F446705

General Info

Members Datasets Scaffolds Average Seq Length
451 233 437 157

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10017665|JGI24740J21852_100176653
Length 173
Sequence MRQNKNSDVVYSPSGVGDFTHLDEQGKATMVNVSEKKITQRSATARSIVQLPQAVLDKLIDGDIQTKKGSVFQTAIIAGIMAAKKTGDLIPLCHPLGLENCKVDIHLNDQQELVIDCTTNITAKTGVEMEALVGASIAALTIYDMCKALSHDIVIKETKLMEKTGGKNDFKRA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
3 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
4 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
5 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
6 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
7 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
8 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
9 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
10 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
11 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
12 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
13 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
14 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
15 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
18 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
102 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
103 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
106 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
107 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
108 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
160 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
165 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
174 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
175 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
176 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
177 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
188 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
189 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
190 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
194 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
195 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
196 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
197 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
198 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
201 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
202 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
203 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
204 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
205 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
206 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
207 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
208 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
211 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
212 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
213 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
229 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
230 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
231 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
232 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
233 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.67
Metatranscriptomes 0.22
Isolates 3.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.31
Nodule 0
Rhizoplane 1.11
Rhizosphere 83.37
Stem 0
Stem Tuber 0
Unclassified 6.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2249581 2162886007 Bacteria 2739
2 JGI24740J21852_10016410 3300001979 Bacteria 2678
3 JGI24740J21852_10017665 3300001979 Bacteria 2545
4 JGI24740J21852_10141127 3300001979 Bacteria 600
5 JGI25162J39368_1002129 3300002737 Bacteria 8382
6 JGI25406J46586_10013358 3300003203 Bacteria 3530
7 JGI25406J46586_10021135 3300003203 Bacteria 2618
8 JGI25165J46597_1001445 3300003214 Bacteria 12601
9 JGI25153J46596_10058865 3300003215 Unclassified 1055
10 JGI25153J46596_10066463 3300003215 Bacteria 954
11 rootH2_10001101 3300003320 Bacteria 45863
12 rootH2_10021057 3300003320 Bacteria 19112
13 rootH2_10154995 3300003320 Bacteria 1871
14 rootH2_10215700 3300003320 Bacteria 2621
15 rootH1_10009528 3300003323 Bacteria 31356
16 rootH1_10039649 3300003323 Bacteria 1328
17 rootH1_10094446 3300003323 Bacteria 2165
18 rootH1_10158475 3300003323 Bacteria 2210
19 rootH1_10232185 3300003323 Bacteria 3721
20 JGI25160J50197_1007750 3300003354 Bacteria 4166
21 JGI25160J50197_1010557 3300003354 Unclassified 3329
22 Ga0055526_1015271 3300003771 Bacteria 3092
23 Ga0055526_1017392 3300003771 Bacteria 2748
24 Ga0055528_1000600 3300003790 Bacteria 27092
25 Ga0055530_10011881 3300003791 Bacteria 3084
26 Ga0055543_1032763 3300004625 Bacteria 901
27 Ga0058863_11903483 3300004799 Bacteria 5348
28 Ga0065165_1000100 3300005262 Bacteria 141963
29 Ga0065714_10006471 3300005288 Bacteria 5544
30 Ga0065704_10001934 3300005289 Bacteria 8070
31 Ga0065715_10584689 3300005293 Unclassified 649
32 Ga0070658_10000011 3300005327 Bacteria 294396
33 Ga0070658_10059182 3300005327 Bacteria 3120
34 Ga0070658_10187503 3300005327 Bacteria 1742
35 Ga0070658_10753882 3300005327 Unclassified 845
36 Ga0070676_10000471 3300005328 Bacteria 19324
37 Ga0070676_10110857 3300005328 Bacteria 1708
38 Ga0070676_11150863 3300005328 Bacteria 588
39 Ga0070683_100104508 3300005329 Bacteria 2669
40 Ga0070690_100230531 3300005330 Bacteria 1302
41 Ga0070670_100259120 3300005331 Bacteria 1516
42 Ga0070677_10478376 3300005333 Bacteria 671
43 Ga0068869_100150757 3300005334 Bacteria 1803
44 Ga0068869_100488382 3300005334 Unclassified 1026
45 Ga0068869_100592781 3300005334 Bacteria 935
46 Ga0070666_10193073 3300005335 Bacteria 1431
47 Ga0070680_100317620 3300005336 Bacteria 1322
48 Ga0070680_100327163 3300005336 Bacteria 1301
49 Ga0070680_100725343 3300005336 Unclassified 855
50 Ga0070660_100014306 3300005339 Bacteria 5714
51 Ga0070660_100055845 3300005339 Bacteria 3053
52 Ga0070660_100284733 3300005339 Bacteria 1353
53 Ga0070661_100276884 3300005344 Bacteria 1301
54 Ga0070669_100267287 3300005353 Unclassified 1366
55 Ga0070675_100176988 3300005354 Bacteria 1842
56 Ga0070671_100029755 3300005355 Bacteria 4505
57 Ga0070671_100575466 3300005355 Bacteria 972
58 Ga0070674_100157872 3300005356 Bacteria 1718
59 Ga0070674_100369679 3300005356 Bacteria 1163
60 Ga0070673_100006304 3300005364 Bacteria 7702
61 Ga0070673_100236646 3300005364 Unclassified 1586
62 Ga0070659_100004095 3300005366 Bacteria 10394
63 Ga0070659_100178954 3300005366 Unclassified 1739
64 Ga0070659_100512986 3300005366 Bacteria 1023
65 Ga0070678_100002096 3300005456 Bacteria 10811
66 Ga0070662_100002245 3300005457 Bacteria 11849
67 Ga0070662_100136109 3300005457 Bacteria 1899
68 Ga0070662_100412540 3300005457 Bacteria 1116
69 Ga0070662_100698408 3300005457 Bacteria 858
70 Ga0070681_10093028 3300005458 Bacteria 2964
71 Ga0068867_100003012 3300005459 Bacteria 11876
72 Ga0068867_100380966 3300005459 Bacteria 1185
73 Ga0068867_101079096 3300005459 Bacteria 732
74 Ga0070679_100032826 3300005530 Bacteria 5138
75 Ga0070679_100141055 3300005530 Bacteria 2389
76 Ga0070679_100526702 3300005530 Bacteria 1126
77 Ga0070684_100121665 3300005535 Unclassified 2348
78 Ga0070684_101013127 3300005535 Bacteria 779
79 Ga0068853_100004807 3300005539 Bacteria 10506
80 Ga0068853_100049786 3300005539 Bacteria 3602
81 Ga0068853_100275649 3300005539 Unclassified 1550
82 Ga0068853_100846797 3300005539 Bacteria 877
83 Ga0070695_101537486 3300005545 Unclassified 554
84 Ga0070665_100000003 3300005548 Bacteria 811857
85 Ga0070665_100006942 3300005548 Bacteria 11513
86 Ga0068855_100010991 3300005563 Bacteria 10924
87 Ga0068855_100017518 3300005563 Bacteria 8614
88 Ga0068855_100208154 3300005563 Unclassified 2199
89 Ga0068855_100233312 3300005563 Bacteria 2059
90 Ga0068855_101386092 3300005563 Bacteria 725
91 Ga0068855_101757860 3300005563 Unclassified 631
92 Ga0068855_101828029 3300005563 Bacteria 617
93 Ga0068857_100037446 3300005577 Bacteria 4297
94 Ga0068857_100107398 3300005577 Bacteria 2507
95 Ga0068857_100174186 3300005577 Bacteria 1957
96 Ga0068857_100287742 3300005577 Bacteria 1513
97 Ga0068854_101340089 3300005578 Bacteria 645
98 Ga0068856_100005531 3300005614 Bacteria 12443
99 Ga0068856_100020553 3300005614 Bacteria 6413
100 Ga0068856_100201118 3300005614 Bacteria 2007
101 Ga0068856_100565266 3300005614 Bacteria 1158
102 Ga0068852_100006806 3300005616 Bacteria 8299
103 Ga0068852_100226196 3300005616 Bacteria 1781
104 Ga0068852_100239301 3300005616 Unclassified 1734
105 Ga0068852_100839445 3300005616 Bacteria 934
106 Ga0068852_102659718 3300005616 Unclassified 520
107 Ga0068859_100039885 3300005617 Bacteria 4712
108 Ga0068859_101131958 3300005617 Bacteria 861
109 Ga0068864_100434578 3300005618 Bacteria 1253
110 Ga0068851_10107854 3300005834 Bacteria 1484
111 Ga0068851_10434717 3300005834 Bacteria 777
112 Ga0068870_10535096 3300005840 Bacteria 786
113 Ga0068858_100158547 3300005842 Bacteria 2130
114 Ga0068860_100003179 3300005843 Bacteria 16941
115 Ga0068860_100039308 3300005843 Bacteria 4525
116 Ga0068860_100749525 3300005843 Bacteria 988
117 Ga0068862_100137052 3300005844 Unclassified 2170
118 Ga0081539_10001000 3300005985 Bacteria 52492
119 Ga0081539_10027743 3300005985 Bacteria 3578
120 Ga0081539_10111806 3300005985 Bacteria 1373
121 Ga0075366_10193559 3300006195 Bacteria 1236
122 Ga0097621_100000020 3300006237 Bacteria 86226
123 Ga0097621_100597036 3300006237 Bacteria 1009
124 Ga0068871_100000130 3300006358 Bacteria 47875
125 Ga0075428_100011356 3300006844 Bacteria 9908
126 Ga0068865_100000050 3300006881 Bacteria 65632
127 Ga0097620_100039887 3300006931 Bacteria 4712
128 Ga0097620_101131964 3300006931 Bacteria 861
129 Ga0105240_10010235 3300009093 Bacteria 13201
130 Ga0105240_10017595 3300009093 Bacteria 9629
131 Ga0105240_10018707 3300009093 Bacteria 9281
132 Ga0105240_10131450 3300009093 Unclassified 3002
133 Ga0105240_11510709 3300009093 Bacteria 704
134 Ga0111539_10073077 3300009094 Unclassified 4043
135 Ga0105245_10029178 3300009098 Bacteria 4872
136 Ga0105245_10642604 3300009098 Bacteria 1091
137 Ga0105247_10452901 3300009101 Bacteria 925
138 Ga0105247_10520370 3300009101 Bacteria 870
139 Ga0105243_10079878 3300009148 Bacteria 2666
140 Ga0105241_10000281 3300009174 Bacteria 37919
141 Ga0105241_10009625 3300009174 Bacteria 7101
142 Ga0105241_10009913 3300009174 Bacteria 7001
143 Ga0105241_10063493 3300009174 Unclassified 2850
144 Ga0105241_10398170 3300009174 Bacteria 1207
145 Ga0105241_10476776 3300009174 Bacteria 1108
146 Ga0105241_11167234 3300009174 Unclassified 728
147 Ga0105242_10017684 3300009176 Bacteria 5561
148 Ga0105237_10003737 3300009545 Bacteria 17929
149 Ga0105237_10005432 3300009545 Bacteria 14392
150 Ga0105237_10018441 3300009545 Bacteria 7222
151 Ga0105237_10158158 3300009545 Unclassified 2263
152 Ga0105237_10323523 3300009545 Bacteria 1546
153 Ga0105237_10339220 3300009545 Bacteria 1507
154 Ga0105237_10628309 3300009545 Bacteria 1081
155 Ga0105238_10018941 3300009551 Bacteria 7009
156 Ga0105239_10000002 3300010375 Bacteria 610298
157 Ga0105239_10008543 3300010375 Bacteria 11630
158 Ga0105239_10071795 3300010375 Bacteria 3803
159 Ga0105239_10073017 3300010375 Unclassified 3773
160 Ga0105239_10077424 3300010375 Bacteria 3659
161 Ga0105239_10081977 3300010375 Bacteria 3551
162 Ga0105239_10188381 3300010375 Bacteria 2309
163 Ga0105239_10190093 3300010375 Unclassified 2298
164 Ga0105246_10012536 3300011119 Bacteria 5294
165 Ga0105246_10220149 3300011119 Bacteria 1487
166 Ga0105246_10775115 3300011119 Bacteria 848
167 Ga0157373_10011051 3300013100 Bacteria 6649
168 Ga0157373_10142759 3300013100 Bacteria 1684
169 Ga0157373_10239916 3300013100 Bacteria 1281
170 Ga0157371_10000269 3300013102 Bacteria 70787
171 Ga0157371_10070860 3300013102 Bacteria 2468
172 Ga0157371_10162071 3300013102 Bacteria 1597
173 Ga0157371_10373621 3300013102 Bacteria 1040
174 Ga0157371_10933133 3300013102 Bacteria 659
175 Ga0157370_10132970 3300013104 Bacteria 2320
176 Ga0157370_10464400 3300013104 Bacteria 1163
177 Ga0157370_10967153 3300013104 Bacteria 771
178 Ga0157369_10099032 3300013105 Bacteria 3108
179 Ga0157369_10157365 3300013105 Unclassified 2399
180 Ga0157369_10248245 3300013105 Bacteria 1858
181 Ga0157369_10296173 3300013105 Bacteria 1683
182 Ga0157374_10003065 3300013296 Bacteria 14011
183 Ga0157374_10003613 3300013296 Bacteria 13024
184 Ga0157374_10032460 3300013296 Bacteria 4754
185 Ga0157374_10558816 3300013296 Bacteria 1152
186 Ga0157378_10011737 3300013297 Bacteria 7670
187 Ga0157378_10025837 3300013297 Bacteria 5174
188 Ga0157378_10158271 3300013297 Bacteria 2116
189 Ga0157378_11004333 3300013297 Bacteria 869
190 Ga0163162_10000031 3300013306 Bacteria 157666
191 Ga0163162_10000705 3300013306 Bacteria 30921
192 Ga0163162_10005497 3300013306 Bacteria 12245
193 Ga0163162_10877308 3300013306 Bacteria 1011
194 Ga0163162_10917261 3300013306 Bacteria 988
195 Ga0163162_11284622 3300013306 Unclassified 831
196 Ga0163162_11451799 3300013306 Bacteria 781
197 Ga0157372_10001534 3300013307 Bacteria 25119
198 Ga0157372_10261500 3300013307 Unclassified 2010
199 Ga0157372_10288551 3300013307 Unclassified 1908
200 Ga0157372_10291468 3300013307 Bacteria 1898
201 Ga0157372_10516304 3300013307 Bacteria 1393
202 Ga0157372_10731150 3300013307 Unclassified 1151
203 Ga0157375_10070001 3300013308 Bacteria 3516
204 Ga0157375_10319225 3300013308 Bacteria 1718
205 Ga0157375_11265308 3300013308 Bacteria 867
206 Ga0163163_10623135 3300014325 Unclassified 1142
207 Ga0163163_10903493 3300014325 Bacteria 946
208 Ga0157377_10437454 3300014745 Bacteria 900
209 Ga0213872_10008555 3300021361 Bacteria 4949
210 Ga0213874_10169891 3300021377 Bacteria 771
211 Ga0209436_101223 3300025208 Bacteria 9305
212 Ga0209563_104761 3300025230 Bacteria 2545
213 Ga0207427_100766 3300025231 Bacteria 14625
214 Ga0209437_100052 3300025233 Bacteria 380548
215 Ga0209026_1013628 3300025250 Bacteria 1379
216 Ga0209233_1000067 3300025261 Bacteria 380554
217 Ga0209233_1001304 3300025261 Bacteria 9948
218 Ga0209455_1004456 3300025272 Bacteria 4576
219 Ga0209673_1000049 3300025273 Bacteria 286207
220 Ga0209130_1000976 3300025284 Bacteria 22454
221 Ga0209564_1005217 3300025295 Bacteria 7518
222 Ga0209564_1007602 3300025295 Bacteria 5560
223 Ga0209564_1081662 3300025295 Unclassified 629
224 Ga0209758_1004184 3300025297 Bacteria 12259
225 Ga0209758_1008253 3300025297 Bacteria 6817
226 Ga0209050_1000272 3300025298 Bacteria 110636
227 Ga0207426_1000030 3300025302 Bacteria 461478
228 Ga0207426_1000233 3300025302 Bacteria 127848
229 Ga0207426_1001865 3300025302 Bacteria 15465
230 Ga0207426_1047250 3300025302 Bacteria 1299
231 Ga0209257_1002478 3300025304 Bacteria 18255
232 Ga0207656_10279266 3300025321 Bacteria 823
233 Ga0207647_10000463 3300025904 Bacteria 32923
234 Ga0207647_10002317 3300025904 Bacteria 14485
235 Ga0207647_10008145 3300025904 Bacteria 7530
236 Ga0207645_10000082 3300025907 Bacteria 68372
237 Ga0207705_10000015 3300025909 Bacteria 382901
238 Ga0207705_10090856 3300025909 Bacteria 2236
239 Ga0207705_10442565 3300025909 Bacteria 1007
240 Ga0207705_10544828 3300025909 Unclassified 902
241 Ga0207654_10002190 3300025911 Bacteria 9998
242 Ga0207654_10094726 3300025911 Bacteria 1828
243 Ga0207654_10244739 3300025911 Bacteria 1200
244 Ga0207707_10528295 3300025912 Bacteria 1004
245 Ga0207695_10010555 3300025913 Bacteria 11295
246 Ga0207695_10022088 3300025913 Bacteria 7238
247 Ga0207695_10026330 3300025913 Bacteria 6492
248 Ga0207695_10045184 3300025913 Bacteria 4678
249 Ga0207695_10169042 3300025913 Unclassified 2113
250 Ga0207695_11012520 3300025913 Bacteria 710
251 Ga0207671_10004889 3300025914 Bacteria 12594
252 Ga0207671_10013495 3300025914 Bacteria 6503
253 Ga0207671_10200242 3300025914 Bacteria 1559
254 Ga0207671_10285494 3300025914 Bacteria 1302
255 Ga0207660_10121846 3300025917 Bacteria 1976
256 Ga0207657_10118301 3300025919 Bacteria 2181
257 Ga0207657_10168624 3300025919 Bacteria 1775
258 Ga0207649_10193466 3300025920 Unclassified 1432
259 Ga0207652_10561611 3300025921 Unclassified 1025
260 Ga0207652_10675776 3300025921 Bacteria 922
261 Ga0207652_10911167 3300025921 Bacteria 776
262 Ga0207681_10606889 3300025923 Bacteria 905
263 Ga0207694_10097885 3300025924 Bacteria 2322
264 Ga0207650_10449747 3300025925 Unclassified 1072
265 Ga0207659_10110951 3300025926 Unclassified 2085
266 Ga0207659_10861722 3300025926 Bacteria 779
267 Ga0207659_11255596 3300025926 Bacteria 636
268 Ga0207644_10025333 3300025931 Bacteria 4080
269 Ga0207644_10698221 3300025931 Bacteria 846
270 Ga0207690_10018517 3300025932 Bacteria 4271
271 Ga0207690_10862537 3300025932 Bacteria 750
272 Ga0207706_10001363 3300025933 Bacteria 24429
273 Ga0207706_10006247 3300025933 Bacteria 11074
274 Ga0207669_10167058 3300025937 Bacteria 1562
275 Ga0207669_10386974 3300025937 Bacteria 1091
276 Ga0207704_10000078 3300025938 Bacteria 59491
277 Ga0207691_10205477 3300025940 Bacteria 1713
278 Ga0207691_11036514 3300025940 Bacteria 684
279 Ga0207689_10249464 3300025942 Unclassified 1468
280 Ga0207689_10376998 3300025942 Bacteria 1181
281 Ga0207661_10911308 3300025944 Bacteria 809
282 Ga0207679_10471249 3300025945 Bacteria 1116
283 Ga0207667_10001584 3300025949 Bacteria 28609
284 Ga0207667_10013812 3300025949 Bacteria 9224
285 Ga0207667_10037382 3300025949 Bacteria 5190
286 Ga0207667_10045148 3300025949 Bacteria 4667
287 Ga0207667_10056234 3300025949 Bacteria 4134
288 Ga0207667_10227629 3300025949 Bacteria 1910
289 Ga0207667_10366928 3300025949 Unclassified 1468
290 Ga0207667_11256867 3300025949 Unclassified 718
291 Ga0207667_11501597 3300025949 Bacteria 645
292 Ga0207651_10003963 3300025960 Bacteria 7353
293 Ga0207651_10210453 3300025960 Unclassified 1565
294 Ga0207640_11139626 3300025981 Unclassified 691
295 Ga0207640_11246111 3300025981 Bacteria 663
296 Ga0207640_12014018 3300025981 Bacteria 523
297 Ga0207658_11413263 3300025986 Unclassified 636
298 Ga0207658_11464018 3300025986 Bacteria 625
299 Ga0207639_10002536 3300026041 Bacteria 12254
300 Ga0207639_10184541 3300026041 Unclassified 1777
301 Ga0207639_10487562 3300026041 Bacteria 1124
302 Ga0207639_10502930 3300026041 Bacteria 1107
303 Ga0207639_11131218 3300026041 Bacteria 734
304 Ga0207702_10054908 3300026078 Bacteria 3377
305 Ga0207702_10079442 3300026078 Bacteria 2843
306 Ga0207702_10593192 3300026078 Bacteria 1087
307 Ga0207702_10878119 3300026078 Bacteria 888
308 Ga0207702_10982871 3300026078 Bacteria 837
309 Ga0207702_12406608 3300026078 Bacteria 514
310 Ga0207641_11335808 3300026088 Bacteria 718
311 Ga0207648_10000472 3300026089 Bacteria 44933
312 Ga0207648_10239697 3300026089 Bacteria 1614
313 Ga0207676_10243860 3300026095 Bacteria 1614
314 Ga0207676_10257108 3300026095 Bacteria 1575
315 Ga0207676_10389267 3300026095 Bacteria 1300
316 Ga0207676_12431691 3300026095 Bacteria 521
317 Ga0207674_10177020 3300026116 Unclassified 2085
318 Ga0207674_10212888 3300026116 Bacteria 1881
319 Ga0207674_10308827 3300026116 Bacteria 1531
320 Ga0207674_10661551 3300026116 Bacteria 1009
321 Ga0207675_100375005 3300026118 Bacteria 1398
322 Ga0207683_10014226 3300026121 Bacteria 6778
323 Ga0207698_10161706 3300026142 Bacteria 1959
324 Ga0207698_10283439 3300026142 Bacteria 1534
325 Ga0207698_10302479 3300026142 Bacteria 1489
326 Ga0207698_10588993 3300026142 Bacteria 1095
327 Ga0207698_11080014 3300026142 Bacteria 815
328 Ga0268266_10000052 3300028379 Bacteria 296230
329 Ga0268266_10042782 3300028379 Unclassified 3870
330 Ga0268265_10095657 3300028380 Unclassified 2385
331 Ga0268264_10005023 3300028381 Bacteria 11200
332 Ga0268264_12032374 3300028381 Bacteria 584
333 Ga0307517_10013049 3300028786 Bacteria 11328
334 Ga0307515_10000280 3300028794 Bacteria 125330
335 Ga0265338_10014193 3300028800 Bacteria 8897
336 Ga0265320_10069354 3300031240 Bacteria 1664
337 Ga0265327_10045402 3300031251 Bacteria 2335
338 Ga0307509_10007469 3300031507 Bacteria 14263
339 Ga0307509_10480132 3300031507 Bacteria 931
340 Ga0307412_11537006 3300031911 Bacteria 606
341 Ga0307510_10021390 3300033180 Bacteria 7538
342 Ga0307510_10484276 3300033180 Bacteria 679
343 Ga0373941_0044832 3300035115 Bacteria 1381
344 Ga0395899_0000002 3300037312 Bacteria 1324310
345 Ga0395899_0000312 3300037312 Bacteria 62304
346 Ga0395899_0072330 3300037312 Bacteria 2523
347 Ga0395900_0000014 3300037418 Bacteria 386513
348 Ga0395900_0000128 3300037418 Bacteria 127446
349 Ga0395900_0005426 3300037418 Bacteria 13362
350 Ga0395900_0986217 3300037418 Bacteria 763
351 Ga0395898_0021189 3300037466 Bacteria 6594
352 Ga0395905_0000037 3300037471 Bacteria 261808
353 Ga0395905_0006237 3300037471 Bacteria 12038
354 Ga0395905_0170697 3300037471 Bacteria 2043
355 Ga0395905_0259434 3300037471 Unclassified 1623
356 Ga0395905_0598979 3300037471 Bacteria 1004
357 Ga0395901_0000166 3300038443 Bacteria 86352
358 Ga0436361_0360494 3300039447 Bacteria 8737
359 Ga0436363_0061232 3300039450 Bacteria 2581
360 Ga0436363_0121304 3300039450 Bacteria 1654
361 Ga0451791_0703053 3300041451 Bacteria 1186
362 Ga0451791_0969218 3300041451 Bacteria 684
363 Ga0451800_1033799 3300041459 Unclassified 701
364 Ga0451807_0001899 3300041486 Bacteria 821
365 Ga0451807_1089415 3300041486 Bacteria 529
366 Ga0451833_1056126 3300041491 Bacteria 960
367 Ga0439431_0000225 3300041997 Bacteria 11382
368 Ga0466969_0140681 3300044656 Bacteria 1115
369 Ga0466972_0073142 3300044658 Bacteria 1634
370 Ga0466972_0483093 3300044658 Bacteria 583
371 Ga0466965_0104846 3300044683 Bacteria 1449
372 Ga0453684_0096941 3300044712 Bacteria 3621
373 Ga0466968_0088057 3300044735 Bacteria 1372
374 Ga0466957_0157485 3300044842 Bacteria 1473
375 Ga0466957_0228546 3300044842 Bacteria 1231
376 Ga0466960_0267213 3300044901 Bacteria 955
377 Ga0466959_0009583 3300045049 Bacteria 6890
378 Ga0466959_1121709 3300045049 Unclassified 523
379 Ga0466967_1233281 3300045976 Bacteria 745
380 Ga0495650_0000087 3300046471 Bacteria 234870
381 Ga0495585_0137308 3300046492 Bacteria 1283
382 Ga0495596_0194502 3300046500 Bacteria 788
383 Ga0495583_0117821 3300046506 Bacteria 1120
384 Ga0495606_0546979 3300046507 Bacteria 577
385 Ga0495608_0360811 3300046511 Bacteria 893
386 Ga0495610_0064142 3300046512 Bacteria 1737
387 Ga0495616_0002580 3300046513 Bacteria 11923
388 Ga0495616_0005811 3300046513 Bacteria 7538
389 Ga0495631_0018106 3300046518 Bacteria 3320
390 Ga0495644_0235141 3300046523 Bacteria 710
391 Ga0495648_0005125 3300046524 Bacteria 10975
392 Ga0495642_0160364 3300046528 Bacteria 975
393 Ga0495652_0170444 3300046529 Unclassified 1681
394 Ga0495654_0034622 3300046530 Bacteria 2547
395 Ga0495609_0016612 3300046538 Bacteria 3427
396 Ga0495622_0164902 3300046557 Bacteria 998
397 Ga0495668_0189266 3300046616 Bacteria 1127
398 Ga0495611_0334387 3300046648 Bacteria 696
399 Ga0495625_0000008 3300046660 Bacteria 536165
400 Ga0495625_0014767 3300046660 Bacteria 6216
401 Ga0495625_0031960 3300046660 Bacteria 3910
402 Ga0495661_0003217 3300046665 Bacteria 12191
403 Ga0495671_0117910 3300046692 Bacteria 1296
404 Ga0495649_0000018 3300046694 Bacteria 220586
405 Ga0495604_0899231 3300047317 Bacteria 553
406 Ga0495672_0035866 3300047320 Bacteria 3051
407 Ga0495687_001574 3300047443 Bacteria 20718
408 Ga0495687_209927 3300047443 Bacteria 611
409 Ga0495679_086770 3300047446 Bacteria 882
410 Ga0495673_0085717 3300047469 Bacteria 1296
411 Ga0495686_0025603 3300047472 Bacteria 3867
412 Ga0495686_0030076 3300047472 Unclassified 3530
413 Ga0495686_0193718 3300047472 Bacteria 1170
414 Ga0496121_0000008 3300048924 Bacteria 843593
415 Ga0495678_030657 3300049459 Bacteria 2249
416 Ga0501033_0038409 3300049570 Bacteria 3579
417 Ga0501034_0296973 3300049571 Bacteria 1553
418 Ga0501034_0613088 3300049571 Bacteria 993
419 Ga0501037_0270358 3300049573 Bacteria 1186
420 Ga0501038_0534218 3300049574 Bacteria 894
421 Ga0501046_0000103 3300049580 Bacteria 89927
422 Ga0501047_0027417 3300049581 Bacteria 5487
423 Ga0501035_0017901 3300049822 Bacteria 6536
424 Ga0501035_0125793 3300049822 Bacteria 2238
425 Ga0501035_0379556 3300049822 Unclassified 1179
426 Ga0501044_0336629 3300049823 Bacteria 1431
427 nmdc:mga0k408_13994_c1 3300050493 Bacteria 4409
428 nmdc:mga0qj67_365061_c1 3300050509 Bacteria 1166
429 nmdc:mga08y16_111765_c1 3300050511 Unclassified 2844
430 Ga0500635_0002470 3300053080 Bacteria 4588
431 Ga0500635_0010879 3300053080 Bacteria 2570
432 Ga0500607_265108 3300053121 Bacteria 669
433 Ga0500608_028201 3300053122 Bacteria 2650
434 Ga0500608_035171 3300053122 Bacteria 2389
435 Ga0500642_0058116 3300053130 Bacteria 1728
436 Ga0500652_002298 3300053131 Bacteria 5745
437 Ga0500588_0004226 3300053146 Bacteria 3096

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005459 Ga0068867_100380966 Ga0068867_1003809661 140
2 3300026089 Ga0207648_10239697 Ga0207648_102396972 140
3 3300025912 Ga0207707_10528295 Ga0207707_105282952 142
4 3300025925 Ga0207650_10449747 Ga0207650_104497472 142
5 3300025942 Ga0207689_10249464 Ga0207689_102494641 142
6 3300026078 Ga0207702_10593192 Ga0207702_105931922 142
7 3300002737 JGI25162J39368_1002129 JGI25162J39368_100212910 143
8 3300003214 JGI25165J46597_1001445 JGI25165J46597_10014456 143
9 3300003323 rootH1_10009528 rootH1_1000952818 143
10 3300005288 Ga0065714_10006471 Ga0065714_100064718 143
11 3300005327 Ga0070658_10059182 Ga0070658_100591823 143
12 3300005336 Ga0070680_100725343 Ga0070680_1007253431 143
13 3300005366 Ga0070659_100004095 Ga0070659_10000409512 143
14 3300005563 Ga0068855_101757860 Ga0068855_1017578601 143
15 3300005563 Ga0068855_101828029 Ga0068855_1018280291 143
16 3300005577 Ga0068857_100037446 Ga0068857_1000374462 143
17 3300005578 Ga0068854_101340089 Ga0068854_1013400892 143
18 3300021361 Ga0213872_10008555 Ga0213872_100085551 143
19 3300025230 Ga0209563_104761 Ga0209563_1047612 143
20 3300025231 Ga0207427_100766 Ga0207427_10076611 143
21 3300025233 Ga0209437_100052 Ga0209437_100052114 143
22 3300025261 Ga0209233_1000067 Ga0209233_1000067114 143
23 3300025261 Ga0209233_1001304 Ga0209233_10013045 143
24 3300025272 Ga0209455_1004456 Ga0209455_10044563 143
25 3300025904 Ga0207647_10000463 Ga0207647_1000046314 143
26 3300025913 Ga0207695_10169042 Ga0207695_101690422 143
27 3300025921 Ga0207652_10911167 Ga0207652_109111672 143
28 3300025932 Ga0207690_10018517 Ga0207690_100185172 143
29 3300025932 Ga0207690_10862537 Ga0207690_108625371 143
30 3300025949 Ga0207667_10001584 Ga0207667_1000158414 143
31 3300025949 Ga0207667_11256867 Ga0207667_112568672 143
32 3300025949 Ga0207667_11501597 Ga0207667_115015971 143
33 3300025981 Ga0207640_11246111 Ga0207640_112461112 143
34 3300026078 Ga0207702_10982871 Ga0207702_109828712 143
35 3300026116 Ga0207674_10212888 Ga0207674_102128882 143
36 3300026142 Ga0207698_10588993 Ga0207698_105889932 143
37 3300031507 Ga0307509_10007469 Ga0307509_1000746910 143
38 3300041459 Ga0451800_1033799 Ga0451800_1033799_239_673 143
39 3300041486 Ga0451807_1089415 Ga0451807_1089415_62_496 143
40 3300046507 Ga0495606_0546979 Ga0495606_0546979_30_464 143
41 3300046692 Ga0495671_0117910 Ga0495671_0117910_11_445 143
42 3300047317 Ga0495604_0899231 Ga0495604_0899231_92_526 143
43 3300049571 Ga0501034_0613088 Ga0501034_0613088_13_447 143
44 3300005614 Ga0068856_100005531 Ga0068856_1000055314 144
45 3300025926 Ga0207659_10861722 Ga0207659_108617222 144
46 3300026078 Ga0207702_10079442 Ga0207702_100794423 144
47 3300047320 Ga0495672_0035866 Ga0495672_0035866_2584_3024 144
48 3300039450 Ga0436363_0061232 Ga0436363_0061232_1612_2067 145
49 3300039450 Ga0436363_0121304 Ga0436363_0121304_399_854 145
50 3300041486 Ga0451807_0001899 Ga0451807_0001899_337_780 145
51 3300006237 Ga0097621_100597036 Ga0097621_1005970362 147
52 3300013306 Ga0163162_11451799 Ga0163162_114517992 147
53 3300031251 Ga0265327_10045402 Ga0265327_100454022 147
54 3300005328 Ga0070676_11150863 Ga0070676_111508631 148
55 3300049570 Ga0501033_0038409 Ga0501033_0038409_1929_2414 149
56 3300049822 Ga0501035_0379556 Ga0501035_0379556_436_921 149
57 3300046471 Ga0495650_0000087 Ga0495650_0000087_89767_90237 150
58 3300046506 Ga0495583_0117821 Ga0495583_0117821_351_821 150
59 3300046512 Ga0495610_0064142 Ga0495610_0064142_61_531 150
60 3300046513 Ga0495616_0002580 Ga0495616_0002580_8901_9371 150
61 3300046538 Ga0495609_0016612 Ga0495609_0016612_819_1289 150
62 3300046616 Ga0495668_0189266 Ga0495668_0189266_488_958 150
63 3300046660 Ga0495625_0000008 Ga0495625_0000008_470487_470957 150
64 3300046665 Ga0495661_0003217 Ga0495661_0003217_3930_4400 150
65 3300046694 Ga0495649_0000018 Ga0495649_0000018_65208_65678 150
66 3300047446 Ga0495679_086770 Ga0495679_086770_252_722 150
67 3300047469 Ga0495673_0085717 Ga0495673_0085717_557_1027 150
68 3300009174 Ga0105241_10476776 Ga0105241_104767761 151
69 3300025931 Ga0207644_10698221 Ga0207644_106982212 151
70 3300049571 Ga0501034_0296973 Ga0501034_0296973_107_598 151
71 3300049573 Ga0501037_0270358 Ga0501037_0270358_267_758 151
72 3300049574 Ga0501038_0534218 Ga0501038_0534218_266_757 151
73 3300049581 Ga0501047_0027417 Ga0501047_0027417_2629_3120 151
74 3300049822 Ga0501035_0125793 Ga0501035_0125793_1707_2198 151
75 3300049823 Ga0501044_0336629 Ga0501044_0336629_351_842 151
76 3300053146 Ga0500588_0004226 Ga0500588_0004226_1980_2456 151
77 iso_pu_bacteria 2852623160 2852623773 151
78 iso_pu_bacteria 2884933994 2884937321 151
79 iso_pu_bacteria 2896109856 2896112310 152
80 iso_pu_bacteria 2929239360 2929239628 152
81 iso_pu_bacteria 2839989709 2839992637 153
82 iso_pu_bacteria 2911138879 2911141355 153
83 iso_pu_bacteria 2919399522 2919404073 153
84 iso_pu_bacteria 2946019816 2946020996 153
85 iso_pu_bacteria 2738543014 2739255291 154
86 iso_pu_bacteria 2896085136 2896087966 154
87 iso_pu_bacteria 2929177148 2929177206 154
88 iso_pu_bacteria 2945977869 2945979573 154
89 iso_pu_bacteria 2946013367 2946014559 154
90 3300003323 rootH1_10039649 rootH1_100396491 155
91 3300004799 Ga0058863_11903483 Ga0058863_119034833 155
92 3300005327 Ga0070658_10000011 Ga0070658_1000001199 155
93 3300005458 Ga0070681_10093028 Ga0070681_100930283 155
94 3300005530 Ga0070679_100032826 Ga0070679_1000328262 155
95 3300005563 Ga0068855_100017518 Ga0068855_1000175183 155
96 3300009093 Ga0105240_10131450 Ga0105240_101314503 155
97 3300009174 Ga0105241_10063493 Ga0105241_100634932 155
98 3300009545 Ga0105237_10158158 Ga0105237_101581582 155
99 3300009545 Ga0105237_10339220 Ga0105237_103392202 155
100 3300010375 Ga0105239_10008543 Ga0105239_100085433 155
101 3300013297 Ga0157378_10025837 Ga0157378_100258374 155
102 3300013297 Ga0157378_10158271 Ga0157378_101582712 155
103 3300013306 Ga0163162_10005497 Ga0163162_1000549713 155
104 3300013308 Ga0157375_10070001 Ga0157375_100700013 155
105 3300025909 Ga0207705_10000015 Ga0207705_1000001599 155
106 3300025914 Ga0207671_10285494 Ga0207671_102854942 155
107 3300025949 Ga0207667_10037382 Ga0207667_100373826 155
108 3300028794 Ga0307515_10000280 Ga0307515_1000028040 155
109 3300033180 Ga0307510_10484276 Ga0307510_104842761 155
110 3300035115 Ga0373941_0044832 Ga0373941_0044832_882_1352 155
111 3300046511 Ga0495608_0360811 Ga0495608_0360811_383_853 155
112 3300046513 Ga0495616_0005811 Ga0495616_0005811_4244_4714 155
113 3300046523 Ga0495644_0235141 Ga0495644_0235141_202_672 155
114 3300046524 Ga0495648_0005125 Ga0495648_0005125_8776_9246 155
115 3300046529 Ga0495652_0170444 Ga0495652_0170444_438_908 155
116 3300046530 Ga0495654_0034622 Ga0495654_0034622_501_971 155
117 3300046557 Ga0495622_0164902 Ga0495622_0164902_26_496 155
118 3300046648 Ga0495611_0334387 Ga0495611_0334387_111_581 155
119 3300046660 Ga0495625_0014767 Ga0495625_0014767_3560_4030 155
120 3300047443 Ga0495687_209927 Ga0495687_209927_69_539 155
121 3300047472 Ga0495686_0025603 Ga0495686_0025603_2689_3159 155
122 3300047472 Ga0495686_0193718 Ga0495686_0193718_550_1020 155
123 3300049459 Ga0495678_030657 Ga0495678_030657_789_1259 155
124 3300053122 Ga0500608_035171 Ga0500608_035171_1491_1961 155
125 iso_pu_bacteria 2884791551 2884797324 155
126 3300003320 rootH2_10001101 rootH2_1000110125 156
127 3300003323 rootH1_10094446 rootH1_100944462 156
128 3300003323 rootH1_10158475 rootH1_101584753 156
129 3300005293 Ga0065715_10584689 Ga0065715_105846891 156
130 3300005327 Ga0070658_10187503 Ga0070658_101875032 156
131 3300005328 Ga0070676_10000471 Ga0070676_100004716 156
132 3300005334 Ga0068869_100150757 Ga0068869_1001507572 156
133 3300005334 Ga0068869_100488382 Ga0068869_1004883822 156
134 3300005336 Ga0070680_100327163 Ga0070680_1003271632 156
135 3300005339 Ga0070660_100055845 Ga0070660_1000558453 156
136 3300005339 Ga0070660_100284733 Ga0070660_1002847332 156
137 3300005353 Ga0070669_100267287 Ga0070669_1002672872 156
138 3300005355 Ga0070671_100029755 Ga0070671_1000297551 156
139 3300005356 Ga0070674_100369679 Ga0070674_1003696792 156
140 3300005364 Ga0070673_100006304 Ga0070673_1000063043 156
141 3300005366 Ga0070659_100512986 Ga0070659_1005129862 156
142 3300005456 Ga0070678_100002096 Ga0070678_1000020966 156
143 3300005457 Ga0070662_100002245 Ga0070662_1000022452 156
144 3300005459 Ga0068867_100003012 Ga0068867_10000301210 156
145 3300005530 Ga0070679_100141055 Ga0070679_1001410553 156
146 3300005530 Ga0070679_100526702 Ga0070679_1005267022 156
147 3300005535 Ga0070684_101013127 Ga0070684_1010131271 156
148 3300005539 Ga0068853_100004807 Ga0068853_10000480710 156
149 3300005539 Ga0068853_100049786 Ga0068853_1000497865 156
150 3300005539 Ga0068853_100846797 Ga0068853_1008467972 156
151 3300005545 Ga0070695_101537486 Ga0070695_1015374861 156
152 3300005548 Ga0070665_100000003 Ga0070665_100000003610 156
153 3300005563 Ga0068855_100010991 Ga0068855_10001099110 156
154 3300005563 Ga0068855_100233312 Ga0068855_1002333123 156
155 3300005563 Ga0068855_101386092 Ga0068855_1013860922 156
156 3300005614 Ga0068856_100201118 Ga0068856_1002011181 156
157 3300005616 Ga0068852_100006806 Ga0068852_1000068066 156
158 3300005616 Ga0068852_100226196 Ga0068852_1002261962 156
159 3300005617 Ga0068859_100039885 Ga0068859_1000398854 156
160 3300005840 Ga0068870_10535096 Ga0068870_105350961 156
161 3300005842 Ga0068858_100158547 Ga0068858_1001585472 156
162 3300005843 Ga0068860_100003179 Ga0068860_1000031794 156
163 3300005844 Ga0068862_100137052 Ga0068862_1001370522 156
164 3300006237 Ga0097621_100000020 Ga0097621_10000002075 156
165 3300006358 Ga0068871_100000130 Ga0068871_10000013021 156
166 3300006881 Ga0068865_100000050 Ga0068865_10000005030 156
167 3300006931 Ga0097620_100039887 Ga0097620_1000398874 156
168 3300009093 Ga0105240_10010235 Ga0105240_100102358 156
169 3300009093 Ga0105240_10018707 Ga0105240_100187078 156
170 3300009098 Ga0105245_10029178 Ga0105245_100291783 156
171 3300009101 Ga0105247_10452901 Ga0105247_104529012 156
172 3300009148 Ga0105243_10079878 Ga0105243_100798782 156
173 3300009174 Ga0105241_10000281 Ga0105241_1000028129 156
174 3300009174 Ga0105241_10009625 Ga0105241_100096255 156
175 3300009174 Ga0105241_10009913 Ga0105241_100099136 156
176 3300009174 Ga0105241_11167234 Ga0105241_111672342 156
177 3300009176 Ga0105242_10017684 Ga0105242_100176843 156
178 3300009545 Ga0105237_10003737 Ga0105237_1000373716 156
179 3300009545 Ga0105237_10005432 Ga0105237_100054326 156
180 3300009545 Ga0105237_10323523 Ga0105237_103235232 156
181 3300009551 Ga0105238_10018941 Ga0105238_100189413 156
182 3300010375 Ga0105239_10071795 Ga0105239_100717952 156
183 3300010375 Ga0105239_10077424 Ga0105239_100774242 156
184 3300011119 Ga0105246_10012536 Ga0105246_100125364 156
185 3300011119 Ga0105246_10220149 Ga0105246_102201492 156
186 3300013100 Ga0157373_10142759 Ga0157373_101427592 156
187 3300013100 Ga0157373_10239916 Ga0157373_102399162 156
188 3300013102 Ga0157371_10070860 Ga0157371_100708602 156
189 3300013104 Ga0157370_10132970 Ga0157370_101329702 156
190 3300013104 Ga0157370_10464400 Ga0157370_104644002 156
191 3300013104 Ga0157370_10967153 Ga0157370_109671532 156
192 3300013105 Ga0157369_10099032 Ga0157369_100990322 156
193 3300013105 Ga0157369_10248245 Ga0157369_102482452 156
194 3300013296 Ga0157374_10003065 Ga0157374_100030656 156
195 3300013296 Ga0157374_10003613 Ga0157374_100036136 156
196 3300013296 Ga0157374_10558816 Ga0157374_105588162 156
197 3300013297 Ga0157378_10011737 Ga0157378_100117374 156
198 3300013306 Ga0163162_10000031 Ga0163162_1000003121 156
199 3300013306 Ga0163162_11284622 Ga0163162_112846222 156
200 3300013307 Ga0157372_10288551 Ga0157372_102885513 156
201 3300014325 Ga0163163_10623135 Ga0163163_106231352 156
202 3300014325 Ga0163163_10903493 Ga0163163_109034932 156
203 3300025904 Ga0207647_10002317 Ga0207647_100023175 156
204 3300025907 Ga0207645_10000082 Ga0207645_1000008249 156
205 3300025909 Ga0207705_10090856 Ga0207705_100908562 156
206 3300025909 Ga0207705_10442565 Ga0207705_104425651 156
207 3300025911 Ga0207654_10002190 Ga0207654_100021902 156
208 3300025911 Ga0207654_10094726 Ga0207654_100947263 156
209 3300025911 Ga0207654_10244739 Ga0207654_102447392 156
210 3300025913 Ga0207695_10010555 Ga0207695_100105557 156
211 3300025913 Ga0207695_10026330 Ga0207695_100263305 156
212 3300025913 Ga0207695_10045184 Ga0207695_100451842 156
213 3300025914 Ga0207671_10004889 Ga0207671_100048897 156
214 3300025914 Ga0207671_10013495 Ga0207671_100134952 156
215 3300025917 Ga0207660_10121846 Ga0207660_101218462 156
216 3300025919 Ga0207657_10168624 Ga0207657_101686243 156
217 3300025921 Ga0207652_10561611 Ga0207652_105616111 156
218 3300025921 Ga0207652_10675776 Ga0207652_106757762 156
219 3300025924 Ga0207694_10097885 Ga0207694_100978852 156
220 3300025931 Ga0207644_10025333 Ga0207644_100253336 156
221 3300025933 Ga0207706_10001363 Ga0207706_1000136313 156
222 3300025937 Ga0207669_10386974 Ga0207669_103869742 156
223 3300025938 Ga0207704_10000078 Ga0207704_1000007830 156
224 3300025942 Ga0207689_10376998 Ga0207689_103769982 156
225 3300025949 Ga0207667_10013812 Ga0207667_100138123 156
226 3300025949 Ga0207667_10045148 Ga0207667_100451483 156
227 3300025949 Ga0207667_10227629 Ga0207667_102276292 156
228 3300025949 Ga0207667_10366928 Ga0207667_103669282 156
229 3300025960 Ga0207651_10003963 Ga0207651_100039635 156
230 3300025981 Ga0207640_11139626 Ga0207640_111396261 156
231 3300025981 Ga0207640_12014018 Ga0207640_120140181 156
232 3300025986 Ga0207658_11413263 Ga0207658_114132631 156
233 3300026041 Ga0207639_10002536 Ga0207639_100025369 156
234 3300026041 Ga0207639_10487562 Ga0207639_104875622 156
235 3300026041 Ga0207639_10502930 Ga0207639_105029302 156
236 3300026041 Ga0207639_11131218 Ga0207639_111312182 156
237 3300026078 Ga0207702_12406608 Ga0207702_124066081 156
238 3300026089 Ga0207648_10000472 Ga0207648_1000047222 156
239 3300026095 Ga0207676_12431691 Ga0207676_124316911 156
240 3300026121 Ga0207683_10014226 Ga0207683_100142267 156
241 3300026142 Ga0207698_10161706 Ga0207698_101617062 156
242 3300026142 Ga0207698_10302479 Ga0207698_103024792 156
243 3300026142 Ga0207698_11080014 Ga0207698_110800142 156
244 3300028379 Ga0268266_10000052 Ga0268266_10000052202 156
245 3300028380 Ga0268265_10095657 Ga0268265_100956572 156
246 3300028381 Ga0268264_12032374 Ga0268264_120323741 156
247 3300028786 Ga0307517_10013049 Ga0307517_1001304911 156
248 3300031507 Ga0307509_10480132 Ga0307509_104801322 156
249 3300033180 Ga0307510_10021390 Ga0307510_100213908 156
250 3300037312 Ga0395899_0000312 Ga0395899_0000312_28591_29064 156
251 3300037418 Ga0395900_0000014 Ga0395900_0000014_45952_46425 156
252 3300037418 Ga0395900_0000128 Ga0395900_0000128_91189_91662 156
253 3300037466 Ga0395898_0021189 Ga0395898_0021189_2800_3273 156
254 3300037471 Ga0395905_0000037 Ga0395905_0000037_45942_46415 156
255 3300038443 Ga0395901_0000166 Ga0395901_0000166_45806_46279 156
256 3300039447 Ga0436361_0360494 Ga0436361_0360494_4837_5310 156
257 3300041491 Ga0451833_1056126 Ga0451833_1056126_337_816 156
258 3300044842 Ga0466957_0157485 Ga0466957_0157485_632_1114 156
259 3300046500 Ga0495596_0194502 Ga0495596_0194502_260_733 156
260 3300046518 Ga0495631_0018106 Ga0495631_0018106_2200_2673 156
261 3300046528 Ga0495642_0160364 Ga0495642_0160364_132_605 156
262 3300047443 Ga0495687_001574 Ga0495687_001574_1829_2302 156
263 3300048924 Ga0496121_0000008 Ga0496121_0000008_186587_187069 156
264 3300053080 Ga0500635_0002470 Ga0500635_0002470_2092_2565 156
265 3300053121 Ga0500607_265108 Ga0500607_265108_19_501 156
266 3300053130 Ga0500642_0058116 Ga0500642_0058116_70_543 156
267 3300001979 JGI24740J21852_10141127 JGI24740J21852_101411271 157
268 3300003203 JGI25406J46586_10013358 JGI25406J46586_100133584 157
269 3300003203 JGI25406J46586_10021135 JGI25406J46586_100211354 157
270 3300003320 rootH2_10215700 rootH2_102157003 157
271 3300003323 rootH1_10232185 rootH1_102321853 157
272 3300003354 JGI25160J50197_1010557 JGI25160J50197_10105572 157
273 3300005328 Ga0070676_10110857 Ga0070676_101108572 157
274 3300005329 Ga0070683_100104508 Ga0070683_1001045083 157
275 3300005330 Ga0070690_100230531 Ga0070690_1002305311 157
276 3300005333 Ga0070677_10478376 Ga0070677_104783761 157
277 3300005334 Ga0068869_100592781 Ga0068869_1005927812 157
278 3300005335 Ga0070666_10193073 Ga0070666_101930732 157
279 3300005336 Ga0070680_100317620 Ga0070680_1003176201 157
280 3300005339 Ga0070660_100014306 Ga0070660_1000143062 157
281 3300005344 Ga0070661_100276884 Ga0070661_1002768841 157
282 3300005355 Ga0070671_100575466 Ga0070671_1005754662 157
283 3300005364 Ga0070673_100236646 Ga0070673_1002366461 157
284 3300005366 Ga0070659_100178954 Ga0070659_1001789542 157
285 3300005457 Ga0070662_100136109 Ga0070662_1001361092 157
286 3300005535 Ga0070684_100121665 Ga0070684_1001216652 157
287 3300005539 Ga0068853_100275649 Ga0068853_1002756492 157
288 3300005563 Ga0068855_100208154 Ga0068855_1002081543 157
289 3300005577 Ga0068857_100174186 Ga0068857_1001741862 157
290 3300005577 Ga0068857_100287742 Ga0068857_1002877422 157
291 3300005614 Ga0068856_100565266 Ga0068856_1005652662 157
292 3300005616 Ga0068852_100239301 Ga0068852_1002393011 157
293 3300005616 Ga0068852_100839445 Ga0068852_1008394452 157
294 3300005616 Ga0068852_102659718 Ga0068852_1026597181 157
295 3300005617 Ga0068859_101131958 Ga0068859_1011319582 157
296 3300005618 Ga0068864_100434578 Ga0068864_1004345782 157
297 3300005834 Ga0068851_10107854 Ga0068851_101078542 157
298 3300005843 Ga0068860_100039308 Ga0068860_1000393082 157
299 3300005843 Ga0068860_100749525 Ga0068860_1007495252 157
300 3300005985 Ga0081539_10001000 Ga0081539_100010003 157
301 3300005985 Ga0081539_10027743 Ga0081539_100277433 157
302 3300005985 Ga0081539_10111806 Ga0081539_101118063 157
303 3300006931 Ga0097620_101131964 Ga0097620_1011319642 157
304 3300009098 Ga0105245_10642604 Ga0105245_106426042 157
305 3300009101 Ga0105247_10520370 Ga0105247_105203701 157
306 3300009545 Ga0105237_10628309 Ga0105237_106283091 157
307 3300010375 Ga0105239_10000002 Ga0105239_10000002265 157
308 3300010375 Ga0105239_10190093 Ga0105239_101900933 157
309 3300011119 Ga0105246_10775115 Ga0105246_107751151 157
310 3300013100 Ga0157373_10011051 Ga0157373_100110512 157
311 3300013102 Ga0157371_10000269 Ga0157371_100002692 157
312 3300013102 Ga0157371_10162071 Ga0157371_101620711 157
313 3300013102 Ga0157371_10933133 Ga0157371_109331332 157
314 3300013105 Ga0157369_10157365 Ga0157369_101573652 157
315 3300013105 Ga0157369_10296173 Ga0157369_102961732 157
316 3300013296 Ga0157374_10032460 Ga0157374_100324601 157
317 3300013297 Ga0157378_11004333 Ga0157378_110043332 157
318 3300013306 Ga0163162_10000705 Ga0163162_1000070511 157
319 3300013306 Ga0163162_10877308 Ga0163162_108773082 157
320 3300013306 Ga0163162_10917261 Ga0163162_109172612 157
321 3300013307 Ga0157372_10001534 Ga0157372_1000153417 157
322 3300013307 Ga0157372_10261500 Ga0157372_102615001 157
323 3300013307 Ga0157372_10291468 Ga0157372_102914681 157
324 3300013307 Ga0157372_10516304 Ga0157372_105163042 157
325 3300013307 Ga0157372_10731150 Ga0157372_107311502 157
326 3300013308 Ga0157375_10319225 Ga0157375_103192252 157
327 3300014745 Ga0157377_10437454 Ga0157377_104374542 157
328 3300025302 Ga0207426_1000030 Ga0207426_1000030212 157
329 3300025321 Ga0207656_10279266 Ga0207656_102792662 157
330 3300025914 Ga0207671_10200242 Ga0207671_102002422 157
331 3300025919 Ga0207657_10118301 Ga0207657_101183013 157
332 3300025920 Ga0207649_10193466 Ga0207649_101934662 157
333 3300025926 Ga0207659_10110951 Ga0207659_101109513 157
334 3300025933 Ga0207706_10006247 Ga0207706_100062474 157
335 3300025944 Ga0207661_10911308 Ga0207661_109113081 157
336 3300025945 Ga0207679_10471249 Ga0207679_104712492 157
337 3300025949 Ga0207667_10056234 Ga0207667_100562344 157
338 3300025960 Ga0207651_10210453 Ga0207651_102104532 157
339 3300025986 Ga0207658_11464018 Ga0207658_114640181 157
340 3300026041 Ga0207639_10184541 Ga0207639_101845412 157
341 3300026078 Ga0207702_10878119 Ga0207702_108781192 157
342 3300026088 Ga0207641_11335808 Ga0207641_113358081 157
343 3300026095 Ga0207676_10243860 Ga0207676_102438602 157
344 3300026095 Ga0207676_10257108 Ga0207676_102571082 157
345 3300026116 Ga0207674_10177020 Ga0207674_101770202 157
346 3300026116 Ga0207674_10308827 Ga0207674_103088272 157
347 3300026142 Ga0207698_10283439 Ga0207698_102834392 157
348 3300028381 Ga0268264_10005023 Ga0268264_1000502313 157
349 3300028800 Ga0265338_10014193 Ga0265338_100141935 157
350 3300031240 Ga0265320_10069354 Ga0265320_100693542 157
351 3300031911 Ga0307412_11537006 Ga0307412_115370061 157
352 3300037312 Ga0395899_0000002 Ga0395899_0000002_1305613_1306113 157
353 3300037312 Ga0395899_0072330 Ga0395899_0072330_427_903 157
354 3300037418 Ga0395900_0005426 Ga0395900_0005426_9200_9676 157
355 3300037471 Ga0395905_0006237 Ga0395905_0006237_9860_10336 157
356 3300037471 Ga0395905_0259434 Ga0395905_0259434_677_1153 157
357 3300037471 Ga0395905_0598979 Ga0395905_0598979_470_976 157
358 3300041451 Ga0451791_0703053 Ga0451791_0703053_509_991 157
359 3300045049 Ga0466959_1121709 Ga0466959_1121709_13_489 157
360 3300045976 Ga0466967_1233281 Ga0466967_1233281_55_531 157
361 3300046492 Ga0495585_0137308 Ga0495585_0137308_427_909 157
362 3300046660 Ga0495625_0031960 Ga0495625_0031960_739_1215 157
363 3300047472 Ga0495686_0030076 Ga0495686_0030076_803_1279 157
364 3300049580 Ga0501046_0000103 Ga0501046_0000103_38794_39288 157
365 3300053080 Ga0500635_0010879 Ga0500635_0010879_837_1313 157
366 3300053122 Ga0500608_028201 Ga0500608_028201_1590_2072 157
367 3300003320 rootH2_10021057 rootH2_100210578 158
368 3300005327 Ga0070658_10753882 Ga0070658_107538822 158
369 3300005548 Ga0070665_100006942 Ga0070665_1000069424 158
370 3300005577 Ga0068857_100107398 Ga0068857_1001073982 158
371 3300005614 Ga0068856_100020553 Ga0068856_1000205532 158
372 3300006844 Ga0075428_100011356 Ga0075428_10001135611 158
373 3300009093 Ga0105240_10017595 Ga0105240_100175954 158
374 3300009093 Ga0105240_11510709 Ga0105240_115107092 158
375 3300009094 Ga0111539_10073077 Ga0111539_100730773 158
376 3300010375 Ga0105239_10073017 Ga0105239_100730177 158
377 3300010375 Ga0105239_10188381 Ga0105239_101883814 158
378 3300025208 Ga0209436_101223 Ga0209436_1012234 158
379 3300025250 Ga0209026_1013628 Ga0209026_10136282 158
380 3300025284 Ga0209130_1000976 Ga0209130_100097612 158
381 3300025302 Ga0207426_1000233 Ga0207426_100023318 158
382 3300025904 Ga0207647_10008145 Ga0207647_100081454 158
383 3300025909 Ga0207705_10544828 Ga0207705_105448282 158
384 3300025913 Ga0207695_10022088 Ga0207695_100220883 158
385 3300025913 Ga0207695_11012520 Ga0207695_110125201 158
386 3300026078 Ga0207702_10054908 Ga0207702_100549082 158
387 3300026116 Ga0207674_10661551 Ga0207674_106615512 158
388 3300028379 Ga0268266_10042782 Ga0268266_100427821 158
389 3300037418 Ga0395900_0986217 Ga0395900_0986217_196_675 158
390 3300037471 Ga0395905_0170697 Ga0395905_0170697_1263_1742 158
391 3300044658 Ga0466972_0073142 Ga0466972_0073142_184_669 158
392 3300044712 Ga0453684_0096941 Ga0453684_0096941_1766_2245 158
393 3300044735 Ga0466968_0088057 Ga0466968_0088057_57_542 158
394 3300044842 Ga0466957_0228546 Ga0466957_0228546_427_912 158
395 3300044901 Ga0466960_0267213 Ga0466960_0267213_255_740 158
396 3300045049 Ga0466959_0009583 Ga0466959_0009583_1233_1718 158
397 3300049822 Ga0501035_0017901 Ga0501035_0017901_2284_2763 158
398 3300050509 nmdc:mga0qj67_365061_c1 nmdc:mga0qj67_365061_c1_82_558 158
399 3300050511 nmdc:mga08y16_111765_c1 nmdc:mga08y16_111765_c1_1527_2003 158
400 3300001979 JGI24740J21852_10016410 JGI24740J21852_100164104 159
401 3300001979 JGI24740J21852_10017665 JGI24740J21852_100176653 159
402 3300003215 JGI25153J46596_10058865 JGI25153J46596_100588652 159
403 3300003215 JGI25153J46596_10066463 JGI25153J46596_100664632 159
404 3300003320 rootH2_10154995 rootH2_101549954 159
405 3300003354 JGI25160J50197_1007750 JGI25160J50197_10077501 159
406 3300003771 Ga0055526_1015271 Ga0055526_10152713 159
407 3300003771 Ga0055526_1017392 Ga0055526_10173923 159
408 3300003790 Ga0055528_1000600 Ga0055528_100060016 159
409 3300003791 Ga0055530_10011881 Ga0055530_100118811 159
410 3300004625 Ga0055543_1032763 Ga0055543_10327631 159
411 3300005262 Ga0065165_1000100 Ga0065165_1000100112 159
412 3300005331 Ga0070670_100259120 Ga0070670_1002591202 159
413 3300005354 Ga0070675_100176988 Ga0070675_1001769882 159
414 3300005356 Ga0070674_100157872 Ga0070674_1001578721 159
415 3300005457 Ga0070662_100412540 Ga0070662_1004125402 159
416 3300005457 Ga0070662_100698408 Ga0070662_1006984082 159
417 3300005459 Ga0068867_101079096 Ga0068867_1010790961 159
418 3300005834 Ga0068851_10434717 Ga0068851_104347172 159
419 3300006195 Ga0075366_10193559 Ga0075366_101935592 159
420 3300009174 Ga0105241_10398170 Ga0105241_103981702 159
421 3300009545 Ga0105237_10018441 Ga0105237_100184414 159
422 3300010375 Ga0105239_10081977 Ga0105239_100819772 159
423 3300013102 Ga0157371_10373621 Ga0157371_103736212 159
424 3300013308 Ga0157375_11265308 Ga0157375_112653082 159
425 3300025273 Ga0209673_1000049 Ga0209673_100004928 159
426 3300025295 Ga0209564_1005217 Ga0209564_10052177 159
427 3300025295 Ga0209564_1007602 Ga0209564_10076024 159
428 3300025295 Ga0209564_1081662 Ga0209564_10816621 159
429 3300025297 Ga0209758_1004184 Ga0209758_10041844 159
430 3300025297 Ga0209758_1008253 Ga0209758_10082535 159
431 3300025298 Ga0209050_1000272 Ga0209050_100027253 159
432 3300025302 Ga0207426_1001865 Ga0207426_10018659 159
433 3300025302 Ga0207426_1047250 Ga0207426_10472502 159
434 3300025304 Ga0209257_1002478 Ga0209257_100247814 159
435 3300025923 Ga0207681_10606889 Ga0207681_106068892 159
436 3300025926 Ga0207659_11255596 Ga0207659_112555962 159
437 3300025937 Ga0207669_10167058 Ga0207669_101670582 159
438 3300025940 Ga0207691_10205477 Ga0207691_102054772 159
439 3300025940 Ga0207691_11036514 Ga0207691_110365141 159
440 3300026095 Ga0207676_10389267 Ga0207676_103892672 159
441 3300041451 Ga0451791_0969218 Ga0451791_0969218_142_630 159
442 3300041997 Ga0439431_0000225 Ga0439431_0000225_7176_7664 159
443 3300044658 Ga0466972_0483093 Ga0466972_0483093_34_525 159
444 3300044683 Ga0466965_0104846 Ga0466965_0104846_162_653 159
445 3300050493 nmdc:mga0k408_13994_c1 nmdc:mga0k408_13994_c1_853_1344 159
446 3300053131 Ga0500652_002298 Ga0500652_002298_3124_3615 159
447 2162886007 SwRhRL2b_contig_2249581 SwRhRL2b_0373.00002530 161
448 3300005289 Ga0065704_10001934 Ga0065704_100019343 161
449 3300021377 Ga0213874_10169891 Ga0213874_101698911 161
450 3300026118 Ga0207675_100375005 Ga0207675_1003750052 161
451 3300044656 Ga0466969_0140681 Ga0466969_0140681_194_697 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01967

MoaC

MoaC family

30

166

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pyd-assembly1.cif.gz_A moac in complex with cpmp crystallized in space group p212121 0.8602 17 158
1eks-assembly1.cif.gz_A asp128ala variant of moac protein from e. coli 0.8598 17 158
1ekr-assembly1.cif.gz_A moac protein from e. coli 0.8587 13 158
4pyd-assembly1.cif.gz_D moac in complex with cpmp crystallized in space group p212121 0.8577 7 153
4pyd-assembly1.cif.gz_F moac in complex with cpmp crystallized in space group p212121 0.8559 26 147
ID Description Score Start End Superfamily
af_P9WJR7_13_167_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.8736 7 155 3.30.70.640
af_Q20624_440_595_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.8605 5 159 3.30.70.640
af_B4FJH5_64_220_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.8591 7 153 3.30.70.640
1ekrA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.8587 13 158 3.30.70.640
af_Q54NM6_454_628_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.8567 4 154 3.30.70.640
ID Description Score Start End GO Terms
AF-A0A522H4W9-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.8971 3 157 GO:0006777
GO:0061798
GO:0061799
AF-A0A522NAT1-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.8947 6 157 GO:0006777
GO:0061798
GO:0061799
AF-A0A2E5FHE4-F1-model_v4 Cyclic pyranopterin monophosphate synthase MoaC 0.8938 1 151 GO:0006777
GO:0061799
AF-A0A2N0FR25-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.8937 4 158 GO:0006777
GO:0061799
AF-A0A1I1N7J3-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.8931 17 158 GO:0006777
GO:0061799

Feature Viewer

pLDDT pTM Quality
84.24 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map