F446912

General Info

Members Datasets Scaffolds Average Seq Length
452 252 904 198

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10029003|Ga0070658_100290032
Length 194
Sequence VSTFEEAAGEHHGPPPIHYSSRVTPAVLGMFLFIGSEIMLFGSFFTVYFFDRVVGHGVNGHWPPVGFERPWFLAGINTVLLVTSSFSMHWADTSVKRGNRAGLRAGLVLTVCLGLTFLSIQVIEYHRLGFNTGDTSFASTFFGLTGLHACHVFVGRAFRGHFSPEHHHGVEIAGIYWHFVDVMWIVVYVTVYLL

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
78 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
123 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
134 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
135 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
136 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
153 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
154 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
170 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
251 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.58
Metatranscriptomes 4.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 10.18
Rhizosphere 88.5
Stem 0
Stem Tuber 0
Unclassified 6.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10029003 3300005327 Bacteria 4444
2 Ga0058861_11967305 3300004800 Unclassified 997
3 Ga0070658_10256709 3300005327 Bacteria 1483
4 Ga0070658_10319928 3300005327 Bacteria 1325
5 Ga0070658_10342699 3300005327 Bacteria 1278
6 Ga0070676_10250504 3300005328 Bacteria 1182
7 Ga0070683_100008018 3300005329 Bacteria 8962
8 Ga0070683_100197863 3300005329 Unclassified 1908
9 Ga0070680_100152106 3300005336 Unclassified 1943
10 Ga0070682_100053754 3300005337 Bacteria 2525
11 Ga0070682_100057387 3300005337 Bacteria 2452
12 Ga0068868_100009008 3300005338 Bacteria 7164
13 Ga0070660_100051968 3300005339 Bacteria 3158
14 Ga0070660_100057688 3300005339 Bacteria 3009
15 Ga0070660_100238199 3300005339 Bacteria 1481
16 Ga0070660_100690448 3300005339 Bacteria 855
17 Ga0070691_10005002 3300005341 Bacteria 6030
18 Ga0070661_100110796 3300005344 Bacteria 2049
19 Ga0070661_100148409 3300005344 Unclassified 1771
20 Ga0070661_100348789 3300005344 Unclassified 1161
21 Ga0070669_100696181 3300005353 Bacteria 858
22 Ga0070674_100087666 3300005356 Bacteria 2238
23 Ga0070659_100007213 3300005366 Bacteria 8066
24 Ga0070659_100353890 3300005366 Bacteria 1232
25 Ga0070703_10024958 3300005406 Bacteria 1770
26 Ga0070705_100154233 3300005440 Bacteria 1527
27 Ga0070700_100002630 3300005441 Bacteria 9189
28 Ga0070694_100019045 3300005444 Bacteria 4362
29 Ga0070708_100136631 3300005445 Bacteria 2271
30 Ga0070663_100057079 3300005455 Bacteria 2800
31 Ga0070663_100571297 3300005455 Unclassified 947
32 Ga0070678_100041486 3300005456 Bacteria 3262
33 Ga0070678_100044402 3300005456 Bacteria 3174
34 Ga0070662_100068369 3300005457 Bacteria 2611
35 Ga0070681_10007555 3300005458 Bacteria 10621
36 Ga0070681_10011313 3300005458 Bacteria 8830
37 Ga0070681_10036121 3300005458 Bacteria 4963
38 Ga0070679_100016331 3300005530 Bacteria 7157
39 Ga0070679_100083514 3300005530 Bacteria 3182
40 Ga0070679_100109669 3300005530 Bacteria 2746
41 Ga0070684_100053408 3300005535 Bacteria 3518
42 Ga0068853_100034131 3300005539 Bacteria 4317
43 Ga0068853_100285383 3300005539 Unclassified 1522
44 Ga0070696_100015479 3300005546 Bacteria 5123
45 Ga0070696_100147303 3300005546 Bacteria 1725
46 Ga0070693_100003891 3300005547 Bacteria 7005
47 Ga0070693_100177823 3300005547 Bacteria 1368
48 Ga0070665_100012036 3300005548 Bacteria 8725
49 Ga0070665_100613531 3300005548 Bacteria 1101
50 Ga0070704_100418883 3300005549 Bacteria 1146
51 Ga0070704_100492168 3300005549 Unclassified 1063
52 Ga0068855_100014674 3300005563 Bacteria 9437
53 Ga0068855_100025529 3300005563 Bacteria 7068
54 Ga0068855_100328904 3300005563 Bacteria 1687
55 Ga0070664_100172539 3300005564 Bacteria 1919
56 Ga0068857_100550819 3300005577 Bacteria 1086
57 Ga0068854_100027887 3300005578 Bacteria 3895
58 Ga0068854_100076105 3300005578 Bacteria 2466
59 Ga0068856_100045175 3300005614 Bacteria 4336
60 Ga0068856_100085156 3300005614 Bacteria 3140
61 Ga0070702_100021611 3300005615 Bacteria 3389
62 Ga0070702_100438214 3300005615 Unclassified 945
63 Ga0068852_100032190 3300005616 Bacteria 4339
64 Ga0068852_100238794 3300005616 Bacteria 1735
65 Ga0068852_100243930 3300005616 Unclassified 1718
66 Ga0068864_100676266 3300005618 Bacteria 1007
67 Ga0068866_10003803 3300005718 Bacteria 6188
68 Ga0068860_100795652 3300005843 Bacteria 959
69 Ga0081540_1000651 3300005983 Bacteria 32775
70 Ga0070717_10166928 3300006028 Bacteria 1912
71 Ga0070712_100028945 3300006175 Bacteria 3711
72 Ga0070712_100049940 3300006175 Bacteria 2908
73 Ga0075367_10264825 3300006178 Bacteria 1079
74 Ga0068871_100181550 3300006358 Unclassified 1809
75 Ga0075428_100061014 3300006844 Bacteria 4129
76 Ga0075433_10050428 3300006852 Bacteria 3624
77 Ga0075433_10284393 3300006852 Unclassified 1465
78 Ga0075434_100041158 3300006871 Bacteria 4577
79 Ga0068865_100010857 3300006881 Bacteria 5682
80 Ga0075436_100045657 3300006914 Bacteria 3022
81 Ga0075435_100093119 3300007076 Bacteria 2489
82 Ga0075435_100327622 3300007076 Bacteria 1311
83 Ga0105240_10153467 3300009093 Bacteria 2741
84 Ga0105240_10531210 3300009093 Bacteria 1304
85 Ga0105240_10561912 3300009093 Bacteria 1261
86 Ga0105240_10781288 3300009093 Bacteria 1036
87 Ga0105245_10005679 3300009098 Bacteria 10965
88 Ga0105245_10213974 3300009098 Bacteria 1856
89 Ga0105245_10421651 3300009098 Bacteria 1338
90 Ga0105245_10610943 3300009098 Bacteria 1118
91 Ga0114129_10028748 3300009147 Bacteria 7877
92 Ga0105243_10034832 3300009148 Bacteria 3901
93 Ga0105243_10070282 3300009148 Bacteria 2826
94 Ga0105243_10136708 3300009148 Bacteria 2086
95 Ga0105241_10225141 3300009174 Unclassified 1579
96 Ga0105242_10061102 3300009176 Bacteria 3098
97 Ga0105242_10068016 3300009176 Bacteria 2946
98 Ga0105242_10956189 3300009176 Bacteria 861
99 Ga0105248_10387805 3300009177 Bacteria 1573
100 Ga0105237_10038621 3300009545 Bacteria 4821
101 Ga0105237_10055458 3300009545 Bacteria 3969
102 Ga0105237_10166820 3300009545 Unclassified 2201
103 Ga0105237_10327553 3300009545 Unclassified 1536
104 Ga0105237_11314128 3300009545 Bacteria 729
105 Ga0105238_10065706 3300009551 Unclassified 3629
106 Ga0105238_10452943 3300009551 Bacteria 1280
107 Ga0105249_10100224 3300009553 Bacteria 2723
108 Ga0105239_10384370 3300010375 Archaea 1587
109 Ga0105239_10637440 3300010375 Bacteria 1217
110 Ga0105239_11110396 3300010375 Bacteria 910
111 Ga0105239_11368870 3300010375 Bacteria 817
112 Ga0105246_10121072 3300011119 Bacteria 1939
113 Ga0157373_10110900 3300013100 Bacteria 1929
114 Ga0157371_10119335 3300013102 Unclassified 1875
115 Ga0157371_10199864 3300013102 Bacteria 1433
116 Ga0157370_10062753 3300013104 Bacteria 3523
117 Ga0157370_10088916 3300013104 Bacteria 2901
118 Ga0157370_10377355 3300013104 Bacteria 1306
119 Ga0157369_10006809 3300013105 Bacteria 13181
120 Ga0157369_10034098 3300013105 Bacteria 5589
121 Ga0157369_10298455 3300013105 Bacteria 1676
122 Ga0157369_10458948 3300013105 Bacteria 1319
123 Ga0157374_10119228 3300013296 Unclassified 2545
124 Ga0157374_10217636 3300013296 Unclassified 1874
125 Ga0157378_10024123 3300013297 Bacteria 5350
126 Ga0163162_10373974 3300013306 Bacteria 1558
127 Ga0163162_10734939 3300013306 Bacteria 1107
128 Ga0157372_10115575 3300013307 Bacteria 3076
129 Ga0157372_10215938 3300013307 Bacteria 2223
130 Ga0157372_10247865 3300013307 Bacteria 2067
131 Ga0157372_10402195 3300013307 Bacteria 1596
132 Ga0157372_10538561 3300013307 Bacteria 1361
133 Ga0157372_11231660 3300013307 Bacteria 864
134 Ga0157375_10456176 3300013308 Bacteria 1444
135 Ga0157375_10843450 3300013308 Bacteria 1063
136 Ga0157375_10942133 3300013308 Bacteria 1006
137 Ga0157380_10363777 3300014326 Bacteria 1358
138 Ga0157380_11804513 3300014326 Bacteria 671
139 Ga0157376_10349800 3300014969 Unclassified 1414
140 Ga0157376_10503630 3300014969 Bacteria 1191
141 Ga0163161_10084223 3300017792 Bacteria 2344
142 Ga0197907_10375245 3300020069 Bacteria 2643
143 Ga0206356_10250304 3300020070 Bacteria 4055
144 Ga0206356_11646994 3300020070 Bacteria 778
145 Ga0206355_1237988 3300020076 Bacteria 905
146 Ga0206350_10871682 3300020080 Bacteria 1409
147 Ga0206354_11088837 3300020081 Bacteria 1975
148 Ga0206353_11433310 3300020082 Bacteria 932
149 Ga0154015_1293392 3300020610 Bacteria 1099
150 Ga0224712_10012213 3300022467 Bacteria 2694
151 Ga0224712_10200946 3300022467 Bacteria 906
152 Ga0207653_10015729 3300025885 Bacteria 2375
153 Ga0207699_10083280 3300025906 Bacteria 1989
154 Ga0207645_10256504 3300025907 Bacteria 1158
155 Ga0207705_10017657 3300025909 Bacteria 5106
156 Ga0207654_10104178 3300025911 Bacteria 1753
157 Ga0207654_10163348 3300025911 Bacteria 1440
158 Ga0207707_10004423 3300025912 Bacteria 12388
159 Ga0207707_10039045 3300025912 Bacteria 4150
160 Ga0207707_10523851 3300025912 Bacteria 1009
161 Ga0207695_10261331 3300025913 Bacteria 1629
162 Ga0207671_10365990 3300025914 Bacteria 1145
163 Ga0207693_10004391 3300025915 Bacteria 11922
164 Ga0207693_10029633 3300025915 Bacteria 4321
165 Ga0207663_10030204 3300025916 Bacteria 3193
166 Ga0207660_10026481 3300025917 Bacteria 3950
167 Ga0207660_10104685 3300025917 Bacteria 2119
168 Ga0207657_10027552 3300025919 Bacteria 5203
169 Ga0207657_10162496 3300025919 Bacteria 1813
170 Ga0207657_10841795 3300025919 Unclassified 708
171 Ga0207649_10082810 3300025920 Bacteria 2081
172 Ga0207649_10131884 3300025920 Bacteria 1698
173 Ga0207652_10019853 3300025921 Bacteria 5532
174 Ga0207652_10340597 3300025921 Bacteria 1354
175 Ga0207646_10531597 3300025922 Bacteria 1058
176 Ga0207687_10037905 3300025927 Bacteria 3292
177 Ga0207687_10085950 3300025927 Unclassified 2283
178 Ga0207687_10274685 3300025927 Bacteria 1348
179 Ga0207687_10357134 3300025927 Bacteria 1192
180 Ga0207700_10211476 3300025928 Bacteria 1640
181 Ga0207690_10044801 3300025932 Bacteria 2918
182 Ga0207690_10128830 3300025932 Unclassified 1849
183 Ga0207706_10009324 3300025933 Bacteria 9012
184 Ga0207686_10047813 3300025934 Bacteria 2647
185 Ga0207669_10064289 3300025937 Bacteria 2270
186 Ga0207661_10005533 3300025944 Bacteria 8912
187 Ga0207661_10256403 3300025944 Bacteria 1556
188 Ga0207661_10260930 3300025944 Bacteria 1543
189 Ga0207661_10467468 3300025944 Bacteria 1150
190 Ga0207679_10100872 3300025945 Bacteria 2257
191 Ga0207667_10031710 3300025949 Bacteria 5703
192 Ga0207667_10112116 3300025949 Bacteria 2813
193 Ga0207667_10346129 3300025949 Bacteria 1516
194 Ga0207640_10035175 3300025981 Bacteria 3132
195 Ga0207640_10191946 3300025981 Bacteria 1540
196 Ga0207658_10621679 3300025986 Bacteria 972
197 Ga0207658_10665710 3300025986 Bacteria 939
198 Ga0207677_10035123 3300026023 Bacteria 3252
199 Ga0207677_10100477 3300026023 Bacteria 2127
200 Ga0207678_10312375 3300026067 Bacteria 1351
201 Ga0207708_10013577 3300026075 Bacteria 6089
202 Ga0207702_10019419 3300026078 Bacteria 5623
203 Ga0207702_10040099 3300026078 Bacteria 3925
204 Ga0207702_10187537 3300026078 Bacteria 1908
205 Ga0207648_10014493 3300026089 Bacteria 7281
206 Ga0207674_10023703 3300026116 Bacteria 6569
207 Ga0207675_100257205 3300026118 Bacteria 1691
208 Ga0207683_10011424 3300026121 Bacteria 7578
209 Ga0207698_10144980 3300026142 Bacteria 2052
210 Ga0207698_10373000 3300026142 Bacteria 1355
211 Ga0268265_10112394 3300028380 Bacteria 2227
212 Ga0268264_11394708 3300028381 Bacteria 711
213 Ga0265322_10002494 3300028654 Bacteria 5671
214 Ga0265338_10029907 3300028800 Bacteria 5386
215 Ga0265338_10041262 3300028800 Bacteria 4318
216 Ga0265338_10099976 3300028800 Bacteria 2367
217 Ga0265324_10031773 3300029957 Bacteria 1848
218 Ga0265332_10046984 3300031238 Bacteria 1859
219 Ga0265320_10125267 3300031240 Bacteria 1169
220 Ga0265325_10009148 3300031241 Bacteria 5801
221 Ga0265340_10054494 3300031247 Bacteria 1928
222 Ga0265340_10108666 3300031247 Bacteria 1283
223 Ga0265339_10015181 3300031249 Bacteria 4624
224 Ga0265331_10058242 3300031250 Bacteria 1830
225 Ga0265331_10156476 3300031250 Bacteria 1034
226 Ga0265327_10045994 3300031251 Bacteria 2314
227 Ga0265327_10113314 3300031251 Bacteria 1293
228 Ga0265316_10005608 3300031344 Bacteria 12159
229 Ga0265313_10019726 3300031595 Bacteria 3741
230 Ga0265314_10006982 3300031711 Bacteria 9878
231 Ga0373944_0037610 3300035089 Bacteria 1483
232 Ga0373945_0024752 3300035116 Bacteria 2082
233 Ga0373946_0025261 3300035171 Bacteria 2336
234 Ga0373924_0251241 3300035410 Bacteria 783
235 Ga0373935_0022692 3300035692 Bacteria 3852
236 Ga0373927_0234540 3300035695 Bacteria 1206
237 Ga0373947_0000772 3300035725 Bacteria 19208
238 Ga0373947_0385242 3300035725 Bacteria 944
239 Ga0373937_0125196 3300036401 Bacteria 2397
240 Ga0373925_0011112 3300037068 Bacteria 6532
241 Ga0395899_0013000 3300037312 Bacteria 6369
242 Ga0395899_0051513 3300037312 Bacteria 3055
243 Ga0395899_0058533 3300037312 Bacteria 2841
244 Ga0395899_0108394 3300037312 Bacteria 1999
245 Ga0395900_0007240 3300037418 Bacteria 11490
246 Ga0395900_0012865 3300037418 Bacteria 8548
247 Ga0395900_0082051 3300037418 Bacteria 3312
248 Ga0395900_0092617 3300037418 Bacteria 3105
249 Ga0395900_0499897 3300037418 Bacteria 1166
250 Ga0395898_0004043 3300037466 Bacteria 16131
251 Ga0395898_0027138 3300037466 Bacteria 5751
252 Ga0395898_0040202 3300037466 Bacteria 4626
253 Ga0395898_0044576 3300037466 Bacteria 4365
254 Ga0395898_0087007 3300037466 Bacteria 3011
255 Ga0395898_0103657 3300037466 Bacteria 2729
256 Ga0395898_0630549 3300037466 Bacteria 1014
257 Ga0395905_0017624 3300037471 Bacteria 6778
258 Ga0395905_0050044 3300037471 Bacteria 3916
259 Ga0395905_0111466 3300037471 Bacteria 2569
260 Ga0395905_0123803 3300037471 Bacteria 2431
261 Ga0395901_0000244 3300038443 Bacteria 67684
262 Ga0395901_0004812 3300038443 Bacteria 13622
263 Ga0395901_0013945 3300038443 Bacteria 8180
264 Ga0395901_0115278 3300038443 Bacteria 2822
265 Ga0395901_0216357 3300038443 Bacteria 2004
266 Ga0395901_0747540 3300038443 Bacteria 971
267 Ga0436365_0325492 3300039437 Bacteria 871
268 Ga0436363_0236262 3300039450 Bacteria 657
269 Ga0436363_0288681 3300039450 Bacteria 1160
270 Ga0436363_0381632 3300039450 Unclassified 798
271 Ga0436363_0605561 3300039450 Bacteria 623
272 Ga0466966_0006534 3300044684 Bacteria 7715
273 Ga0466961_0089702 3300044693 Bacteria 1941
274 Ga0466963_0001348 3300044694 Bacteria 13110
275 Ga0466963_0006525 3300044694 Bacteria 6911
276 Ga0466963_0093695 3300044694 Bacteria 2048
277 Ga0466963_0289115 3300044694 Bacteria 1152
278 Ga0466964_0027606 3300044706 Bacteria 2230
279 Ga0466964_0225965 3300044706 Bacteria 911
280 Ga0466971_0139043 3300044719 Bacteria 1130
281 Ga0466968_0000915 3300044735 Bacteria 10387
282 Ga0466970_0020873 3300044765 Bacteria 3408
283 Ga0466957_0063860 3300044842 Bacteria 2264
284 Ga0466957_0791284 3300044842 Bacteria 673
285 Ga0466960_0061374 3300044901 Bacteria 1845
286 Ga0466960_0094260 3300044901 Bacteria 1531
287 Ga0466959_0016161 3300045049 Bacteria 5448
288 Ga0466959_0074680 3300045049 Bacteria 2451
289 Ga0466958_0022336 3300045836 Bacteria 3705
290 Ga0466958_0025665 3300045836 Bacteria 3476
291 Ga0466958_0036869 3300045836 Bacteria 2928
292 Ga0466958_0043404 3300045836 Bacteria 2708
293 Ga0466967_0002026 3300045976 Bacteria 12356
294 Ga0466967_0002467 3300045976 Bacteria 11525
295 Ga0466967_0005057 3300045976 Bacteria 9044
296 Ga0466967_0018171 3300045976 Bacteria 5611
297 Ga0466967_0047501 3300045976 Bacteria 3742
298 Ga0466967_0049286 3300045976 Bacteria 3682
299 Ga0495603_0518799 3300046455 Bacteria 682
300 Ga0495629_0046181 3300046459 Bacteria 3055
301 Ga0495641_0052816 3300046461 Bacteria 1851
302 Ga0495641_0210508 3300046461 Bacteria 872
303 Ga0495651_0215246 3300046462 Bacteria 1334
304 Ga0495651_0328822 3300046462 Bacteria 1016
305 Ga0495653_0097452 3300046463 Bacteria 2137
306 Ga0495653_0183951 3300046463 Bacteria 1431
307 Ga0495582_0250170 3300046473 Bacteria 1016
308 Ga0495639_0328910 3300046475 Bacteria 765
309 Ga0495664_0069358 3300046477 Bacteria 2104
310 Ga0495664_0142393 3300046477 Bacteria 1454
311 Ga0495664_0481711 3300046477 Bacteria 742
312 Ga0495584_0507789 3300046491 Bacteria 614
313 Ga0495585_0221322 3300046492 Bacteria 955
314 Ga0495608_0067749 3300046511 Bacteria 2335
315 Ga0495630_0252234 3300046517 Bacteria 1348
316 Ga0495644_0121222 3300046523 Unclassified 995
317 Ga0495652_0069149 3300046529 Bacteria 2956
318 Ga0495645_0029135 3300046543 Bacteria 4013
319 Ga0495667_0291812 3300046559 Bacteria 1034
320 Ga0495656_0191094 3300046615 Archaea 1011
321 Ga0495634_0075937 3300046642 Bacteria 2206
322 Ga0495635_0220164 3300046663 Bacteria 1284
323 Ga0495635_0326877 3300046663 Bacteria 1026
324 Ga0495659_0071665 3300046664 Archaea 1299
325 Ga0495599_0000767 3300046678 Bacteria 18059
326 Ga0495599_0321750 3300046678 Bacteria 931
327 Ga0495623_0109684 3300046679 Bacteria 1674
328 Ga0495646_0243866 3300046680 Bacteria 965
329 Ga0495658_0003825 3300046683 Bacteria 7450
330 Ga0495658_0176810 3300046683 Bacteria 1323
331 Ga0495624_0278837 3300046690 Bacteria 1009
332 Ga0495600_0377790 3300046809 Bacteria 884
333 Ga0495604_0053386 3300047317 Bacteria 3124
334 Ga0495674_0150799 3300047319 Bacteria 1949
335 Ga0495674_0227801 3300047319 Bacteria 1539
336 Ga0495676_0309939 3300047321 Bacteria 1062
337 Ga0495676_0345137 3300047321 Bacteria 996
338 Ga0495676_0371745 3300047321 Bacteria 952
339 Ga0495680_0262872 3300047322 Bacteria 1220
340 Ga0495593_0154934 3300047673 Bacteria 1158
341 Ga0495602_0060988 3300048088 Bacteria 3283
342 Ga0495602_0103062 3300048088 Bacteria 2336
343 Ga0496100_0001131 3300048903 Bacteria 12961
344 Ga0496100_0005021 3300048903 Bacteria 7081
345 Ga0496101_0000788 3300048904 Bacteria 18714
346 Ga0496101_0025753 3300048904 Bacteria 4084
347 Ga0496101_0217971 3300048904 Bacteria 1480
348 Ga0496101_0374907 3300048904 Bacteria 1119
349 Ga0496101_0458817 3300048904 Unclassified 1005
350 Ga0496102_0002425 3300048905 Bacteria 15891
351 Ga0496102_0004302 3300048905 Bacteria 12037
352 Ga0496102_0050878 3300048905 Bacteria 3773
353 Ga0496102_1033334 3300048905 Bacteria 742
354 Ga0496103_0002939 3300048906 Bacteria 10557
355 Ga0496103_0164865 3300048906 Bacteria 1422
356 Ga0496103_0174657 3300048906 Bacteria 1380
357 Ga0496103_0192451 3300048906 Bacteria 1311
358 Ga0496103_0478249 3300048906 Bacteria 798
359 Ga0496104_0000551 3300048907 Bacteria 31933
360 Ga0496104_0065033 3300048907 Bacteria 3460
361 Ga0496104_0356476 3300048907 Bacteria 1375
362 Ga0496105_0019054 3300048908 Bacteria 5530
363 Ga0496105_0084485 3300048908 Bacteria 2622
364 Ga0496105_0417968 3300048908 Bacteria 1062
365 Ga0496106_0458191 3300048909 Bacteria 1024
366 Ga0496107_0007053 3300048910 Bacteria 7741
367 Ga0496107_0009060 3300048910 Bacteria 6899
368 Ga0496107_0027461 3300048910 Bacteria 4041
369 Ga0496107_0135350 3300048910 Unclassified 1820
370 Ga0496108_0006397 3300048911 Bacteria 9550
371 Ga0496109_0084475 3300048912 Bacteria 2929
372 Ga0496109_0433802 3300048912 Bacteria 1241
373 Ga0496110_0013810 3300048913 Bacteria 6693
374 Ga0496110_0047991 3300048913 Bacteria 3741
375 Ga0496111_0102831 3300048914 Bacteria 2100
376 Ga0496111_0107776 3300048914 Bacteria 2051
377 Ga0496111_0895452 3300048914 Bacteria 639
378 Ga0496112_0053941 3300048915 Bacteria 3949
379 Ga0496113_0043621 3300048916 Bacteria 3320
380 Ga0496114_0005161 3300048917 Bacteria 10189
381 Ga0496114_0008222 3300048917 Bacteria 8267
382 Ga0496114_0262349 3300048917 Bacteria 1521
383 Ga0496115_0000806 3300048918 Bacteria 22990
384 Ga0496115_0002490 3300048918 Bacteria 13233
385 Ga0496115_0026153 3300048918 Bacteria 4552
386 Ga0496115_0074251 3300048918 Bacteria 2761
387 Ga0496115_0136817 3300048918 Bacteria 2020
388 Ga0496115_0514604 3300048918 Bacteria 960
389 Ga0501031_0178255 3300049568 Bacteria 1388
390 Ga0501032_0058408 3300049569 Bacteria 2590
391 Ga0501034_1321568 3300049571 Bacteria 597
392 Ga0501036_0542169 3300049572 Bacteria 967
393 Ga0501036_0863292 3300049572 Bacteria 744
394 Ga0501037_0298073 3300049573 Bacteria 1120
395 Ga0501038_0093155 3300049574 Bacteria 2521
396 Ga0501038_1038917 3300049574 Bacteria 600
397 Ga0501039_0007776 3300049575 Bacteria 8177
398 Ga0501039_1241717 3300049575 Bacteria 576
399 Ga0501040_0037039 3300049576 Bacteria 3312
400 Ga0501041_0012663 3300049577 Bacteria 4997
401 Ga0501042_0447738 3300049578 Unclassified 936
402 Ga0501047_0054387 3300049581 Bacteria 3872
403 Ga0501048_0011329 3300049582 Bacteria 6651
404 Ga0501048_0035387 3300049582 Bacteria 3595
405 Ga0501067_0009609 3300049583 Bacteria 5355
406 Ga0501067_0329139 3300049583 Bacteria 851
407 Ga0501069_0000751 3300049585 Bacteria 15127
408 Ga0501070_0207648 3300049586 Bacteria 1608
409 Ga0501071_0002747 3300049587 Bacteria 10796
410 Ga0501071_0052709 3300049587 Bacteria 2934
411 Ga0501072_0006540 3300049588 Bacteria 8879
412 Ga0501072_0303409 3300049588 Bacteria 1269
413 Ga0501074_0079697 3300049590 Unclassified 2350
414 Ga0501074_0434228 3300049590 Bacteria 931
415 Ga0501075_0021517 3300049591 Bacteria 4703
416 Ga0501076_0004309 3300049592 Bacteria 10096
417 Ga0501076_0680147 3300049592 Bacteria 849
418 Ga0501079_0057021 3300049741 Bacteria 3014
419 Ga0501081_0077624 3300049743 Bacteria 2321
420 Ga0501035_0153347 3300049822 Bacteria 1998
421 Ga0501035_0302209 3300049822 Bacteria 1348
422 Ga0501035_0888246 3300049822 Bacteria 706
423 Ga0501045_0048746 3300049824 Bacteria 3087
424 Ga0501045_0185239 3300049824 Bacteria 1551
425 nmdc:mga05p37_284342_c1 3300050507 Bacteria 1971
426 nmdc:mga06r32_208684_c1 3300050510 Bacteria 1941
427 nmdc:mga0n895_1629215_c1 3300050512 Bacteria 609
428 nmdc:mga0n895_25269_c1 3300050512 Bacteria 5610
429 nmdc:mga0n895_302416_c1 3300050512 Bacteria 1622
430 nmdc:mga0rr50_37012_c1 3300050513 Bacteria 3519
431 nmdc:mga0rr50_463031_c1 3300050513 Bacteria 1076
432 nmdc:mga08x19_5408_c1 3300050514 Bacteria 7553
433 nmdc:mga0a205_20783_c1 3300050515 Bacteria 6201
434 nmdc:mga0a205_25895_c1 3300050515 Bacteria 5588
435 nmdc:mga0a205_297778_c1 3300050515 Bacteria 1487
436 Ga0495601_0010782 3300053077 Bacteria 5453
437 Ga0495595_0024620 3300053084 Bacteria 2659
438 Ga0587084_034201 3300059477 Bacteria 834
439 Ga0587077_064250 3300059493 Bacteria 804
440 Ga0587082_025545 3300059504 Bacteria 994
441 Ga0587083_0048266 3300059505 Bacteria 919
442 Ga0587086_018737 3300059507 Bacteria 925
443 Ga0587088_033866 3300059508 Bacteria 928
444 Ga0587076_078052 3300059645 Bacteria 701
445 Ga0587107_013598 3300059652 Bacteria 1034
446 Ga0587111_0084492 3300060346 Bacteria 764
447 Ga0501082_0053332 3300060353 Bacteria 3486
448 Ga0501082_0477564 3300060353 Bacteria 1089
449 Ga0466962_0011514 3300061719 Bacteria 4259
450 Ga0530510_0007266 3300061734 Bacteria 7706
451 Ga0530510_0081327 3300061734 Bacteria 2358
452 Ga0530510_0519908 3300061734 Bacteria 903
453 Ga0070658_10029003
454 Ga0058861_11967305
455 Ga0070658_10256709
456 Ga0070658_10319928
457 Ga0070658_10342699
458 Ga0070676_10250504
459 Ga0070683_100008018
460 Ga0070683_100197863
461 Ga0070680_100152106
462 Ga0070682_100053754
463 Ga0070682_100057387
464 Ga0068868_100009008
465 Ga0070660_100051968
466 Ga0070660_100057688
467 Ga0070660_100238199
468 Ga0070660_100690448
469 Ga0070691_10005002
470 Ga0070661_100110796
471 Ga0070661_100148409
472 Ga0070661_100348789
473 Ga0070669_100696181
474 Ga0070674_100087666
475 Ga0070659_100007213
476 Ga0070659_100353890
477 Ga0070703_10024958
478 Ga0070705_100154233
479 Ga0070700_100002630
480 Ga0070694_100019045
481 Ga0070708_100136631
482 Ga0070663_100057079
483 Ga0070663_100571297
484 Ga0070678_100041486
485 Ga0070678_100044402
486 Ga0070662_100068369
487 Ga0070681_10007555
488 Ga0070681_10011313
489 Ga0070681_10036121
490 Ga0070679_100016331
491 Ga0070679_100083514
492 Ga0070679_100109669
493 Ga0070684_100053408
494 Ga0068853_100034131
495 Ga0068853_100285383
496 Ga0070696_100015479
497 Ga0070696_100147303
498 Ga0070693_100003891
499 Ga0070693_100177823
500 Ga0070665_100012036
501 Ga0070665_100613531
502 Ga0070704_100418883
503 Ga0070704_100492168
504 Ga0068855_100014674
505 Ga0068855_100025529
506 Ga0068855_100328904
507 Ga0070664_100172539
508 Ga0068857_100550819
509 Ga0068854_100027887
510 Ga0068854_100076105
511 Ga0068856_100045175
512 Ga0068856_100085156
513 Ga0070702_100021611
514 Ga0070702_100438214
515 Ga0068852_100032190
516 Ga0068852_100238794
517 Ga0068852_100243930
518 Ga0068864_100676266
519 Ga0068866_10003803
520 Ga0068860_100795652
521 Ga0081540_1000651
522 Ga0070717_10166928
523 Ga0070712_100028945
524 Ga0070712_100049940
525 Ga0075367_10264825
526 Ga0068871_100181550
527 Ga0075428_100061014
528 Ga0075433_10050428
529 Ga0075433_10284393
530 Ga0075434_100041158
531 Ga0068865_100010857
532 Ga0075436_100045657
533 Ga0075435_100093119
534 Ga0075435_100327622
535 Ga0105240_10153467
536 Ga0105240_10531210
537 Ga0105240_10561912
538 Ga0105240_10781288
539 Ga0105245_10005679
540 Ga0105245_10213974
541 Ga0105245_10421651
542 Ga0105245_10610943
543 Ga0114129_10028748
544 Ga0105243_10034832
545 Ga0105243_10070282
546 Ga0105243_10136708
547 Ga0105241_10225141
548 Ga0105242_10061102
549 Ga0105242_10068016
550 Ga0105242_10956189
551 Ga0105248_10387805
552 Ga0105237_10038621
553 Ga0105237_10055458
554 Ga0105237_10166820
555 Ga0105237_10327553
556 Ga0105237_11314128
557 Ga0105238_10065706
558 Ga0105238_10452943
559 Ga0105249_10100224
560 Ga0105239_10384370
561 Ga0105239_10637440
562 Ga0105239_11110396
563 Ga0105239_11368870
564 Ga0105246_10121072
565 Ga0157373_10110900
566 Ga0157371_10119335
567 Ga0157371_10199864
568 Ga0157370_10062753
569 Ga0157370_10088916
570 Ga0157370_10377355
571 Ga0157369_10006809
572 Ga0157369_10034098
573 Ga0157369_10298455
574 Ga0157369_10458948
575 Ga0157374_10119228
576 Ga0157374_10217636
577 Ga0157378_10024123
578 Ga0163162_10373974
579 Ga0163162_10734939
580 Ga0157372_10115575
581 Ga0157372_10215938
582 Ga0157372_10247865
583 Ga0157372_10402195
584 Ga0157372_10538561
585 Ga0157372_11231660
586 Ga0157375_10456176
587 Ga0157375_10843450
588 Ga0157375_10942133
589 Ga0157380_10363777
590 Ga0157380_11804513
591 Ga0157376_10349800
592 Ga0157376_10503630
593 Ga0163161_10084223
594 Ga0197907_10375245
595 Ga0206356_10250304
596 Ga0206356_11646994
597 Ga0206355_1237988
598 Ga0206350_10871682
599 Ga0206354_11088837
600 Ga0206353_11433310
601 Ga0154015_1293392
602 Ga0224712_10012213
603 Ga0224712_10200946
604 Ga0207653_10015729
605 Ga0207699_10083280
606 Ga0207645_10256504
607 Ga0207705_10017657
608 Ga0207654_10104178
609 Ga0207654_10163348
610 Ga0207707_10004423
611 Ga0207707_10039045
612 Ga0207707_10523851
613 Ga0207695_10261331
614 Ga0207671_10365990
615 Ga0207693_10004391
616 Ga0207693_10029633
617 Ga0207663_10030204
618 Ga0207660_10026481
619 Ga0207660_10104685
620 Ga0207657_10027552
621 Ga0207657_10162496
622 Ga0207657_10841795
623 Ga0207649_10082810
624 Ga0207649_10131884
625 Ga0207652_10019853
626 Ga0207652_10340597
627 Ga0207646_10531597
628 Ga0207687_10037905
629 Ga0207687_10085950
630 Ga0207687_10274685
631 Ga0207687_10357134
632 Ga0207700_10211476
633 Ga0207690_10044801
634 Ga0207690_10128830
635 Ga0207706_10009324
636 Ga0207686_10047813
637 Ga0207669_10064289
638 Ga0207661_10005533
639 Ga0207661_10256403
640 Ga0207661_10260930
641 Ga0207661_10467468
642 Ga0207679_10100872
643 Ga0207667_10031710
644 Ga0207667_10112116
645 Ga0207667_10346129
646 Ga0207640_10035175
647 Ga0207640_10191946
648 Ga0207658_10621679
649 Ga0207658_10665710
650 Ga0207677_10035123
651 Ga0207677_10100477
652 Ga0207678_10312375
653 Ga0207708_10013577
654 Ga0207702_10019419
655 Ga0207702_10040099
656 Ga0207702_10187537
657 Ga0207648_10014493
658 Ga0207674_10023703
659 Ga0207675_100257205
660 Ga0207683_10011424
661 Ga0207698_10144980
662 Ga0207698_10373000
663 Ga0268265_10112394
664 Ga0268264_11394708
665 Ga0265322_10002494
666 Ga0265338_10029907
667 Ga0265338_10041262
668 Ga0265338_10099976
669 Ga0265324_10031773
670 Ga0265332_10046984
671 Ga0265320_10125267
672 Ga0265325_10009148
673 Ga0265340_10054494
674 Ga0265340_10108666
675 Ga0265339_10015181
676 Ga0265331_10058242
677 Ga0265331_10156476
678 Ga0265327_10045994
679 Ga0265327_10113314
680 Ga0265316_10005608
681 Ga0265313_10019726
682 Ga0265314_10006982
683 Ga0373944_0037610
684 Ga0373945_0024752
685 Ga0373946_0025261
686 Ga0373924_0251241
687 Ga0373935_0022692
688 Ga0373927_0234540
689 Ga0373947_0000772
690 Ga0373947_0385242
691 Ga0373937_0125196
692 Ga0373925_0011112
693 Ga0395899_0013000
694 Ga0395899_0051513
695 Ga0395899_0058533
696 Ga0395899_0108394
697 Ga0395900_0007240
698 Ga0395900_0012865
699 Ga0395900_0082051
700 Ga0395900_0092617
701 Ga0395900_0499897
702 Ga0395898_0004043
703 Ga0395898_0027138
704 Ga0395898_0040202
705 Ga0395898_0044576
706 Ga0395898_0087007
707 Ga0395898_0103657
708 Ga0395898_0630549
709 Ga0395905_0017624
710 Ga0395905_0050044
711 Ga0395905_0111466
712 Ga0395905_0123803
713 Ga0395901_0000244
714 Ga0395901_0004812
715 Ga0395901_0013945
716 Ga0395901_0115278
717 Ga0395901_0216357
718 Ga0395901_0747540
719 Ga0436365_0325492
720 Ga0436363_0236262
721 Ga0436363_0288681
722 Ga0436363_0381632
723 Ga0436363_0605561
724 Ga0466966_0006534
725 Ga0466961_0089702
726 Ga0466963_0001348
727 Ga0466963_0006525
728 Ga0466963_0093695
729 Ga0466963_0289115
730 Ga0466964_0027606
731 Ga0466964_0225965
732 Ga0466971_0139043
733 Ga0466968_0000915
734 Ga0466970_0020873
735 Ga0466957_0063860
736 Ga0466957_0791284
737 Ga0466960_0061374
738 Ga0466960_0094260
739 Ga0466959_0016161
740 Ga0466959_0074680
741 Ga0466958_0022336
742 Ga0466958_0025665
743 Ga0466958_0036869
744 Ga0466958_0043404
745 Ga0466967_0002026
746 Ga0466967_0002467
747 Ga0466967_0005057
748 Ga0466967_0018171
749 Ga0466967_0047501
750 Ga0466967_0049286
751 Ga0495603_0518799
752 Ga0495629_0046181
753 Ga0495641_0052816
754 Ga0495641_0210508
755 Ga0495651_0215246
756 Ga0495651_0328822
757 Ga0495653_0097452
758 Ga0495653_0183951
759 Ga0495582_0250170
760 Ga0495639_0328910
761 Ga0495664_0069358
762 Ga0495664_0142393
763 Ga0495664_0481711
764 Ga0495584_0507789
765 Ga0495585_0221322
766 Ga0495608_0067749
767 Ga0495630_0252234
768 Ga0495644_0121222
769 Ga0495652_0069149
770 Ga0495645_0029135
771 Ga0495667_0291812
772 Ga0495656_0191094
773 Ga0495634_0075937
774 Ga0495635_0220164
775 Ga0495635_0326877
776 Ga0495659_0071665
777 Ga0495599_0000767
778 Ga0495599_0321750
779 Ga0495623_0109684
780 Ga0495646_0243866
781 Ga0495658_0003825
782 Ga0495658_0176810
783 Ga0495624_0278837
784 Ga0495600_0377790
785 Ga0495604_0053386
786 Ga0495674_0150799
787 Ga0495674_0227801
788 Ga0495676_0309939
789 Ga0495676_0345137
790 Ga0495676_0371745
791 Ga0495680_0262872
792 Ga0495593_0154934
793 Ga0495602_0060988
794 Ga0495602_0103062
795 Ga0496100_0001131
796 Ga0496100_0005021
797 Ga0496101_0000788
798 Ga0496101_0025753
799 Ga0496101_0217971
800 Ga0496101_0374907
801 Ga0496101_0458817
802 Ga0496102_0002425
803 Ga0496102_0004302
804 Ga0496102_0050878
805 Ga0496102_1033334
806 Ga0496103_0002939
807 Ga0496103_0164865
808 Ga0496103_0174657
809 Ga0496103_0192451
810 Ga0496103_0478249
811 Ga0496104_0000551
812 Ga0496104_0065033
813 Ga0496104_0356476
814 Ga0496105_0019054
815 Ga0496105_0084485
816 Ga0496105_0417968
817 Ga0496106_0458191
818 Ga0496107_0007053
819 Ga0496107_0009060
820 Ga0496107_0027461
821 Ga0496107_0135350
822 Ga0496108_0006397
823 Ga0496109_0084475
824 Ga0496109_0433802
825 Ga0496110_0013810
826 Ga0496110_0047991
827 Ga0496111_0102831
828 Ga0496111_0107776
829 Ga0496111_0895452
830 Ga0496112_0053941
831 Ga0496113_0043621
832 Ga0496114_0005161
833 Ga0496114_0008222
834 Ga0496114_0262349
835 Ga0496115_0000806
836 Ga0496115_0002490
837 Ga0496115_0026153
838 Ga0496115_0074251
839 Ga0496115_0136817
840 Ga0496115_0514604
841 Ga0501031_0178255
842 Ga0501032_0058408
843 Ga0501034_1321568
844 Ga0501036_0542169
845 Ga0501036_0863292
846 Ga0501037_0298073
847 Ga0501038_0093155
848 Ga0501038_1038917
849 Ga0501039_0007776
850 Ga0501039_1241717
851 Ga0501040_0037039
852 Ga0501041_0012663
853 Ga0501042_0447738
854 Ga0501047_0054387
855 Ga0501048_0011329
856 Ga0501048_0035387
857 Ga0501067_0009609
858 Ga0501067_0329139
859 Ga0501069_0000751
860 Ga0501070_0207648
861 Ga0501071_0002747
862 Ga0501071_0052709
863 Ga0501072_0006540
864 Ga0501072_0303409
865 Ga0501074_0079697
866 Ga0501074_0434228
867 Ga0501075_0021517
868 Ga0501076_0004309
869 Ga0501076_0680147
870 Ga0501079_0057021
871 Ga0501081_0077624
872 Ga0501035_0153347
873 Ga0501035_0302209
874 Ga0501035_0888246
875 Ga0501045_0048746
876 Ga0501045_0185239
877 nmdc:mga05p37_284342_c1
878 nmdc:mga06r32_208684_c1
879 nmdc:mga0n895_1629215_c1
880 nmdc:mga0n895_25269_c1
881 nmdc:mga0n895_302416_c1
882 nmdc:mga0rr50_37012_c1
883 nmdc:mga0rr50_463031_c1
884 nmdc:mga08x19_5408_c1
885 nmdc:mga0a205_20783_c1
886 nmdc:mga0a205_25895_c1
887 nmdc:mga0a205_297778_c1
888 Ga0495601_0010782
889 Ga0495595_0024620
890 Ga0587084_034201
891 Ga0587077_064250
892 Ga0587082_025545
893 Ga0587083_0048266
894 Ga0587086_018737
895 Ga0587088_033866
896 Ga0587076_078052
897 Ga0587107_013598
898 Ga0587111_0084492
899 Ga0501082_0053332
900 Ga0501082_0477564
901 Ga0466962_0011514
902 Ga0530510_0007266
903 Ga0530510_0081327
904 Ga0530510_0519908

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00510

COX3

Cytochrome c oxidase subunit III

17

194

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yev-assembly2.cif.gz_A structure of caa3-type cytochrome oxidase 0.8984 23 200
8dh6-assembly1.cif.gz_c cryo-em structure of saccharomyces cerevisiae cytochrome c oxidase (complex iv) extracted in lipid nanodiscs 0.8883 25 199
7jrp-assembly1.cif.gz_c plant mitochondrial complex sc iii2+iv from vigna radiata 0.8881 24 198
7au3-assembly1.cif.gz_C cytochrome c oxidase structure in f-state 0.8817 23 198
5z62-assembly1.cif.gz_C structure of human cytochrome c oxidase 0.8816 24 199
ID Description Score Start End Superfamily
af_O21049_302_434_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.9068 93 198 1.20.120.80
af_P24891_68_255_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.901 24 198 1.20.120.80
af_A0A0R0H600_74_264_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.9008 23 198 1.20.120.80
af_P14575_77_269_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8993 24 198 1.20.120.80
2yevD03 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8924 20 200 1.20.120.80
ID Description Score Start End GO Terms
AF-Q2QB03-F1-model_v4 Cytochrome c oxidase subunit 3 0.9764 70 198 GO:0004129
GO:0005739
GO:0006123
GO:0016020
AF-A0A3G3C7E7-F1-model_v4 Cytochrome c oxidase subunit 3 0.9751 70 198 GO:0004129
GO:0005739
GO:0006123
GO:0016020
AF-A0A6H1PG00-F1-model_v4 Cytochrome c oxidase subunit 3 0.9749 70 198 GO:0004129
GO:0005739
GO:0006123
GO:0016020
AF-G3CJQ1-F1-model_v4 Cytochrome c oxidase subunit 3 0.9738 80 198 GO:0004129
GO:0005739
GO:0006123
GO:0016020
AF-A0A087FW95-F1-model_v4 Cytochrome c oxidase subunit 3 0.9732 77 198 GO:0004129
GO:0005739
GO:0006123
GO:0016020

Map