495601_0140160 3300053077 Bacteria 1577
445 Ga0495601_0143350 3300053077 Unclassified 1559
446 Ga0495595_0090404 3300053084 Unclassified 1468
447 Ga0495619_0029175 3300053085 Bacteria 3563
448 Ga0495619_0079232 3300053085 Unclassified 2209
449 Ga0495619_0087891 3300053085 Bacteria 2102
450 Ga0495619_0118878 3300053085 Bacteria 1811
451 Ga0501082_0006041 3300060353 Bacteria 10506
452 Ga0530510_0037033 3300061734 Bacteria 3516
453 Ga0068859_100176426
454 JGI25406J46586_10068503
455 Ga0065715_10274004
456 Ga0065707_10000940
457 Ga0065707_10134858
458 Ga0065707_10284920
459 Ga0070683_100152535
460 Ga0070690_100093257
461 Ga0070670_100261252
462 Ga0070677_10069182
463 Ga0068869_100306075
464 Ga0070666_10036636
465 Ga0070666_10060864
466 Ga0070666_10192188
467 Ga0068868_100056161
468 Ga0068868_100084872
469 Ga0068868_100124839
470 Ga0068868_100211450
471 Ga0070668_100305139
472 Ga0070671_100008003
473 Ga0070674_100087520
474 Ga0070673_100004895
475 Ga0070673_100069334
476 Ga0070673_100237695
477 Ga0070673_100300633
478 Ga0070667_100006327
479 Ga0070709_10081235
480 Ga0070713_100021635
481 Ga0070694_100282429
482 Ga0070708_100159123
483 Ga0070708_100177408
484 Ga0070708_100299352
485 Ga0070708_100516577
486 Ga0070678_100042900
487 Ga0068867_100084709
488 Ga0068867_100172907
489 Ga0070685_10106430
490 Ga0070706_100322096
491 Ga0070706_100565881
492 Ga0070707_100248511
493 Ga0070698_100030689
494 Ga0070698_100140246
495 Ga0070698_100180590
496 Ga0070698_100326442
497 Ga0070698_100416219
498 Ga0070699_100215949
499 Ga0070699_100374448
500 Ga0070679_100025286
501 Ga0070697_100016754
502 Ga0070672_100545528
503 Ga0070686_100001788
504 Ga0070686_100024951
505 Ga0070686_100091850
506 Ga0070686_100236051
507 Ga0070696_100310450
508 Ga0070696_100397228
509 Ga0070665_100004520
510 Ga0070665_100025845
511 Ga0070704_100001196
512 Ga0070704_100038820
513 Ga0070704_100106604
514 Ga0070664_100637599
515 Ga0068854_100047843
516 Ga0068859_100001016
517 Ga0068859_100204708
518 Ga0068859_100317337
519 Ga0068866_10006661
520 Ga0068866_10036747
521 Ga0068866_10363502
522 Ga0068861_100030495
523 Ga0068851_10157882
524 Ga0068851_10226272
525 Ga0068870_10091445
526 Ga0068863_100019348
527 Ga0068863_100108144
528 Ga0068863_100322399
529 Ga0068858_100053917
530 Ga0068858_100065737
531 Ga0068858_100085337
532 Ga0068858_100086238
533 Ga0068858_100112220
534 Ga0068858_100118341
535 Ga0068858_100138202
536 Ga0068858_100335432
537 Ga0068860_100023422
538 Ga0068860_100086722
539 Ga0068860_100274699
540 Ga0068860_100323500
541 Ga0068860_100374886
542 Ga0068860_100462715
543 Ga0068860_100756477
544 Ga0068862_100038707
545 Ga0068862_100144180
546 Ga0068862_100428433
547 Ga0081455_10157899
548 Ga0081539_10005740
549 Ga0070717_10052149
550 Ga0070717_10103967
551 Ga0070715_10172401
552 Ga0070716_100053097
553 Ga0097621_100004353
554 Ga0097621_100012231
555 Ga0097621_100022805
556 Ga0097621_100031639
557 Ga0097621_100033736
558 Ga0097621_100174285
559 Ga0097621_100197649
560 Ga0097621_100559381
561 Ga0068871_100000308
562 Ga0068871_100001385
563 Ga0068871_100004321
564 Ga0068871_100040287
565 Ga0068871_100168555
566 Ga0068871_100729636
567 Ga0075433_10044797
568 Ga0075433_10046012
569 Ga0075433_10069722
570 Ga0075434_100001575
571 Ga0075434_100081401
572 Ga0075434_100315087
573 Ga0075434_100483525
574 Ga0075434_100493099
575 Ga0075429_100215267
576 Ga0068865_100020279
577 Ga0068865_100314119
578 Ga0075436_100020214
579 Ga0075436_100041298
580 Ga0075436_100042817
581 Ga0075436_100075298
582 Ga0097620_100001016
583 Ga0097620_100176415
584 Ga0097620_100204711
585 Ga0097620_100317372
586 Ga0075435_100000417
587 Ga0075435_100021913
588 Ga0075435_100022519
589 Ga0075435_100029100
590 Ga0075435_100139810
591 Ga0075435_100215217
592 Ga0075435_100259678
593 Ga0075435_100338218
594 Ga0099795_10027802
595 Ga0111539_10002954
596 Ga0105245_10008432
597 Ga0105245_10071035
598 Ga0105245_10182904
599 Ga0105245_10560791
600 Ga0105247_10012013
601 Ga0105247_10035535
602 Ga0114129_10004143
603 Ga0114129_10007298
604 Ga0114129_10025472
605 Ga0114129_10058479
606 Ga0114129_10229058
607 Ga0114129_10904596
608 Ga0105243_10067815
609 Ga0105243_10283357
610 Ga0105241_10085870
611 Ga0105242_10021871
612 Ga0105242_10049571
613 Ga0105242_10275362
614 Ga0105242_10340099
615 Ga0105242_10646507
616 Ga0105242_10840017
617 Ga0105248_10001567
618 Ga0105248_10021392
619 Ga0105248_10024186
620 Ga0105248_10043509
621 Ga0105248_10047652
622 Ga0105248_10062948
623 Ga0105248_10064889
624 Ga0105248_10114941
625 Ga0105248_10328036
626 Ga0105248_10655290
627 Ga0105248_11005256
628 Ga0105238_10232012
629 Ga0105238_10642901
630 Ga0105249_10012606
631 Ga0105246_10222029
632 Ga0157374_10093787
633 Ga0157374_10284249
634 Ga0157378_10007290
635 Ga0157378_10012281
636 Ga0157378_10367632
637 Ga0157378_10552921
638 Ga0163162_10005014
639 Ga0163162_10694339
640 Ga0163162_10734870
641 Ga0163162_10756299
642 Ga0157372_10133391
643 Ga0157375_10018957
644 Ga0157375_10055216
645 Ga0157375_10269595
646 Ga0157375_10703930
647 Ga0163163_10259637
648 Ga0163163_10898154
649 Ga0157380_10058409
650 Ga0157380_10084033
651 Ga0157377_10305225
652 Ga0157379_10002823
653 Ga0157379_10016425
654 Ga0157379_10284994
655 Ga0157379_10293183
656 Ga0157379_10438285
657 Ga0157376_10045942
658 Ga0157376_10069771
659 Ga0157376_10123547
660 Ga0157376_10391915
661 Ga0157376_10481530
662 Ga0157376_10655631
663 Ga0163161_10060183
664 Ga0163161_10363908
665 Ga0207710_10017308
666 Ga0207680_10015060
667 Ga0207680_10090930
668 Ga0207680_10344151
669 Ga0207685_10048611
670 Ga0207685_10162854
671 Ga0207699_10010686
672 Ga0207699_10328793
673 Ga0207645_10357515
674 Ga0207643_10097396
675 Ga0207654_10164645
676 Ga0207695_10093441
677 Ga0207652_10012813
678 Ga0207652_10071759
679 Ga0207652_10128390
680 Ga0207646_10508884
681 Ga0207694_10388548
682 Ga0207650_10236778
683 Ga0207650_10411962
684 Ga0207659_10000196
685 Ga0207659_10102754
686 Ga0207659_10540059
687 Ga0207687_10015461
688 Ga0207700_10051403
689 Ga0207644_10078115
690 Ga0207686_10030192
691 Ga0207686_10037372
692 Ga0207686_10104526
693 Ga0207709_10397372
694 Ga0207669_10091805
695 Ga0207704_10135005
696 Ga0207691_10022928
697 Ga0207691_10046428
698 Ga0207691_10159121
699 Ga0207711_10029605
700 Ga0207711_10045394
701 Ga0207711_10063904
702 Ga0207711_10147196
703 Ga0207711_10181427
704 Ga0207711_10202942
705 Ga0207711_10428858
706 Ga0207711_10648136
707 Ga0207689_10121149
708 Ga0207689_10154457
709 Ga0207689_10665044
710 Ga0207679_10276403
711 Ga0207679_10725274
712 Ga0207667_10449590
713 Ga0207651_10009647
714 Ga0207651_10077585
715 Ga0207651_10178109
716 Ga0207651_10268626
717 Ga0207668_10127348
718 Ga0207640_10372648
719 Ga0207658_10074451
720 Ga0207658_10493554
721 Ga0207677_10116273
722 Ga0207677_10220636
723 Ga0207703_10120518
724 Ga0207703_10272281
725 Ga0207703_10401788
726 Ga0207703_10461606
727 Ga0207703_10512634
728 Ga0207703_10519486
729 Ga0207703_10616571
730 Ga0207703_10621112
731 Ga0207703_10696844
732 Ga0207639_10414150
733 Ga0207702_10407111
734 Ga0207641_10005092
735 Ga0207641_10047233
736 Ga0207641_10573294
737 Ga0207648_10041426
738 Ga0207648_10156029
739 Ga0207648_10220249
740 Ga0207648_10232865
741 Ga0207648_10305392
742 Ga0207648_10340843
743 Ga0207676_10157050
744 Ga0207674_10086479
745 Ga0207675_100045811
746 Ga0207675_100346703
747 Ga0207683_10100650
748 Ga0207683_10511186
749 Ga0207698_10273547
750 Ga0268266_10017050
751 Ga0268266_10050970
752 Ga0268266_10291966
753 Ga0268265_10072937
754 Ga0268265_10666794
755 Ga0268265_11012616
756 Ga0268264_10039413
757 Ga0268264_10124778
758 Ga0268264_10281259
759 Ga0268264_10310530
760 Ga0268264_10333711
761 Ga0265318_10085137
762 Ga0265314_10047008
763 Ga0265314_10056964
764 Ga0373923_0137561
765 Ga0373936_0129058
766 Ga0373945_0027485
767 Ga0373954_0171133
768 Ga0373956_0149658
769 Ga0373956_0181918
770 Ga0373943_0066398
771 Ga0373946_0044581
772 Ga0373946_0056459
773 Ga0373955_0274980
774 Ga0373924_0003055
775 Ga0373924_0005414
776 Ga0373935_0035602
777 Ga0373935_0176598
778 Ga0373935_0292189
779 Ga0373927_0095612
780 Ga0373947_0030487
781 Ga0373947_0070315
782 Ga0373937_0066997
783 Ga0373937_0165421
784 Ga0373937_0199500
785 Ga0373937_0235135
786 Ga0373925_0035874
787 Ga0373925_0040803
788 Ga0373925_0040828
789 Ga0373925_0088277
790 Ga0373925_0115000
791 Ga0373925_0264616
792 Ga0436365_0795483
793 Ga0436365_1493574
794 Ga0436363_0065186
795 Ga0495592_0015867
796 Ga0495592_0041046
797 Ga0495592_0157263
798 Ga0495651_0256152
799 Ga0495580_0050080
800 Ga0495580_0101722
801 Ga0495639_0204260
802 Ga0495662_0116587
803 Ga0495608_0017078
804 Ga0495608_0037953
805 Ga0495618_0191830
806 Ga0495628_0062980
807 Ga0495630_0206557
808 Ga0495640_0131972
809 Ga0495587_0029362
810 Ga0495645_0195272
811 Ga0495645_0310724
812 Ga0495634_0037693
813 Ga0495635_0147832
814 Ga0495599_0439381
815 Ga0495647_0148316
816 Ga0495658_0150268
817 Ga0495669_0000655
818 Ga0495669_0025953
819 Ga0495613_0001600
820 Ga0495600_0019208
821 Ga0495600_0347158
822 Ga0495674_0016157
823 Ga0495684_0000078
824 Ga0495684_0000315
825 Ga0495602_0267622
826 Ga0496100_0011124
827 Ga0496100_0100562
828 Ga0496100_0453228
829 Ga0496101_0002334
830 Ga0496101_0006105
831 Ga0496101_0184650
832 Ga0496102_0036498
833 Ga0496102_0068260
834 Ga0496102_0071896
835 Ga0496102_0218201
836 Ga0496102_0254140
837 Ga0496103_0316859
838 Ga0496104_0033302
839 Ga0496104_0180163
840 Ga0496104_0547055
841 Ga0496105_0069104
842 Ga0496105_0108428
843 Ga0496105_0362572
844 Ga0496106_0048994
845 Ga0496106_0148774
846 Ga0496109_0548279
847 Ga0496110_0256201
848 Ga0496112_0155941
849 Ga0496113_0724890
850 Ga0496114_0000913
851 Ga0496114_0210320
852 Ga0496114_0536266
853 Ga0501291_018384
854 Ga0501039_0287025
855 Ga0501041_0024821
856 Ga0501048_0358407
857 Ga0501076_0076065
858 Ga0501076_0239144
859 nmdc:mga05p37_18588_c1
860 nmdc:mga05p37_201076_c1
861 nmdc:mga05p37_23469_c1
862 nmdc:mga05p37_4878_c1
863 nmdc:mga05p37_50403_c1
864 nmdc:mga05p37_98588_c1
865 nmdc:mga09592_210638_c1
866 nmdc:mga08y16_2554_c1
867 nmdc:mga0n895_115750_c1
868 nmdc:mga0n895_136922_c1
869 nmdc:mga0n895_163742_c1
870 nmdc:mga0n895_182670_c1
871 nmdc:mga0n895_182_c1
872 nmdc:mga0n895_341547_c1
873 nmdc:mga0n895_8894_c1
874 nmdc:mga0rr50_117884_c1
875 nmdc:mga0rr50_12672_c1
876 nmdc:mga0rr50_227276_c1
877 nmdc:mga0rr50_229313_c1
878 nmdc:mga0rr50_25857_c1
879 nmdc:mga0rr50_29998_c1
880 nmdc:mga0rr50_45_c1
881 nmdc:mga0rr50_550032_c1
882 nmdc:mga08x19_102055_c1
883 nmdc:mga08x19_108829_c1
884 nmdc:mga08x19_19982_c1
885 nmdc:mga08x19_333738_c1
886 nmdc:mga08x19_753_c1
887 nmdc:mga0a205_27842_c1
888 nmdc:mga0a205_29030_c1
889 nmdc:mga0a205_51245_c1
890 nmdc:mga0a205_87131_c1
891 Ga0495601_0010449
892 Ga0495601_0021143
893 Ga0495601_0047055
894 Ga0495601_0065493
895 Ga0495601_0100198
896 Ga0495601_0140160
897 Ga0495601_0143350
898 Ga0495595_0090404
899 Ga0495619_0029175
900 Ga0495619_0079232
901 Ga0495619_0087891
902 Ga0495619_0118878
903 Ga0501082_0006041
904 Ga0530510_0037033

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00902

TatC

Sec-independent protein translocase protein (TatC)

26

237

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4htt-assembly2.cif.gz_B crystal structure of twin arginine translocase receptor- tatc in ddm 0.8352 15 238
4htt-assembly2.cif.gz_B crystal structure of twin arginine translocase receptor- tatc in ddm 0.8253 15 238
4hts-assembly1.cif.gz_A crystal structure of twin arginine translocase receptor- tatc 0.8024 15 242
4hts-assembly1.cif.gz_A crystal structure of twin arginine translocase receptor- tatc 0.7963 15 242
4u2u-assembly1.cif.gz_B bak domain swapped dimer induced by bidbh3 with chaps 0.3675 107 269
ID Description Score Start End Superfamily
af_A0A0K3ASC2_225_426_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4465 58 248 1.20.1640.10
af_H1UBK7_226_421_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.429 63 253 1.20.1640.10
4u2uA00 Mainly Alpha;Orthogonal Bundle;Apoptosis Regulator Bcl-x;Blc2-like 0.4217 105 269 1.10.437.10
af_A0A0K3ASC2_225_426_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4209 58 248 1.20.1640.10
af_H1UBK7_226_421_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4169 63 253 1.20.1640.10
ID Description Score Start End GO Terms
AF-A0A1Q7QY99-F1-model_v4 Sec-independent protein translocase protein TatC 0.9661 11 243 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A7X9IG23-F1-model_v4 Sec-independent protein translocase protein TatC 0.9627 11 238 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A3N5T624-F1-model_v4 Twin-arginine translocase subunit TatC 0.9534 45 238 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A1G3V6N5-F1-model_v4 Sec-independent protein translocase protein TatC 0.9481 11 242 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-K1XB91-F1-model_v4 Sec-independent protein translocase protein TatC 0.9473 11 242 GO:0009977
GO:0033281
GO:0043953
GO:0065002

Map