F446920

General Info

Members Datasets Scaffolds Average Seq Length
452 223 904 343

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100050381|Ga0070714_1000503813
Length 354
Sequence MGDDDVMCTDQTPAGHGASQEILHDVDLPVQFDLEPVDSVTVTTLMDNVTDVFMPDQGPAHRAPVDIGGRRPASTMESGDAPEALLAEHGFSVLVTVTKNGRQHRILFDTGTSPDGVVQNMRRLDVDPTDIEVIVCSHGHFDHTTGLDGLIRRLGGSVNLPVLIHPHFWRRRRVSLPGREPLEIPTTSRSALISAGFEIVEERQPSFLFEQSVLVTGEVARGTGYEPGFPPQQAWLDGSWQPDPLVLDDQALVIDIKDKGLLVITGCGHAGVVNICCYARRLTKDRPLHAVIGGFHLNGPIFEPLIPRVIDDLSALNPQVVVPAHCTGWRAQHAMGARLPGAFIPNTVGTRVEL

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
98 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
99 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
100 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
101 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
102 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
103 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
104 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
105 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
107 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
109 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
110 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
111 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
112 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
113 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
118 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
129 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
220 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.75
Rhizosphere 92.7
Stem 0
Stem Tuber 0
Unclassified 6.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100050381 3300005435 Bacteria 3547
2 rootH1_10331165 3300003323 Unclassified 2331
3 Ga0070658_10026223 3300005327 Bacteria 4675
4 Ga0070658_10030764 3300005327 Bacteria 4312
5 Ga0070683_100222393 3300005329 Bacteria 1794
6 Ga0070690_100025809 3300005330 Bacteria 3620
7 Ga0070680_100023658 3300005336 Bacteria 4903
8 Ga0070680_100176268 3300005336 Bacteria 1800
9 Ga0070680_100241601 3300005336 Bacteria 1526
10 Ga0070682_100057321 3300005337 Bacteria 2454
11 Ga0070682_100163350 3300005337 Bacteria 1540
12 Ga0070689_100111027 3300005340 Bacteria 2181
13 Ga0070691_10088722 3300005341 Bacteria 1522
14 Ga0070669_100120385 3300005353 Bacteria 2002
15 Ga0070675_100119290 3300005354 Bacteria 2240
16 Ga0070674_100110759 3300005356 Bacteria 2015
17 Ga0070673_100042392 3300005364 Bacteria 3509
18 Ga0070709_10001925 3300005434 Bacteria 11284
19 Ga0070709_10013884 3300005434 Bacteria 4540
20 Ga0070714_100013642 3300005435 Bacteria 6515
21 Ga0070714_100029503 3300005435 Unclassified 4560
22 Ga0070714_100059331 3300005435 Bacteria 3280
23 Ga0070714_100233195 3300005435 Bacteria 1696
24 Ga0070714_100393814 3300005435 Bacteria 1308
25 Ga0070713_100004483 3300005436 Bacteria 9387
26 Ga0070713_100025330 3300005436 Bacteria 4637
27 Ga0070710_10001397 3300005437 Bacteria 11400
28 Ga0070710_10015300 3300005437 Bacteria 3880
29 Ga0070710_10076713 3300005437 Bacteria 1940
30 Ga0070710_10130913 3300005437 Unclassified 1529
31 Ga0070711_100023357 3300005439 Bacteria 4019
32 Ga0070711_100029641 3300005439 Bacteria 3613
33 Ga0070711_100089226 3300005439 Bacteria 2217
34 Ga0070711_100114257 3300005439 Bacteria 1986
35 Ga0070711_100209194 3300005439 Bacteria 1510
36 Ga0070705_100123211 3300005440 Bacteria 1677
37 Ga0070708_100028633 3300005445 Bacteria 4796
38 Ga0070708_100043925 3300005445 Bacteria 3928
39 Ga0070681_10201472 3300005458 Bacteria 1908
40 Ga0070685_10034300 3300005466 Bacteria 2857
41 Ga0070706_100020952 3300005467 Bacteria 6018
42 Ga0070706_100059180 3300005467 Bacteria 3536
43 Ga0070706_100084204 3300005467 Bacteria 2946
44 Ga0070706_100109663 3300005467 Bacteria 2568
45 Ga0070706_100117566 3300005467 Bacteria 2477
46 Ga0070706_100119742 3300005467 Unclassified 2453
47 Ga0070707_100000681 3300005468 Bacteria 33657
48 Ga0070707_100030918 3300005468 Bacteria 5099
49 Ga0070707_100056287 3300005468 Bacteria 3772
50 Ga0070707_100170600 3300005468 Bacteria 2120
51 Ga0070707_100242669 3300005468 Bacteria 1753
52 Ga0070698_100043587 3300005471 Bacteria 4599
53 Ga0070698_100075997 3300005471 Bacteria 3362
54 Ga0070698_100248747 3300005471 Unclassified 1711
55 Ga0070699_100000138 3300005518 Bacteria 68369
56 Ga0070679_100014858 3300005530 Bacteria 7480
57 Ga0070697_100008944 3300005536 Bacteria 7826
58 Ga0070697_100060194 3300005536 Bacteria 3094
59 Ga0068853_100029012 3300005539 Bacteria 4659
60 Ga0070672_100034949 3300005543 Bacteria 3817
61 Ga0070695_100037371 3300005545 Bacteria 3059
62 Ga0070695_100053271 3300005545 Bacteria 2601
63 Ga0070693_100054471 3300005547 Bacteria 2300
64 Ga0070704_100025202 3300005549 Bacteria 3913
65 Ga0070664_100145040 3300005564 Bacteria 2093
66 Ga0068856_100263753 3300005614 Bacteria 1738
67 Ga0068856_100457159 3300005614 Unclassified 1298
68 Ga0068863_100144984 3300005841 Bacteria 2271
69 Ga0068863_100236040 3300005841 Bacteria 1765
70 Ga0068860_100254555 3300005843 Bacteria 1710
71 Ga0081455_10005427 3300005937 Bacteria 13988
72 Ga0081540_1000154 3300005983 Bacteria 70679
73 Ga0081540_1001071 3300005983 Bacteria 24309
74 Ga0081540_1007444 3300005983 Bacteria 7800
75 Ga0070717_10012362 3300006028 Bacteria 6506
76 Ga0070717_10018153 3300006028 Bacteria 5490
77 Ga0070717_10228320 3300006028 Bacteria 1638
78 Ga0070715_10009078 3300006163 Bacteria 3490
79 Ga0070716_100000662 3300006173 Bacteria 14623
80 Ga0070716_100034816 3300006173 Bacteria 2764
81 Ga0070716_100136344 3300006173 Bacteria 1559
82 Ga0070712_100015229 3300006175 Unclassified 4946
83 Ga0070712_100045007 3300006175 Bacteria 3046
84 Ga0070712_100060278 3300006175 Bacteria 2676
85 Ga0068871_100212683 3300006358 Bacteria 1673
86 Ga0075434_100008309 3300006871 Bacteria 9642
87 Ga0075434_100090141 3300006871 Bacteria 3068
88 Ga0075434_100308955 3300006871 Unclassified 1601
89 Ga0075436_100009610 3300006914 Bacteria 6621
90 Ga0075436_100041273 3300006914 Bacteria 3183
91 Ga0075436_100129856 3300006914 Bacteria 1766
92 Ga0075435_100002629 3300007076 Bacteria 11961
93 Ga0075435_100175877 3300007076 Bacteria 1807
94 Ga0099795_10045727 3300007788 Bacteria 1575
95 Ga0105251_10031216 3300009011 Bacteria 2668
96 Ga0105240_10126351 3300009093 Bacteria 3073
97 Ga0105245_10200236 3300009098 Bacteria 1917
98 Ga0105241_10131427 3300009174 Bacteria 2027
99 Ga0105242_10102626 3300009176 Bacteria 2426
100 Ga0105248_10090406 3300009177 Bacteria 3447
101 Ga0105237_10131728 3300009545 Bacteria 2495
102 Ga0105239_10298008 3300010375 Bacteria 1816
103 Ga0105246_10059764 3300011119 Bacteria 2645
104 Ga0157371_10178450 3300013102 Bacteria 1519
105 Ga0157369_10028858 3300013105 Bacteria 6137
106 Ga0157369_10110658 3300013105 Bacteria 2920
107 Ga0157369_10212050 3300013105 Bacteria 2030
108 Ga0157374_10096915 3300013296 Bacteria 2821
109 Ga0157374_10258290 3300013296 Bacteria 1715
110 Ga0157372_10148495 3300013307 Bacteria 2704
111 Ga0157372_10248503 3300013307 Bacteria 2064
112 Ga0163163_10110521 3300014325 Bacteria 2777
113 Ga0163163_10439401 3300014325 Unclassified 1364
114 Ga0157379_10084608 3300014968 Unclassified 2842
115 Ga0157376_10080071 3300014969 Bacteria 2801
116 Ga0207692_10006811 3300025898 Unclassified 4648
117 Ga0207692_10007361 3300025898 Bacteria 4512
118 Ga0207692_10014301 3300025898 Bacteria 3464
119 Ga0207692_10143936 3300025898 Bacteria 1358
120 Ga0207688_10007884 3300025901 Bacteria 5796
121 Ga0207680_10055456 3300025903 Bacteria 2388
122 Ga0207699_10000509 3300025906 Bacteria 19289
123 Ga0207699_10002632 3300025906 Bacteria 8483
124 Ga0207699_10006215 3300025906 Bacteria 5764
125 Ga0207699_10038877 3300025906 Bacteria 2730
126 Ga0207699_10047585 3300025906 Bacteria 2515
127 Ga0207699_10069099 3300025906 Unclassified 2152
128 Ga0207643_10038990 3300025908 Bacteria 2671
129 Ga0207705_10107038 3300025909 Unclassified 2062
130 Ga0207684_10001196 3300025910 Bacteria 29015
131 Ga0207684_10017129 3300025910 Bacteria 6219
132 Ga0207684_10051159 3300025910 Unclassified 3505
133 Ga0207684_10102851 3300025910 Bacteria 2443
134 Ga0207684_10123506 3300025910 Bacteria 2221
135 Ga0207684_10313058 3300025910 Bacteria 1353
136 Ga0207654_10156840 3300025911 Bacteria 1467
137 Ga0207654_10283800 3300025911 Bacteria 1121
138 Ga0207671_10077994 3300025914 Bacteria 2480
139 Ga0207693_10013320 3300025915 Bacteria 6631
140 Ga0207693_10026435 3300025915 Bacteria 4594
141 Ga0207693_10028208 3300025915 Bacteria 4436
142 Ga0207693_10051752 3300025915 Bacteria 3221
143 Ga0207693_10062677 3300025915 Bacteria 2913
144 Ga0207693_10074166 3300025915 Unclassified 2665
145 Ga0207663_10017988 3300025916 Bacteria 3948
146 Ga0207663_10062516 3300025916 Bacteria 2367
147 Ga0207660_10049694 3300025917 Bacteria 2975
148 Ga0207662_10011097 3300025918 Bacteria 4984
149 Ga0207657_10034306 3300025919 Bacteria 4566
150 Ga0207649_10019783 3300025920 Bacteria 3853
151 Ga0207646_10004638 3300025922 Bacteria 14840
152 Ga0207646_10010773 3300025922 Bacteria 8897
153 Ga0207646_10169191 3300025922 Bacteria 1973
154 Ga0207694_10141313 3300025924 Bacteria 1936
155 Ga0207687_10102222 3300025927 Bacteria 2111
156 Ga0207700_10002204 3300025928 Bacteria 11179
157 Ga0207700_10008687 3300025928 Bacteria 6309
158 Ga0207700_10027198 3300025928 Bacteria 4001
159 Ga0207700_10089711 3300025928 Bacteria 2424
160 Ga0207700_10105770 3300025928 Bacteria 2254
161 Ga0207700_10223291 3300025928 Bacteria 1598
162 Ga0207700_10223328 3300025928 Bacteria 1598
163 Ga0207700_10264394 3300025928 Bacteria 1474
164 Ga0207664_10010363 3300025929 Bacteria 6583
165 Ga0207664_10010892 3300025929 Bacteria 6440
166 Ga0207664_10012885 3300025929 Bacteria 5992
167 Ga0207664_10058980 3300025929 Bacteria 3056
168 Ga0207664_10063746 3300025929 Bacteria 2946
169 Ga0207664_10077773 3300025929 Bacteria 2689
170 Ga0207664_10101893 3300025929 Unclassified 2373
171 Ga0207664_10173247 3300025929 Bacteria 1848
172 Ga0207664_10237614 3300025929 Bacteria 1586
173 Ga0207664_10296455 3300025929 Bacteria 1422
174 Ga0207664_10343342 3300025929 Bacteria 1320
175 Ga0207665_10002139 3300025939 Bacteria 13360
176 Ga0207665_10003455 3300025939 Bacteria 10555
177 Ga0207711_10095365 3300025941 Bacteria 2624
178 Ga0207689_10042186 3300025942 Bacteria 3775
179 Ga0207667_10492785 3300025949 Bacteria 1243
180 Ga0207639_10256535 3300026041 Bacteria 1527
181 Ga0207678_10010755 3300026067 Bacteria 8040
182 Ga0207708_10011012 3300026075 Bacteria 6726
183 Ga0207702_10074389 3300026078 Bacteria 2932
184 Ga0207702_10341218 3300026078 Bacteria 1431
185 Ga0207641_10081037 3300026088 Bacteria 2818
186 Ga0207641_10241153 3300026088 Bacteria 1684
187 Ga0207648_10045229 3300026089 Bacteria 3862
188 Ga0207674_10018630 3300026116 Bacteria 7540
189 Ga0207674_10302057 3300026116 Bacteria 1550
190 Ga0207683_10162512 3300026121 Bacteria 2020
191 Ga0268265_10243423 3300028380 Bacteria 1589
192 Ga0373948_0006622 3300034817 Bacteria 1922
193 Ga0373938_0003427 3300034957 Bacteria 2600
194 Ga0373926_0000053 3300035083 Bacteria 20049
195 Ga0373926_0005549 3300035083 Bacteria 4160
196 Ga0373928_0024148 3300035084 Bacteria 1302
197 Ga0373934_0011625 3300035086 Bacteria 3312
198 Ga0373934_0011789 3300035086 Bacteria 3292
199 Ga0373940_0001769 3300035088 Bacteria 4018
200 Ga0373944_0000416 3300035089 Bacteria 9754
201 Ga0373944_0001549 3300035089 Bacteria 5814
202 Ga0373949_0010161 3300035090 Bacteria 2061
203 Ga0373923_0032536 3300035111 Bacteria 2107
204 Ga0373932_0031066 3300035112 Bacteria 1485
205 Ga0373936_0013831 3300035113 Bacteria 3080
206 Ga0373941_0055361 3300035115 Bacteria 1274
207 Ga0373945_0000114 3300035116 Bacteria 19621
208 Ga0373953_0010917 3300035117 Bacteria 3174
209 Ga0373954_0002783 3300035118 Bacteria 7368
210 Ga0373954_0023423 3300035118 Bacteria 2807
211 Ga0373954_0087246 3300035118 Bacteria 1496
212 Ga0373956_0060574 3300035119 Bacteria 1714
213 Ga0373957_0001199 3300035120 Bacteria 6932
214 Ga0373957_0006580 3300035120 Bacteria 3670
215 Ga0373957_0033865 3300035120 Bacteria 1888
216 Ga0373957_0073042 3300035120 Bacteria 1344
217 Ga0373943_0001107 3300035170 Bacteria 12035
218 Ga0373943_0054422 3300035170 Unclassified 1979
219 Ga0373943_0098241 3300035170 Unclassified 1527
220 Ga0373946_0000137 3300035171 Bacteria 22003
221 Ga0373946_0020573 3300035171 Bacteria 2551
222 Ga0373955_0000025 3300035172 Bacteria 58341
223 Ga0373955_0118551 3300035172 Bacteria 1536
224 Ga0373942_0007118 3300035207 Bacteria 2589
225 Ga0373924_0000885 3300035410 Bacteria 9438
226 Ga0373931_0082512 3300035691 Unclassified 1777
227 Ga0373931_0150375 3300035691 Bacteria 1356
228 Ga0373935_0002017 3300035692 Bacteria 11465
229 Ga0373935_0087580 3300035692 Bacteria 2033
230 Ga0373935_0089561 3300035692 Bacteria 2012
231 Ga0373933_0000119 3300035724 Bacteria 51009
232 Ga0373933_0009555 3300035724 Bacteria 5295
233 Ga0373933_0027442 3300035724 Bacteria 3278
234 Ga0373933_0044559 3300035724 Bacteria 2628
235 Ga0373933_0089998 3300035724 Bacteria 1892
236 Ga0373947_0000099 3300035725 Bacteria 43868
237 Ga0373947_0004890 3300035725 Bacteria 7841
238 Ga0373937_0000306 3300036401 Bacteria 46226
239 Ga0373937_0010502 3300036401 Bacteria 8085
240 Ga0373937_0024391 3300036401 Bacteria 5455
241 Ga0373937_0113842 3300036401 Bacteria 2517
242 Ga0373937_0210253 3300036401 Bacteria 1830
243 Ga0372808_000786 3300036459 Bacteria 2854
244 Ga0373925_0006714 3300037068 Bacteria 8441
245 Ga0373925_0006871 3300037068 Bacteria 8329
246 Ga0373925_0079741 3300037068 Bacteria 2488
247 Ga0436364_0503758 3300037853 Bacteria 6769
248 Ga0436365_0259442 3300039437 Bacteria 17659
249 Ga0436365_0488470 3300039437 Bacteria 27098
250 Ga0436365_1613065 3300039437 Bacteria 3754
251 Ga0436363_0116338 3300039450 Bacteria 1285
252 Ga0436362_0439328 3300039453 Bacteria 1484
253 Ga0466966_0015192 3300044684 Bacteria 5094
254 Ga0466961_0022607 3300044693 Bacteria 4046
255 Ga0466963_0100345 3300044694 Bacteria 1981
256 Ga0466971_0013490 3300044719 Bacteria 3590
257 Ga0466970_0042546 3300044765 Bacteria 2416
258 Ga0466957_0135580 3300044842 Unclassified 1582
259 Ga0466958_0013266 3300045836 Bacteria 4689
260 Ga0466958_0060445 3300045836 Unclassified 2307
261 Ga0466958_0075794 3300045836 Bacteria 2064
262 Ga0466967_0473503 3300045976 Bacteria 1226
263 Ga0495592_0000200 3300046454 Bacteria 51023
264 Ga0495592_0067278 3300046454 Bacteria 2618
265 Ga0495592_0116885 3300046454 Bacteria 1881
266 Ga0495629_0022134 3300046459 Bacteria 4532
267 Ga0495641_0023122 3300046461 Bacteria 3095
268 Ga0495651_0000151 3300046462 Bacteria 51025
269 Ga0495651_0001327 3300046462 Bacteria 19162
270 Ga0495651_0009665 3300046462 Bacteria 7416
271 Ga0495651_0020503 3300046462 Bacteria 5132
272 Ga0495651_0031724 3300046462 Bacteria 4119
273 Ga0495651_0036632 3300046462 Bacteria 3819
274 Ga0495651_0121376 3300046462 Unclassified 1919
275 Ga0495653_0011395 3300046463 Bacteria 7265
276 Ga0495653_0013168 3300046463 Bacteria 6744
277 Ga0495653_0030925 3300046463 Bacteria 4259
278 Ga0495653_0069826 3300046463 Bacteria 2630
279 Ga0495653_0072176 3300046463 Bacteria 2578
280 Ga0495653_0077416 3300046463 Bacteria 2469
281 Ga0495653_0095389 3300046463 Bacteria 2165
282 Ga0495580_0004741 3300046472 Bacteria 11383
283 Ga0495639_0030021 3300046475 Bacteria 2415
284 Ga0495662_0033727 3300046476 Bacteria 2473
285 Ga0495664_0006193 3300046477 Bacteria 6606
286 Ga0495594_0007458 3300046499 Bacteria 5627
287 Ga0495594_0029968 3300046499 Bacteria 2942
288 Ga0495608_0000147 3300046511 Bacteria 50943
289 Ga0495608_0007136 3300046511 Bacteria 7903
290 Ga0495608_0028072 3300046511 Bacteria 3825
291 Ga0495608_0052296 3300046511 Bacteria 2704
292 Ga0495608_0052827 3300046511 Bacteria 2689
293 Ga0495618_0002903 3300046514 Bacteria 10849
294 Ga0495618_0021444 3300046514 Bacteria 3983
295 Ga0495618_0051655 3300046514 Bacteria 2597
296 Ga0495628_0000753 3300046516 Bacteria 29919
297 Ga0495628_0006865 3300046516 Bacteria 9896
298 Ga0495628_0114627 3300046516 Bacteria 2070
299 Ga0495628_0168063 3300046516 Bacteria 1664
300 Ga0495630_0018053 3300046517 Bacteria 5177
301 Ga0495630_0023555 3300046517 Bacteria 4551
302 Ga0495630_0042379 3300046517 Bacteria 3399
303 Ga0495630_0111348 3300046517 Bacteria 2073
304 Ga0495652_0000276 3300046529 Bacteria 60614
305 Ga0495652_0002632 3300046529 Bacteria 18323
306 Ga0495652_0022558 3300046529 Bacteria 5585
307 Ga0495652_0069723 3300046529 Bacteria 2941
308 Ga0495652_0106229 3300046529 Bacteria 2267
309 Ga0495640_0020727 3300046533 Bacteria 4834
310 Ga0495640_0025907 3300046533 Bacteria 4246
311 Ga0495640_0125412 3300046533 Bacteria 1665
312 Ga0495586_0086491 3300046535 Unclassified 1728
313 Ga0495587_0000045 3300046536 Bacteria 108362
314 Ga0495587_0002282 3300046536 Bacteria 12845
315 Ga0495587_0017474 3300046536 Bacteria 4455
316 Ga0495587_0044475 3300046536 Bacteria 2641
317 Ga0495587_0051155 3300046536 Bacteria 2443
318 Ga0495587_0118683 3300046536 Bacteria 1515
319 Ga0495645_0003637 3300046543 Bacteria 10469
320 Ga0495645_0103915 3300046543 Unclassified 2018
321 Ga0495645_0206684 3300046543 Bacteria 1328
322 Ga0495667_0000051 3300046559 Bacteria 109277
323 Ga0495667_0003441 3300046559 Bacteria 10610
324 Ga0495667_0008153 3300046559 Bacteria 7108
325 Ga0495667_0009808 3300046559 Bacteria 6485
326 Ga0495634_0014722 3300046642 Bacteria 5629
327 Ga0495634_0016354 3300046642 Bacteria 5306
328 Ga0495634_0074287 3300046642 Bacteria 2234
329 Ga0495635_0001894 3300046663 Bacteria 14212
330 Ga0495635_0006438 3300046663 Bacteria 8186
331 Ga0495635_0015028 3300046663 Bacteria 5415
332 Ga0495635_0057207 3300046663 Bacteria 2683
333 Ga0495635_0175642 3300046663 Bacteria 1456
334 Ga0495657_0000044 3300046675 Bacteria 108383
335 Ga0495657_0022003 3300046675 Bacteria 4570
336 Ga0495657_0022062 3300046675 Bacteria 4565
337 Ga0495657_0033482 3300046675 Bacteria 3577
338 Ga0495657_0043881 3300046675 Unclassified 3045
339 Ga0495657_0054204 3300046675 Bacteria 2680
340 Ga0495599_0000101 3300046678 Bacteria 60499
341 Ga0495599_0002947 3300046678 Bacteria 9899
342 Ga0495599_0063584 3300046678 Bacteria 2306
343 Ga0495599_0174133 3300046678 Unclassified 1327
344 Ga0495623_0001529 3300046679 Bacteria 15620
345 Ga0495623_0026720 3300046679 Bacteria 3714
346 Ga0495623_0056836 3300046679 Bacteria 2462
347 Ga0495646_0013261 3300046680 Bacteria 5238
348 Ga0495646_0013276 3300046680 Bacteria 5234
349 Ga0495647_0003712 3300046681 Bacteria 4906
350 Ga0495613_0013878 3300046689 Bacteria 5978
351 Ga0495624_0011126 3300046690 Bacteria 6190
352 Ga0495624_0015308 3300046690 Bacteria 5182
353 Ga0495600_0018713 3300046809 Bacteria 4417
354 Ga0495600_0020734 3300046809 Bacteria 4204
355 Ga0495600_0039212 3300046809 Bacteria 3084
356 Ga0495600_0049153 3300046809 Bacteria 2752
357 Ga0495581_0055081 3300047315 Bacteria 2296
358 Ga0495581_0127840 3300047315 Bacteria 1480
359 Ga0495604_0000046 3300047317 Bacteria 110553
360 Ga0495604_0010113 3300047317 Bacteria 7474
361 Ga0495604_0119410 3300047317 Bacteria 1910
362 Ga0495604_0121280 3300047317 Bacteria 1892
363 Ga0495674_0002081 3300047319 Bacteria 19639
364 Ga0495674_0009272 3300047319 Bacteria 9352
365 Ga0495676_0003166 3300047321 Bacteria 14869
366 Ga0495680_0000108 3300047322 Bacteria 77095
367 Ga0495680_0006711 3300047322 Bacteria 10648
368 Ga0495680_0010042 3300047322 Bacteria 8465
369 Ga0495680_0014669 3300047322 Bacteria 6777
370 Ga0495680_0028733 3300047322 Bacteria 4558
371 Ga0495680_0049563 3300047322 Bacteria 3289
372 Ga0495680_0057446 3300047322 Bacteria 3009
373 Ga0495680_0062874 3300047322 Bacteria 2852
374 Ga0495675_0000119 3300047444 Bacteria 57079
375 Ga0495675_0010168 3300047444 Bacteria 5869
376 Ga0495684_0003003 3300047471 Bacteria 13273
377 Ga0495684_0035884 3300047471 Bacteria 3801
378 Ga0495684_0077350 3300047471 Bacteria 2526
379 Ga0495684_0123309 3300047471 Bacteria 1950
380 Ga0495602_0000167 3300048088 Bacteria 61216
381 Ga0495602_0012398 3300048088 Bacteria 8766
382 Ga0495602_0169956 3300048088 Bacteria 1693
383 Ga0495602_0204382 3300048088 Bacteria 1504
384 Ga0495614_0040051 3300048089 Bacteria 2011
385 Ga0496100_0150517 3300048903 Bacteria 1659
386 Ga0496100_0177718 3300048903 Bacteria 1538
387 Ga0496100_0350043 3300048903 Bacteria 1115
388 Ga0496102_0029454 3300048905 Bacteria 4912
389 Ga0496102_0063305 3300048905 Bacteria 3386
390 Ga0496102_0080639 3300048905 Unclassified 2998
391 Ga0496102_0537680 3300048905 Bacteria 1091
392 Ga0496103_0128550 3300048906 Bacteria 1617
393 Ga0496104_0115851 3300048907 Bacteria 2571
394 Ga0496105_0017670 3300048908 Bacteria 5722
395 Ga0496105_0081328 3300048908 Bacteria 2675
396 Ga0496105_0135706 3300048908 Unclassified 2027
397 Ga0496106_0012056 3300048909 Bacteria 6378
398 Ga0496107_0026141 3300048910 Bacteria 4138
399 Ga0496108_0057961 3300048911 Bacteria 3254
400 Ga0496108_0245166 3300048911 Unclassified 1559
401 Ga0496108_0252715 3300048911 Bacteria 1533
402 Ga0496109_0049163 3300048912 Bacteria 3838
403 Ga0496109_0064388 3300048912 Bacteria 3355
404 Ga0496109_0087209 3300048912 Bacteria 2882
405 Ga0496110_0017758 3300048913 Bacteria 5952
406 Ga0496110_0166422 3300048913 Bacteria 1999
407 Ga0496111_0311084 3300048914 Bacteria 1167
408 Ga0496112_0016512 3300048915 Bacteria 6919
409 Ga0496112_0097131 3300048915 Bacteria 2916
410 Ga0496114_0008833 3300048917 Bacteria 7987
411 Ga0501036_0142334 3300049572 Bacteria 2023
412 Ga0501039_0064232 3300049575 Bacteria 2845
413 Ga0501040_0145333 3300049576 Bacteria 1671
414 Ga0501041_0031089 3300049577 Bacteria 3223
415 Ga0501042_0028369 3300049578 Bacteria 3943
416 Ga0501043_0267567 3300049579 Archaea 1313
417 Ga0501048_0036662 3300049582 Bacteria 3524
418 Ga0501067_0006842 3300049583 Bacteria 6326
419 Ga0501069_0103557 3300049585 Bacteria 1617
420 Ga0501071_0317614 3300049587 Archaea 1182
421 Ga0501072_0042738 3300049588 Bacteria 3560
422 Ga0501074_0307808 3300049590 Archaea 1125
423 Ga0501075_0097816 3300049591 Bacteria 2227
424 Ga0501076_0060885 3300049592 Bacteria 3004
425 Ga0501077_0055154 3300049593 Bacteria 2523
426 Ga0501080_0479367 3300049742 Archaea 1113
427 Ga0501081_0072459 3300049743 Bacteria 2402
428 Ga0501083_0117182 3300049744 Bacteria 1748
429 Ga0501044_0459428 3300049823 Archaea 1179
430 Ga0501045_0034310 3300049824 Bacteria 3683
431 Ga0501045_0118373 3300049824 Bacteria 1966
432 nmdc:mga0n895_16343_c1 3300050512 Bacteria 6805
433 nmdc:mga0n895_38380_c1 3300050512 Bacteria 4641
434 nmdc:mga0rr50_19140_c1 3300050513 Bacteria 4614
435 nmdc:mga0rr50_8519_c1 3300050513 Bacteria 6388
436 nmdc:mga08x19_128693_c1 3300050514 Bacteria 1702
437 nmdc:mga08x19_22014_c1 3300050514 Bacteria 3943
438 nmdc:mga0a205_29022_c1 3300050515 Bacteria 5293
439 Ga0495601_0011723 3300053077 Bacteria 5254
440 Ga0495612_0000875 3300053078 Bacteria 12283
441 Ga0495595_0000441 3300053084 Bacteria 15723
442 Ga0495595_0001674 3300053084 Bacteria 8679
443 Ga0495619_0006619 3300053085 Bacteria 7333
444 Ga0495619_0025529 3300053085 Bacteria 3795
445 Ga0495619_0126118 3300053085 Bacteria 1757
446 Ga0495619_0191243 3300053085 Bacteria 1416
447 Ga0501084_0190859 3300054114 Bacteria 1728
448 Ga0590071_020872 3300059421 Bacteria 1543
449 Ga0590075_017428 3300059424 Bacteria 1770
450 Ga0501082_0155312 3300060353 Bacteria 1988
451 Ga0466962_0016559 3300061719 Bacteria 3555
452 Ga0530510_0012863 3300061734 Bacteria 5884
453 Ga0070714_100050381
454 rootH1_10331165
455 Ga0070658_10026223
456 Ga0070658_10030764
457 Ga0070683_100222393
458 Ga0070690_100025809
459 Ga0070680_100023658
460 Ga0070680_100176268
461 Ga0070680_100241601
462 Ga0070682_100057321
463 Ga0070682_100163350
464 Ga0070689_100111027
465 Ga0070691_10088722
466 Ga0070669_100120385
467 Ga0070675_100119290
468 Ga0070674_100110759
469 Ga0070673_100042392
470 Ga0070709_10001925
471 Ga0070709_10013884
472 Ga0070714_100013642
473 Ga0070714_100029503
474 Ga0070714_100059331
475 Ga0070714_100233195
476 Ga0070714_100393814
477 Ga0070713_100004483
478 Ga0070713_100025330
479 Ga0070710_10001397
480 Ga0070710_10015300
481 Ga0070710_10076713
482 Ga0070710_10130913
483 Ga0070711_100023357
484 Ga0070711_100029641
485 Ga0070711_100089226
486 Ga0070711_100114257
487 Ga0070711_100209194
488 Ga0070705_100123211
489 Ga0070708_100028633
490 Ga0070708_100043925
491 Ga0070681_10201472
492 Ga0070685_10034300
493 Ga0070706_100020952
494 Ga0070706_100059180
495 Ga0070706_100084204
496 Ga0070706_100109663
497 Ga0070706_100117566
498 Ga0070706_100119742
499 Ga0070707_100000681
500 Ga0070707_100030918
501 Ga0070707_100056287
502 Ga0070707_100170600
503 Ga0070707_100242669
504 Ga0070698_100043587
505 Ga0070698_100075997
506 Ga0070698_100248747
507 Ga0070699_100000138
508 Ga0070679_100014858
509 Ga0070697_100008944
510 Ga0070697_100060194
511 Ga0068853_100029012
512 Ga0070672_100034949
513 Ga0070695_100037371
514 Ga0070695_100053271
515 Ga0070693_100054471
516 Ga0070704_100025202
517 Ga0070664_100145040
518 Ga0068856_100263753
519 Ga0068856_100457159
520 Ga0068863_100144984
521 Ga0068863_100236040
522 Ga0068860_100254555
523 Ga0081455_10005427
524 Ga0081540_1000154
525 Ga0081540_1001071
526 Ga0081540_1007444
527 Ga0070717_10012362
528 Ga0070717_10018153
529 Ga0070717_10228320
530 Ga0070715_10009078
531 Ga0070716_100000662
532 Ga0070716_100034816
533 Ga0070716_100136344
534 Ga0070712_100015229
535 Ga0070712_100045007
536 Ga0070712_100060278
537 Ga0068871_100212683
538 Ga0075434_100008309
539 Ga0075434_100090141
540 Ga0075434_100308955
541 Ga0075436_100009610
542 Ga0075436_100041273
543 Ga0075436_100129856
544 Ga0075435_100002629
545 Ga0075435_100175877
546 Ga0099795_10045727
547 Ga0105251_10031216
548 Ga0105240_10126351
549 Ga0105245_10200236
550 Ga0105241_10131427
551 Ga0105242_10102626
552 Ga0105248_10090406
553 Ga0105237_10131728
554 Ga0105239_10298008
555 Ga0105246_10059764
556 Ga0157371_10178450
557 Ga0157369_10028858
558 Ga0157369_10110658
559 Ga0157369_10212050
560 Ga0157374_10096915
561 Ga0157374_10258290
562 Ga0157372_10148495
563 Ga0157372_10248503
564 Ga0163163_10110521
565 Ga0163163_10439401
566 Ga0157379_10084608
567 Ga0157376_10080071
568 Ga0207692_10006811
569 Ga0207692_10007361
570 Ga0207692_10014301
571 Ga0207692_10143936
572 Ga0207688_10007884
573 Ga0207680_10055456
574 Ga0207699_10000509
575 Ga0207699_10002632
576 Ga0207699_10006215
577 Ga0207699_10038877
578 Ga0207699_10047585
579 Ga0207699_10069099
580 Ga0207643_10038990
581 Ga0207705_10107038
582 Ga0207684_10001196
583 Ga0207684_10017129
584 Ga0207684_10051159
585 Ga0207684_10102851
586 Ga0207684_10123506
587 Ga0207684_10313058
588 Ga0207654_10156840
589 Ga0207654_10283800
590 Ga0207671_10077994
591 Ga0207693_10013320
592 Ga0207693_10026435
593 Ga0207693_10028208
594 Ga0207693_10051752
595 Ga0207693_10062677
596 Ga0207693_10074166
597 Ga0207663_10017988
598 Ga0207663_10062516
599 Ga0207660_10049694
600 Ga0207662_10011097
601 Ga0207657_10034306
602 Ga0207649_10019783
603 Ga0207646_10004638
604 Ga0207646_10010773
605 Ga0207646_10169191
606 Ga0207694_10141313
607 Ga0207687_10102222
608 Ga0207700_10002204
609 Ga0207700_10008687
610 Ga0207700_10027198
611 Ga0207700_10089711
612 Ga0207700_10105770
613 Ga0207700_10223291
614 Ga0207700_10223328
615 Ga0207700_10264394
616 Ga0207664_10010363
617 Ga0207664_10010892
618 Ga0207664_10012885
619 Ga0207664_10058980
620 Ga0207664_10063746
621 Ga0207664_10077773
622 Ga0207664_10101893
623 Ga0207664_10173247
624 Ga0207664_10237614
625 Ga0207664_10296455
626 Ga0207664_10343342
627 Ga0207665_10002139
628 Ga0207665_10003455
629 Ga0207711_10095365
630 Ga0207689_10042186
631 Ga0207667_10492785
632 Ga0207639_10256535
633 Ga0207678_10010755
634 Ga0207708_10011012
635 Ga0207702_10074389
636 Ga0207702_10341218
637 Ga0207641_10081037
638 Ga0207641_10241153
639 Ga0207648_10045229
640 Ga0207674_10018630
641 Ga0207674_10302057
642 Ga0207683_10162512
643 Ga0268265_10243423
644 Ga0373948_0006622
645 Ga0373938_0003427
646 Ga0373926_0000053
647 Ga0373926_0005549
648 Ga0373928_0024148
649 Ga0373934_0011625
650 Ga0373934_0011789
651 Ga0373940_0001769
652 Ga0373944_0000416
653 Ga0373944_0001549
654 Ga0373949_0010161
655 Ga0373923_0032536
656 Ga0373932_0031066
657 Ga0373936_0013831
658 Ga0373941_0055361
659 Ga0373945_0000114
660 Ga0373953_0010917
661 Ga0373954_0002783
662 Ga0373954_0023423
663 Ga0373954_0087246
664 Ga0373956_0060574
665 Ga0373957_0001199
666 Ga0373957_0006580
667 Ga0373957_0033865
668 Ga0373957_0073042
669 Ga0373943_0001107
670 Ga0373943_0054422
671 Ga0373943_0098241
672 Ga0373946_0000137
673 Ga0373946_0020573
674 Ga0373955_0000025
675 Ga0373955_0118551
676 Ga0373942_0007118
677 Ga0373924_0000885
678 Ga0373931_0082512
679 Ga0373931_0150375
680 Ga0373935_0002017
681 Ga0373935_0087580
682 Ga0373935_0089561
683 Ga0373933_0000119
684 Ga0373933_0009555
685 Ga0373933_0027442
686 Ga0373933_0044559
687 Ga0373933_0089998
688 Ga0373947_0000099
689 Ga0373947_0004890
690 Ga0373937_0000306
691 Ga0373937_0010502
692 Ga0373937_0024391
693 Ga0373937_0113842
694 Ga0373937_0210253
695 Ga0372808_000786
696 Ga0373925_0006714
697 Ga0373925_0006871
698 Ga0373925_0079741
699 Ga0436364_0503758
700 Ga0436365_0259442
701 Ga0436365_0488470
702 Ga0436365_1613065
703 Ga0436363_0116338
704 Ga0436362_0439328
705 Ga0466966_0015192
706 Ga0466961_0022607
707 Ga0466963_0100345
708 Ga0466971_0013490
709 Ga0466970_0042546
710 Ga0466957_0135580
711 Ga0466958_0013266
712 Ga0466958_0060445
713 Ga0466958_0075794
714 Ga0466967_0473503
715 Ga0495592_0000200
716 Ga0495592_0067278
717 Ga0495592_0116885
718 Ga0495629_0022134
719 Ga0495641_0023122
720 Ga0495651_0000151
721 Ga0495651_0001327
722 Ga0495651_0009665
723 Ga0495651_0020503
724 Ga0495651_0031724
725 Ga0495651_0036632
726 Ga0495651_0121376
727 Ga0495653_0011395
728 Ga0495653_0013168
729 Ga0495653_0030925
730 Ga0495653_0069826
731 Ga0495653_0072176
732 Ga0495653_0077416
733 Ga0495653_0095389
734 Ga0495580_0004741
735 Ga0495639_0030021
736 Ga0495662_0033727
737 Ga0495664_0006193
738 Ga0495594_0007458
739 Ga0495594_0029968
740 Ga0495608_0000147
741 Ga0495608_0007136
742 Ga0495608_0028072
743 Ga0495608_0052296
744 Ga0495608_0052827
745 Ga0495618_0002903
746 Ga0495618_0021444
747 Ga0495618_0051655
748 Ga0495628_0000753
749 Ga0495628_0006865
750 Ga0495628_0114627
751 Ga0495628_0168063
752 Ga0495630_0018053
753 Ga0495630_0023555
754 Ga0495630_0042379
755 Ga0495630_0111348
756 Ga0495652_0000276
757 Ga0495652_0002632
758 Ga0495652_0022558
759 Ga0495652_0069723
760 Ga0495652_0106229
761 Ga0495640_0020727
762 Ga0495640_0025907
763 Ga0495640_0125412
764 Ga0495586_0086491
765 Ga0495587_0000045
766 Ga0495587_0002282
767 Ga0495587_0017474
768 Ga0495587_0044475
769 Ga0495587_0051155
770 Ga0495587_0118683
771 Ga0495645_0003637
772 Ga0495645_0103915
773 Ga0495645_0206684
774 Ga0495667_0000051
775 Ga0495667_0003441
776 Ga0495667_0008153
777 Ga0495667_0009808
778 Ga0495634_0014722
779 Ga0495634_0016354
780 Ga0495634_0074287
781 Ga0495635_0001894
782 Ga0495635_0006438
783 Ga0495635_0015028
784 Ga0495635_0057207
785 Ga0495635_0175642
786 Ga0495657_0000044
787 Ga0495657_0022003
788 Ga0495657_0022062
789 Ga0495657_0033482
790 Ga0495657_0043881
791 Ga0495657_0054204
792 Ga0495599_0000101
793 Ga0495599_0002947
794 Ga0495599_0063584
795 Ga0495599_0174133
796 Ga0495623_0001529
797 Ga0495623_0026720
798 Ga0495623_0056836
799 Ga0495646_0013261
800 Ga0495646_0013276
801 Ga0495647_0003712
802 Ga0495613_0013878
803 Ga0495624_0011126
804 Ga0495624_0015308
805 Ga0495600_0018713
806 Ga0495600_0020734
807 Ga0495600_0039212
808 Ga0495600_0049153
809 Ga0495581_0055081
810 Ga0495581_0127840
811 Ga0495604_0000046
812 Ga0495604_0010113
813 Ga0495604_0119410
814 Ga0495604_0121280
815 Ga0495674_0002081
816 Ga0495674_0009272
817 Ga0495676_0003166
818 Ga0495680_0000108
819 Ga0495680_0006711
820 Ga0495680_0010042
821 Ga0495680_0014669
822 Ga0495680_0028733
823 Ga0495680_0049563
824 Ga0495680_0057446
825 Ga0495680_0062874
826 Ga0495675_0000119
827 Ga0495675_0010168
828 Ga0495684_0003003
829 Ga0495684_0035884
830 Ga0495684_0077350
831 Ga0495684_0123309
832 Ga0495602_0000167
833 Ga0495602_0012398
834 Ga0495602_0169956
835 Ga0495602_0204382
836 Ga0495614_0040051
837 Ga0496100_0150517
838 Ga0496100_0177718
839 Ga0496100_0350043
840 Ga0496102_0029454
841 Ga0496102_0063305
842 Ga0496102_0080639
843 Ga0496102_0537680
844 Ga0496103_0128550
845 Ga0496104_0115851
846 Ga0496105_0017670
847 Ga0496105_0081328
848 Ga0496105_0135706
849 Ga0496106_0012056
850 Ga0496107_0026141
851 Ga0496108_0057961
852 Ga0496108_0245166
853 Ga0496108_0252715
854 Ga0496109_0049163
855 Ga0496109_0064388
856 Ga0496109_0087209
857 Ga0496110_0017758
858 Ga0496110_0166422
859 Ga0496111_0311084
860 Ga0496112_0016512
861 Ga0496112_0097131
862 Ga0496114_0008833
863 Ga0501036_0142334
864 Ga0501039_0064232
865 Ga0501040_0145333
866 Ga0501041_0031089
867 Ga0501042_0028369
868 Ga0501043_0267567
869 Ga0501048_0036662
870 Ga0501067_0006842
871 Ga0501069_0103557
872 Ga0501071_0317614
873 Ga0501072_0042738
874 Ga0501074_0307808
875 Ga0501075_0097816
876 Ga0501076_0060885
877 Ga0501077_0055154
878 Ga0501080_0479367
879 Ga0501081_0072459
880 Ga0501083_0117182
881 Ga0501044_0459428
882 Ga0501045_0034310
883 Ga0501045_0118373
884 nmdc:mga0n895_16343_c1
885 nmdc:mga0n895_38380_c1
886 nmdc:mga0rr50_19140_c1
887 nmdc:mga0rr50_8519_c1
888 nmdc:mga08x19_128693_c1
889 nmdc:mga08x19_22014_c1
890 nmdc:mga0a205_29022_c1
891 Ga0495601_0011723
892 Ga0495612_0000875
893 Ga0495595_0000441
894 Ga0495595_0001674
895 Ga0495619_0006619
896 Ga0495619_0025529
897 Ga0495619_0126118
898 Ga0495619_0191243
899 Ga0501084_0190859
900 Ga0590071_020872
901 Ga0590075_017428
902 Ga0501082_0155312
903 Ga0466962_0016559
904 Ga0530510_0012863

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

104

193

0.78

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

87

281

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h3e-assembly1.cif.gz_A crystal structure of tm1679, a metal-dependent hydrolase of the beta-lactamase superfamily 0.8853 12 326
2p4z-assembly2.cif.gz_B a ferredoxin-like metallo-beta-lactamase superfamily protein from thermoanaerobacter tengcongensis 0.8762 10 324
3h3e-assembly1.cif.gz_A crystal structure of tm1679, a metal-dependent hydrolase of the beta-lactamase superfamily 0.8722 12 326
7dck-assembly1.cif.gz_B crystal structure of phosphodiesterase tw9814 0.8718 8 326
2p4z-assembly2.cif.gz_B a ferredoxin-like metallo-beta-lactamase superfamily protein from thermoanaerobacter tengcongensis 0.8612 10 324
ID Description Score Start End Superfamily
2p4zA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8881 10 324 3.60.15.10
af_Q57749_3_293_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.888 4 324 3.60.15.10
af_Q57749_3_293_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8822 4 324 3.60.15.10
2p4zA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8759 10 324 3.60.15.10
3h3eA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8668 13 326 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A348W4X7-F1-model_v4 deleted 0.9877 231 322
AF-A0A1X1UG40-F1-model_v4 MBL fold metallo-hydrolase 0.9849 222 324 GO:0016740
AF-A0A7C4H384-F1-model_v4 MBL fold metallo-hydrolase 0.9826 225 322 GO:0016740
GO:0016787
AF-A0A536DWX4-F1-model_v4 MBL fold metallo-hydrolase 0.9792 74 326 GO:0016740
GO:0016787
AF-A0A7C4NCD3-F1-model_v4 MBL fold metallo-hydrolase 0.9776 248 322 GO:0016740

Map