F446682

General Info

Members Datasets Scaffolds Average Seq Length
450 210 900 198

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0398403|Ga0501039_0398403_73_738
Length 214
Sequence VTSPPTSRLPTRTKPKLRKPVAVAITGGIGAGKSEALYAFQKAGAATVSSDEIVHHLLRTDPEVKERMVRELGEGILGADGVIDRRRVAEVVFADRSKLDFLEGLLHPLVAREYLAWREQLAALPNPPEVCVTEVPLLYETGGDKRFDKVVVITAPAKLREQRRRVARDDRDERLLPDREKVKRADFAYVNTGTLEDLDEWVAGVMAELTKVAA

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
119 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
120 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
128 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
129 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
130 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
131 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
132 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
133 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
134 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
135 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
136 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
137 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
138 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
139 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
149 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
153 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
207 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
208 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 5.78
Rhizosphere 93.33
Stem 0
Stem Tuber 0
Unclassified 8.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0398403 3300049575 Bacteria 1081
2 Ga0070683_100146938 3300005329 Bacteria 2234
3 Ga0070683_100665935 3300005329 Bacteria 997
4 Ga0070670_100276997 3300005331 Bacteria 1465
5 Ga0070670_100322871 3300005331 Bacteria 1353
6 Ga0068869_100060694 3300005334 Bacteria 2772
7 Ga0070680_100073525 3300005336 Bacteria 2811
8 Ga0070680_100440468 3300005336 Bacteria 1112
9 Ga0070682_100024730 3300005337 Bacteria 3577
10 Ga0070682_100040771 3300005337 Bacteria 2858
11 Ga0068868_100102671 3300005338 Bacteria 2316
12 Ga0070689_100219895 3300005340 Bacteria 1558
13 Ga0070661_100143810 3300005344 Bacteria 1799
14 Ga0070692_10070783 3300005345 Bacteria 1857
15 Ga0070668_100059901 3300005347 Bacteria 2947
16 Ga0070675_100106555 3300005354 Bacteria 2366
17 Ga0070675_100251065 3300005354 Bacteria 1548
18 Ga0070675_100615142 3300005354 Bacteria 986
19 Ga0070671_100057977 3300005355 Bacteria 3223
20 Ga0070674_100181116 3300005356 Bacteria 1614
21 Ga0070674_100194643 3300005356 Bacteria 1561
22 Ga0070673_100095402 3300005364 Bacteria 2440
23 Ga0070673_100309945 3300005364 Bacteria 1392
24 Ga0070688_100034937 3300005365 Bacteria 3050
25 Ga0070659_100220740 3300005366 Bacteria 1564
26 Ga0070667_100166261 3300005367 Bacteria 1946
27 Ga0070701_10023938 3300005438 Unclassified 2948
28 Ga0070700_100027379 3300005441 Bacteria 3379
29 Ga0070708_100251422 3300005445 Unclassified 1661
30 Ga0070678_100235714 3300005456 Bacteria 1528
31 Ga0070678_100501317 3300005456 Bacteria 1071
32 Ga0070678_100690125 3300005456 Unclassified 919
33 Ga0070678_100707239 3300005456 Unclassified 908
34 Ga0070662_100121204 3300005457 Bacteria 2005
35 Ga0070662_100631996 3300005457 Unclassified 902
36 Ga0070681_10023930 3300005458 Bacteria 6149
37 Ga0070681_10639187 3300005458 Bacteria 979
38 Ga0068867_100119415 3300005459 Bacteria 2035
39 Ga0068867_100249497 3300005459 Bacteria 1443
40 Ga0070685_10030715 3300005466 Bacteria 2996
41 Ga0070685_10124483 3300005466 Bacteria 1605
42 Ga0070706_100412628 3300005467 Unclassified 1257
43 Ga0070707_100054704 3300005468 Unclassified 3827
44 Ga0070699_100556686 3300005518 Bacteria 1044
45 Ga0070679_100040736 3300005530 Bacteria 4621
46 Ga0070679_100149121 3300005530 Bacteria 2316
47 Ga0070684_100113034 3300005535 Bacteria 2436
48 Ga0070684_100130655 3300005535 Bacteria 2265
49 Ga0070684_100215234 3300005535 Unclassified 1752
50 Ga0068853_100353795 3300005539 Bacteria 1367
51 Ga0070672_100048511 3300005543 Bacteria 3300
52 Ga0070672_100072055 3300005543 Bacteria 2750
53 Ga0070672_100811011 3300005543 Bacteria 824
54 Ga0070686_100065921 3300005544 Bacteria 2354
55 Ga0070696_100127105 3300005546 Unclassified 1851
56 Ga0070696_100697932 3300005546 Bacteria 827
57 Ga0070693_100064971 3300005547 Bacteria 2132
58 Ga0070693_100520539 3300005547 Bacteria 847
59 Ga0070665_100358959 3300005548 Unclassified 1463
60 Ga0070704_100019459 3300005549 Bacteria 4362
61 Ga0070704_100286671 3300005549 Bacteria 1367
62 Ga0070664_100265679 3300005564 Bacteria 1544
63 Ga0068854_100118256 3300005578 Bacteria 2008
64 Ga0068856_100246555 3300005614 Bacteria 1802
65 Ga0068856_100656197 3300005614 Bacteria 1070
66 Ga0070702_100040454 3300005615 Bacteria 2608
67 Ga0070702_100235959 3300005615 Bacteria 1232
68 Ga0068852_100161515 3300005616 Bacteria 2092
69 Ga0068852_100412339 3300005616 Bacteria 1331
70 Ga0068859_100642663 3300005617 Bacteria 1153
71 Ga0068864_100070994 3300005618 Bacteria 3031
72 Ga0068864_100695252 3300005618 Bacteria 993
73 Ga0068866_10380487 3300005718 Bacteria 905
74 Ga0068866_10446655 3300005718 Bacteria 845
75 Ga0068861_100175457 3300005719 Bacteria 1780
76 Ga0068861_100909586 3300005719 Bacteria 834
77 Ga0068860_100119810 3300005843 Bacteria 2520
78 Ga0081455_10002211 3300005937 Bacteria 23173
79 Ga0081455_10460616 3300005937 Bacteria 866
80 Ga0081538_10074765 3300005981 Bacteria 1843
81 Ga0081539_10000452 3300005985 Bacteria 87416
82 Ga0075365_10213141 3300006038 Bacteria 1354
83 Ga0075432_10100397 3300006058 Bacteria 1069
84 Ga0075428_100170943 3300006844 Bacteria 2356
85 Ga0075428_100913547 3300006844 Bacteria 931
86 Ga0075434_100350854 3300006871 Unclassified 1496
87 Ga0075429_100179195 3300006880 Unclassified 1857
88 Ga0097620_100642640 3300006931 Bacteria 1153
89 Ga0075435_100072824 3300007076 Bacteria 2807
90 Ga0111539_10011207 3300009094 Bacteria 11268
91 Ga0111539_10232190 3300009094 Bacteria 2148
92 Ga0105245_10188835 3300009098 Bacteria 1973
93 Ga0105245_10526020 3300009098 Bacteria 1202
94 Ga0105247_10022199 3300009101 Bacteria 3821
95 Ga0114129_10253542 3300009147 Bacteria 2361
96 Ga0114129_10630216 3300009147 Bacteria 1386
97 Ga0114129_10854287 3300009147 Bacteria 1157
98 Ga0105243_10050737 3300009148 Bacteria 3279
99 Ga0105243_10146026 3300009148 Bacteria 2024
100 Ga0105243_10377505 3300009148 Bacteria 1310
101 Ga0105243_10435364 3300009148 Bacteria 1226
102 Ga0105243_10806209 3300009148 Bacteria 926
103 Ga0105242_10018030 3300009176 Bacteria 5513
104 Ga0105242_10465419 3300009176 Bacteria 1195
105 Ga0105248_10044555 3300009177 Bacteria 4976
106 Ga0105248_10080349 3300009177 Bacteria 3665
107 Ga0105248_11410530 3300009177 Unclassified 788
108 Ga0105249_10408402 3300009553 Bacteria 1389
109 Ga0105249_10654096 3300009553 Bacteria 1109
110 Ga0105249_10992325 3300009553 Bacteria 908
111 Ga0105239_10020046 3300010375 Bacteria 7378
112 Ga0105239_10108553 3300010375 Bacteria 3075
113 Ga0105239_10160358 3300010375 Bacteria 2512
114 Ga0105246_10030873 3300011119 Bacteria 3543
115 Ga0157373_10197905 3300013100 Bacteria 1417
116 Ga0157371_10101495 3300013102 Unclassified 2041
117 Ga0157369_10051985 3300013105 Bacteria 4433
118 Ga0157374_10085438 3300013296 Bacteria 3000
119 Ga0157372_10018309 3300013307 Bacteria 7529
120 Ga0157372_10306497 3300013307 Bacteria 1848
121 Ga0157372_10545361 3300013307 Bacteria 1352
122 Ga0157375_10974255 3300013308 Bacteria 989
123 Ga0163163_10617188 3300014325 Bacteria 1148
124 Ga0163163_10889036 3300014325 Bacteria 954
125 Ga0157380_10117649 3300014326 Bacteria 2245
126 Ga0157380_10337691 3300014326 Bacteria 1404
127 Ga0157380_10353580 3300014326 Bacteria 1376
128 Ga0157380_10546894 3300014326 Bacteria 1135
129 Ga0157377_10059236 3300014745 Bacteria 2182
130 Ga0157377_10075197 3300014745 Bacteria 1961
131 Ga0157377_10375964 3300014745 Bacteria 960
132 Ga0157376_10126755 3300014969 Bacteria 2272
133 Ga0157376_10131873 3300014969 Bacteria 2231
134 Ga0163161_10253401 3300017792 Bacteria 1373
135 Ga0206356_10900369 3300020070 Bacteria 963
136 Ga0207656_10193127 3300025321 Bacteria 981
137 Ga0207710_10015672 3300025900 Bacteria 3206
138 Ga0207688_10050258 3300025901 Bacteria 2333
139 Ga0207688_10081813 3300025901 Bacteria 1845
140 Ga0207688_10228387 3300025901 Bacteria 1123
141 Ga0207643_10049756 3300025908 Bacteria 2375
142 Ga0207643_10126374 3300025908 Bacteria 1518
143 Ga0207707_10018451 3300025912 Bacteria 6083
144 Ga0207707_10635219 3300025912 Bacteria 901
145 Ga0207660_10061990 3300025917 Bacteria 2693
146 Ga0207649_10026934 3300025920 Bacteria 3368
147 Ga0207652_10025343 3300025921 Bacteria 4929
148 Ga0207694_10450356 3300025924 Bacteria 1074
149 Ga0207687_10083098 3300025927 Bacteria 2318
150 Ga0207687_10164374 3300025927 Bacteria 1706
151 Ga0207690_10658476 3300025932 Bacteria 858
152 Ga0207706_10254395 3300025933 Bacteria 1534
153 Ga0207686_10351196 3300025934 Bacteria 1110
154 Ga0207709_10325284 3300025935 Bacteria 1152
155 Ga0207670_10395205 3300025936 Bacteria 1104
156 Ga0207669_10104560 3300025937 Bacteria 1881
157 Ga0207669_10198904 3300025937 Bacteria 1453
158 Ga0207691_10063125 3300025940 Bacteria 3360
159 Ga0207691_10203639 3300025940 Bacteria 1721
160 Ga0207691_10252077 3300025940 Bacteria 1523
161 Ga0207711_10120643 3300025941 Bacteria 2340
162 Ga0207711_11068601 3300025941 Unclassified 748
163 Ga0207689_10387066 3300025942 Bacteria 1165
164 Ga0207661_10000468 3300025944 Bacteria 26119
165 Ga0207661_10173174 3300025944 Bacteria 1880
166 Ga0207661_10190989 3300025944 Bacteria 1795
167 Ga0207679_10016516 3300025945 Bacteria 4905
168 Ga0207667_10337174 3300025949 Bacteria 1539
169 Ga0207712_10362533 3300025961 Bacteria 1208
170 Ga0207640_10102953 3300025981 Bacteria 2006
171 Ga0207677_10079297 3300026023 Bacteria 2348
172 Ga0207677_10298476 3300026023 Bacteria 1330
173 Ga0207639_10844541 3300026041 Bacteria 855
174 Ga0207708_10036957 3300026075 Bacteria 3719
175 Ga0207708_10429262 3300026075 Bacteria 1097
176 Ga0207702_10291629 3300026078 Bacteria 1546
177 Ga0207648_10111448 3300026089 Bacteria 2402
178 Ga0207648_10209553 3300026089 Bacteria 1730
179 Ga0207648_10304965 3300026089 Bacteria 1429
180 Ga0207676_10587773 3300026095 Bacteria 1068
181 Ga0207683_10035101 3300026121 Bacteria 4361
182 Ga0207683_10387520 3300026121 Bacteria 1285
183 Ga0207683_10707939 3300026121 Unclassified 934
184 Ga0207698_10147532 3300026142 Bacteria 2037
185 Ga0207698_10611824 3300026142 Bacteria 1075
186 Ga0207698_10980757 3300026142 Bacteria 855
187 Ga0207428_10089118 3300027907 Bacteria 2398
188 Ga0207428_10219733 3300027907 Bacteria 1425
189 Ga0268264_10078134 3300028381 Bacteria 2821
190 Ga0307409_100487794 3300031995 Bacteria 1197
191 Ga0307409_100506002 3300031995 Bacteria 1177
192 Ga0307409_100579867 3300031995 Bacteria 1105
193 Ga0307416_100009670 3300032002 Bacteria 6328
194 Ga0307416_101046305 3300032002 Bacteria 920
195 Ga0307411_11105140 3300032005 Bacteria 715
196 Ga0373952_0023387 3300035092 Bacteria 1320
197 Ga0373942_0043721 3300035207 Bacteria 1232
198 Ga0373962_0027332 3300035242 Bacteria 1543
199 Ga0395900_0107549 3300037418 Bacteria 2865
200 Ga0395900_0372478 3300037418 Unclassified 1397
201 Ga0395900_0497246 3300037418 Bacteria 1170
202 Ga0395898_0038711 3300037466 Bacteria 4724
203 Ga0395898_0759866 3300037466 Bacteria 910
204 Ga0395905_0082727 3300037471 Bacteria 3008
205 Ga0395905_0156382 3300037471 Bacteria 2144
206 Ga0436364_0671991 3300037853 Bacteria 1810
207 Ga0395901_0008098 3300038443 Bacteria 10615
208 Ga0395901_0009482 3300038443 Bacteria 9876
209 Ga0436365_0672651 3300039437 Bacteria 868
210 Ga0439438_040769 3300041405 Unclassified 1206
211 Ga0439439_0007010 3300041406 Bacteria 2625
212 Ga0439461_0012405 3300041410 Bacteria 1594
213 Ga0439461_0038011 3300041410 Unclassified 1030
214 Ga0439431_0038024 3300041997 Bacteria 1217
215 Ga0439433_0062806 3300041999 Bacteria 887
216 Ga0439442_017842 3300042002 Bacteria 1466
217 Ga0439452_025044 3300042010 Bacteria 1518
218 Ga0439462_0024802 3300042015 Bacteria 1577
219 Ga0450920_012607 3300042122 Bacteria 1587
220 Ga0450920_036152 3300042122 Bacteria 979
221 Ga0450906_037811 3300042145 Bacteria 852
222 Ga0450907_006682 3300042146 Bacteria 1927
223 Ga0450907_040951 3300042146 Unclassified 793
224 Ga0439446_0000714 3300042156 Bacteria 6944
225 Ga0439446_0002539 3300042156 Bacteria 4391
226 Ga0439446_0059791 3300042156 Bacteria 1150
227 Ga0439434_0011576 3300042435 Bacteria 2610
228 Ga0439434_0093578 3300042435 Unclassified 963
229 Ga0466966_0031192 3300044684 Bacteria 3457
230 Ga0466971_0027613 3300044719 Bacteria 2543
231 Ga0466970_0033910 3300044765 Bacteria 2700
232 Ga0466957_0057167 3300044842 Bacteria 2387
233 Ga0466959_0027980 3300045049 Bacteria 4180
234 Ga0451576_0513661 3300045051 Bacteria 1259
235 Ga0466958_0013733 3300045836 Bacteria 4615
236 Ga0495594_0458997 3300046499 Unclassified 724
237 Ga0495596_0117451 3300046500 Unclassified 1033
238 Ga0495607_0151835 3300046501 Bacteria 1185
239 Ga0495631_0192945 3300046518 Bacteria 872
240 Ga0495656_0065494 3300046615 Bacteria 1598
241 Ga0495661_0357653 3300046665 Unclassified 718
242 Ga0495588_0307599 3300046674 Bacteria 834
243 Ga0495674_0248323 3300047319 Bacteria 1465
244 Ga0496100_0198526 3300048903 Bacteria 1461
245 Ga0496102_0158000 3300048905 Bacteria 2132
246 Ga0496103_0259638 3300048906 Unclassified 1118
247 Ga0496104_0098497 3300048907 Bacteria 2799
248 Ga0496104_0222223 3300048907 Bacteria 1801
249 Ga0496105_0030967 3300048908 Bacteria 4386
250 Ga0496105_0148287 3300048908 Bacteria 1929
251 Ga0496107_0591620 3300048910 Unclassified 820
252 Ga0496108_0016307 3300048911 Bacteria 6060
253 Ga0496108_0062128 3300048911 Bacteria 3145
254 Ga0496108_0065614 3300048911 Bacteria 3060
255 Ga0496109_0000789 3300048912 Bacteria 26350
256 Ga0496109_0209647 3300048912 Bacteria 1832
257 Ga0496109_0300321 3300048912 Bacteria 1514
258 Ga0496109_0598394 3300048912 Unclassified 1039
259 Ga0496110_0001213 3300048913 Bacteria 18360
260 Ga0496110_0006394 3300048913 Bacteria 9322
261 Ga0496110_0317867 3300048913 Bacteria 1418
262 Ga0496111_0001732 3300048914 Bacteria 12767
263 Ga0496111_0071030 3300048914 Bacteria 2533
264 Ga0496111_0211961 3300048914 Unclassified 1439
265 Ga0496112_0126472 3300048915 Bacteria 2526
266 Ga0496113_0027794 3300048916 Bacteria 4060
267 Ga0496113_0259760 3300048916 Bacteria 1387
268 Ga0496114_0100644 3300048917 Bacteria 2466
269 Ga0496114_0183250 3300048917 Bacteria 1829
270 Ga0501031_0028777 3300049568 Bacteria 3621
271 Ga0501031_0029197 3300049568 Bacteria 3597
272 Ga0501031_0033480 3300049568 Bacteria 3352
273 Ga0501031_0119659 3300049568 Bacteria 1720
274 Ga0501032_0004462 3300049569 Bacteria 10550
275 Ga0501032_0064168 3300049569 Bacteria 2459
276 Ga0501032_0158896 3300049569 Bacteria 1484
277 Ga0501034_0603425 3300049571 Bacteria 1003
278 Ga0501036_0001711 3300049572 Bacteria 17046
279 Ga0501036_0020996 3300049572 Bacteria 5483
280 Ga0501036_0051750 3300049572 Bacteria 3478
281 Ga0501036_0070515 3300049572 Bacteria 2955
282 Ga0501036_0282923 3300049572 Unclassified 1388
283 Ga0501036_0380449 3300049572 Bacteria 1178
284 Ga0501037_0010385 3300049573 Bacteria 6831
285 Ga0501037_0238219 3300049573 Bacteria 1276
286 Ga0501038_0004943 3300049574 Bacteria 12379
287 Ga0501038_0090380 3300049574 Bacteria 2566
288 Ga0501038_0145738 3300049574 Bacteria 1933
289 Ga0501038_0146116 3300049574 Bacteria 1930
290 Ga0501039_0023342 3300049575 Bacteria 4748
291 Ga0501039_0058788 3300049575 Bacteria 2978
292 Ga0501039_0061588 3300049575 Bacteria 2906
293 Ga0501039_0070787 3300049575 Bacteria 2709
294 Ga0501040_0001583 3300049576 Bacteria 14498
295 Ga0501040_0004868 3300049576 Bacteria 8695
296 Ga0501040_0005044 3300049576 Bacteria 8531
297 Ga0501040_0048164 3300049576 Bacteria 2912
298 Ga0501040_0076552 3300049576 Bacteria 2313
299 Ga0501040_0870264 3300049576 Bacteria 652
300 Ga0501041_0001552 3300049577 Bacteria 12785
301 Ga0501041_0002924 3300049577 Bacteria 9797
302 Ga0501041_0010834 3300049577 Bacteria 5378
303 Ga0501041_0028584 3300049577 Bacteria 3363
304 Ga0501041_0032775 3300049577 Bacteria 3140
305 Ga0501041_0122495 3300049577 Bacteria 1617
306 Ga0501042_0003779 3300049578 Bacteria 9571
307 Ga0501042_0008861 3300049578 Bacteria 6670
308 Ga0501042_0008961 3300049578 Bacteria 6641
309 Ga0501042_0040602 3300049578 Bacteria 3308
310 Ga0501042_0151323 3300049578 Bacteria 1673
311 Ga0501042_0301620 3300049578 Unclassified 1157
312 Ga0501042_0428775 3300049578 Bacteria 958
313 Ga0501043_0006002 3300049579 Bacteria 9765
314 Ga0501043_0230567 3300049579 Bacteria 1430
315 Ga0501046_0007692 3300049580 Bacteria 9448
316 Ga0501046_0031439 3300049580 Bacteria 4302
317 Ga0501046_0069100 3300049580 Bacteria 2749
318 Ga0501046_0095849 3300049580 Bacteria 2279
319 Ga0501047_0215535 3300049581 Bacteria 1777
320 Ga0501047_0708583 3300049581 Unclassified 824
321 Ga0501048_0013350 3300049582 Bacteria 6096
322 Ga0501048_0025436 3300049582 Bacteria 4313
323 Ga0501048_0036341 3300049582 Bacteria 3540
324 Ga0501048_0054427 3300049582 Bacteria 2842
325 Ga0501048_0056232 3300049582 Bacteria 2792
326 Ga0501048_0090759 3300049582 Bacteria 2155
327 Ga0501067_0135232 3300049583 Bacteria 1372
328 Ga0501068_0004275 3300049584 Bacteria 7755
329 Ga0501068_0018935 3300049584 Bacteria 3991
330 Ga0501068_0158113 3300049584 Bacteria 1427
331 Ga0501069_0004516 3300049585 Bacteria 7187
332 Ga0501069_0006925 3300049585 Bacteria 5927
333 Ga0501069_0071023 3300049585 Bacteria 1951
334 Ga0501069_0140938 3300049585 Unclassified 1383
335 Ga0501069_0162949 3300049585 Bacteria 1284
336 Ga0501069_0278611 3300049585 Bacteria 978
337 Ga0501070_0061379 3300049586 Bacteria 3114
338 Ga0501070_0066899 3300049586 Bacteria 2976
339 Ga0501070_0367854 3300049586 Unclassified 1166
340 Ga0501071_0019983 3300049587 Bacteria 4652
341 Ga0501071_0045209 3300049587 Bacteria 3160
342 Ga0501071_0109123 3300049587 Bacteria 2044
343 Ga0501071_0112235 3300049587 Bacteria 2015
344 Ga0501071_0166895 3300049587 Bacteria 1647
345 Ga0501071_0190608 3300049587 Bacteria 1538
346 Ga0501071_0216291 3300049587 Bacteria 1442
347 Ga0501071_0372928 3300049587 Bacteria 1087
348 Ga0501071_0596954 3300049587 Bacteria 849
349 Ga0501072_0000140 3300049588 Bacteria 54153
350 Ga0501072_0008683 3300049588 Bacteria 7713
351 Ga0501072_0011799 3300049588 Bacteria 6674
352 Ga0501072_0014420 3300049588 Bacteria 6057
353 Ga0501072_0119158 3300049588 Bacteria 2103
354 Ga0501072_0119334 3300049588 Bacteria 2101
355 Ga0501073_0011110 3300049589 Bacteria 6587
356 Ga0501073_0053807 3300049589 Bacteria 2818
357 Ga0501073_0300179 3300049589 Unclassified 1108
358 Ga0501073_0377593 3300049589 Bacteria 979
359 Ga0501074_0001713 3300049590 Bacteria 14966
360 Ga0501074_0006539 3300049590 Bacteria 8419
361 Ga0501074_0009266 3300049590 Bacteria 7150
362 Ga0501074_0077102 3300049590 Bacteria 2392
363 Ga0501074_0100778 3300049590 Bacteria 2067
364 Ga0501074_0448662 3300049590 Bacteria 915
365 Ga0501075_0001917 3300049591 Bacteria 13721
366 Ga0501075_0009357 3300049591 Bacteria 6853
367 Ga0501075_0015984 3300049591 Bacteria 5398
368 Ga0501075_0016739 3300049591 Bacteria 5288
369 Ga0501075_0020543 3300049591 Bacteria 4806
370 Ga0501075_0050013 3300049591 Bacteria 3141
371 Ga0501075_0126852 3300049591 Bacteria 1943
372 Ga0501076_0005291 3300049592 Bacteria 9254
373 Ga0501076_0034415 3300049592 Bacteria 3959
374 Ga0501076_0046827 3300049592 Bacteria 3417
375 Ga0501076_0076492 3300049592 Bacteria 2684
376 Ga0501076_0102160 3300049592 Bacteria 2311
377 Ga0501076_0116224 3300049592 Bacteria 2165
378 Ga0501076_0665176 3300049592 Unclassified 859
379 Ga0501076_0712344 3300049592 Bacteria 828
380 Ga0501077_0005451 3300049593 Bacteria 7744
381 Ga0501077_0005602 3300049593 Bacteria 7647
382 Ga0501077_0012396 3300049593 Bacteria 5340
383 Ga0501077_0037504 3300049593 Bacteria 3086
384 Ga0501077_0098363 3300049593 Bacteria 1854
385 Ga0501079_0001062 3300049741 Bacteria 19093
386 Ga0501079_0028148 3300049741 Bacteria 4311
387 Ga0501079_0110827 3300049741 Bacteria 2132
388 Ga0501079_0126039 3300049741 Bacteria 1992
389 Ga0501079_0143027 3300049741 Bacteria 1863
390 Ga0501079_0160883 3300049741 Bacteria 1751
391 Ga0501079_0213695 3300049741 Bacteria 1506
392 Ga0501080_0025320 3300049742 Bacteria 5505
393 Ga0501080_0039990 3300049742 Bacteria 4376
394 Ga0501080_0112499 3300049742 Bacteria 2524
395 Ga0501080_0128960 3300049742 Bacteria 2341
396 Ga0501080_0459704 3300049742 Bacteria 1140
397 Ga0501081_0003647 3300049743 Bacteria 9860
398 Ga0501081_0006032 3300049743 Bacteria 7844
399 Ga0501081_0041719 3300049743 Bacteria 3143
400 Ga0501081_0146849 3300049743 Bacteria 1692
401 Ga0501081_0250417 3300049743 Bacteria 1293
402 Ga0501081_0519342 3300049743 Bacteria 888
403 Ga0501035_0002024 3300049822 Bacteria 20202
404 Ga0501035_0020893 3300049822 Bacteria 6016
405 Ga0501035_0079845 3300049822 Bacteria 2889
406 Ga0501035_0098477 3300049822 Bacteria 2567
407 Ga0501035_0337036 3300049822 Bacteria 1264
408 Ga0501044_0227044 3300049823 Bacteria 1816
409 Ga0501045_0011169 3300049824 Bacteria 6295
410 Ga0501045_0021928 3300049824 Bacteria 4570
411 Ga0501045_0024448 3300049824 Bacteria 4337
412 Ga0501045_0057476 3300049824 Bacteria 2846
413 Ga0501045_0102980 3300049824 Bacteria 2114
414 Ga0501045_0131797 3300049824 Bacteria 1858
415 Ga0501045_0330589 3300049824 Bacteria 1134
416 nmdc:mga00v17_429421_c1 3300050491 Bacteria 858
417 nmdc:mga05p37_201189_c1 3300050507 Bacteria 2412
418 nmdc:mga05p37_68657_c1 3300050507 Bacteria 4359
419 nmdc:mga09592_172866_c1 3300050508 Unclassified 1868
420 nmdc:mga08y16_217342_c1 3300050511 Bacteria 1979
421 nmdc:mga08y16_355676_c1 3300050511 Unclassified 1504
422 nmdc:mga08y16_62036_c1 3300050511 Bacteria 3904
423 nmdc:mga0n895_938956_c1 3300050512 Bacteria 849
424 nmdc:mga0rr50_182461_c1 3300050513 Bacteria 1716
425 nmdc:mga0a205_699082_c1 3300050515 Bacteria 864
426 nmdc:mga0a205_846554_c1 3300050515 Bacteria 762
427 Ga0501084_0001484 3300054114 Bacteria 18645
428 Ga0501084_0015272 3300054114 Bacteria 6367
429 Ga0501084_0042707 3300054114 Bacteria 3792
430 Ga0501084_0055038 3300054114 Bacteria 3328
431 Ga0501084_0131711 3300054114 Bacteria 2105
432 Ga0501084_0158720 3300054114 Bacteria 1908
433 Ga0501084_0168859 3300054114 Bacteria 1846
434 Ga0501084_0358950 3300054114 Bacteria 1231
435 Ga0501084_0429657 3300054114 Bacteria 1116
436 Ga0501084_0825069 3300054114 Bacteria 781
437 Ga0501084_1053419 3300054114 Bacteria 683
438 Ga0590071_007603 3300059421 Bacteria 2564
439 Ga0590075_005946 3300059424 Bacteria 2887
440 Ga0590077_022998 3300059426 Bacteria 1332
441 Ga0501082_0004124 3300060353 Bacteria 12695
442 Ga0501082_0033952 3300060353 Bacteria 4400
443 Ga0501082_0054718 3300060353 Bacteria 3439
444 Ga0501082_0063203 3300060353 Bacteria 3187
445 Ga0501082_0116496 3300060353 Bacteria 2314
446 Ga0501082_0193997 3300060353 Bacteria 1766
447 Ga0501082_0806917 3300060353 Bacteria 821
448 Ga0530510_0004717 3300061734 Bacteria 9432
449 Ga0530510_0235101 3300061734 Bacteria 1363
450 Ga0530510_0242781 3300061734 Bacteria 1341
451 Ga0501039_0398403
452 Ga0070683_100146938
453 Ga0070683_100665935
454 Ga0070670_100276997
455 Ga0070670_100322871
456 Ga0068869_100060694
457 Ga0070680_100073525
458 Ga0070680_100440468
459 Ga0070682_100024730
460 Ga0070682_100040771
461 Ga0068868_100102671
462 Ga0070689_100219895
463 Ga0070661_100143810
464 Ga0070692_10070783
465 Ga0070668_100059901
466 Ga0070675_100106555
467 Ga0070675_100251065
468 Ga0070675_100615142
469 Ga0070671_100057977
470 Ga0070674_100181116
471 Ga0070674_100194643
472 Ga0070673_100095402
473 Ga0070673_100309945
474 Ga0070688_100034937
475 Ga0070659_100220740
476 Ga0070667_100166261
477 Ga0070701_10023938
478 Ga0070700_100027379
479 Ga0070708_100251422
480 Ga0070678_100235714
481 Ga0070678_100501317
482 Ga0070678_100690125
483 Ga0070678_100707239
484 Ga0070662_100121204
485 Ga0070662_100631996
486 Ga0070681_10023930
487 Ga0070681_10639187
488 Ga0068867_100119415
489 Ga0068867_100249497
490 Ga0070685_10030715
491 Ga0070685_10124483
492 Ga0070706_100412628
493 Ga0070707_100054704
494 Ga0070699_100556686
495 Ga0070679_100040736
496 Ga0070679_100149121
497 Ga0070684_100113034
498 Ga0070684_100130655
499 Ga0070684_100215234
500 Ga0068853_100353795
501 Ga0070672_100048511
502 Ga0070672_100072055
503 Ga0070672_100811011
504 Ga0070686_100065921
505 Ga0070696_100127105
506 Ga0070696_100697932
507 Ga0070693_100064971
508 Ga0070693_100520539
509 Ga0070665_100358959
510 Ga0070704_100019459
511 Ga0070704_100286671
512 Ga0070664_100265679
513 Ga0068854_100118256
514 Ga0068856_100246555
515 Ga0068856_100656197
516 Ga0070702_100040454
517 Ga0070702_100235959
518 Ga0068852_100161515
519 Ga0068852_100412339
520 Ga0068859_100642663
521 Ga0068864_100070994
522 Ga0068864_100695252
523 Ga0068866_10380487
524 Ga0068866_10446655
525 Ga0068861_100175457
526 Ga0068861_100909586
527 Ga0068860_100119810
528 Ga0081455_10002211
529 Ga0081455_10460616
530 Ga0081538_10074765
531 Ga0081539_10000452
532 Ga0075365_10213141
533 Ga0075432_10100397
534 Ga0075428_100170943
535 Ga0075428_100913547
536 Ga0075434_100350854
537 Ga0075429_100179195
538 Ga0097620_100642640
539 Ga0075435_100072824
540 Ga0111539_10011207
541 Ga0111539_10232190
542 Ga0105245_10188835
543 Ga0105245_10526020
544 Ga0105247_10022199
545 Ga0114129_10253542
546 Ga0114129_10630216
547 Ga0114129_10854287
548 Ga0105243_10050737
549 Ga0105243_10146026
550 Ga0105243_10377505
551 Ga0105243_10435364
552 Ga0105243_10806209
553 Ga0105242_10018030
554 Ga0105242_10465419
555 Ga0105248_10044555
556 Ga0105248_10080349
557 Ga0105248_11410530
558 Ga0105249_10408402
559 Ga0105249_10654096
560 Ga0105249_10992325
561 Ga0105239_10020046
562 Ga0105239_10108553
563 Ga0105239_10160358
564 Ga0105246_10030873
565 Ga0157373_10197905
566 Ga0157371_10101495
567 Ga0157369_10051985
568 Ga0157374_10085438
569 Ga0157372_10018309
570 Ga0157372_10306497
571 Ga0157372_10545361
572 Ga0157375_10974255
573 Ga0163163_10617188
574 Ga0163163_10889036
575 Ga0157380_10117649
576 Ga0157380_10337691
577 Ga0157380_10353580
578 Ga0157380_10546894
579 Ga0157377_10059236
580 Ga0157377_10075197
581 Ga0157377_10375964
582 Ga0157376_10126755
583 Ga0157376_10131873
584 Ga0163161_10253401
585 Ga0206356_10900369
586 Ga0207656_10193127
587 Ga0207710_10015672
588 Ga0207688_10050258
589 Ga0207688_10081813
590 Ga0207688_10228387
591 Ga0207643_10049756
592 Ga0207643_10126374
593 Ga0207707_10018451
594 Ga0207707_10635219
595 Ga0207660_10061990
596 Ga0207649_10026934
597 Ga0207652_10025343
598 Ga0207694_10450356
599 Ga0207687_10083098
600 Ga0207687_10164374
601 Ga0207690_10658476
602 Ga0207706_10254395
603 Ga0207686_10351196
604 Ga0207709_10325284
605 Ga0207670_10395205
606 Ga0207669_10104560
607 Ga0207669_10198904
608 Ga0207691_10063125
609 Ga0207691_10203639
610 Ga0207691_10252077
611 Ga0207711_10120643
612 Ga0207711_11068601
613 Ga0207689_10387066
614 Ga0207661_10000468
615 Ga0207661_10173174
616 Ga0207661_10190989
617 Ga0207679_10016516
618 Ga0207667_10337174
619 Ga0207712_10362533
620 Ga0207640_10102953
621 Ga0207677_10079297
622 Ga0207677_10298476
623 Ga0207639_10844541
624 Ga0207708_10036957
625 Ga0207708_10429262
626 Ga0207702_10291629
627 Ga0207648_10111448
628 Ga0207648_10209553
629 Ga0207648_10304965
630 Ga0207676_10587773
631 Ga0207683_10035101
632 Ga0207683_10387520
633 Ga0207683_10707939
634 Ga0207698_10147532
635 Ga0207698_10611824
636 Ga0207698_10980757
637 Ga0207428_10089118
638 Ga0207428_10219733
639 Ga0268264_10078134
640 Ga0307409_100487794
641 Ga0307409_100506002
642 Ga0307409_100579867
643 Ga0307416_100009670
644 Ga0307416_101046305
645 Ga0307411_11105140
646 Ga0373952_0023387
647 Ga0373942_0043721
648 Ga0373962_0027332
649 Ga0395900_0107549
650 Ga0395900_0372478
651 Ga0395900_0497246
652 Ga0395898_0038711
653 Ga0395898_0759866
654 Ga0395905_0082727
655 Ga0395905_0156382
656 Ga0436364_0671991
657 Ga0395901_0008098
658 Ga0395901_0009482
659 Ga0436365_0672651
660 Ga0439438_040769
661 Ga0439439_0007010
662 Ga0439461_0012405
663 Ga0439461_0038011
664 Ga0439431_0038024
665 Ga0439433_0062806
666 Ga0439442_017842
667 Ga0439452_025044
668 Ga0439462_0024802
669 Ga0450920_012607
670 Ga0450920_036152
671 Ga0450906_037811
672 Ga0450907_006682
673 Ga0450907_040951
674 Ga0439446_0000714
675 Ga0439446_0002539
676 Ga0439446_0059791
677 Ga0439434_0011576
678 Ga0439434_0093578
679 Ga0466966_0031192
680 Ga0466971_0027613
681 Ga0466970_0033910
682 Ga0466957_0057167
683 Ga0466959_0027980
684 Ga0451576_0513661
685 Ga0466958_0013733
686 Ga0495594_0458997
687 Ga0495596_0117451
688 Ga0495607_0151835
689 Ga0495631_0192945
690 Ga0495656_0065494
691 Ga0495661_0357653
692 Ga0495588_0307599
693 Ga0495674_0248323
694 Ga0496100_0198526
695 Ga0496102_0158000
696 Ga0496103_0259638
697 Ga0496104_0098497
698 Ga0496104_0222223
699 Ga0496105_0030967
700 Ga0496105_0148287
701 Ga0496107_0591620
702 Ga0496108_0016307
703 Ga0496108_0062128
704 Ga0496108_0065614
705 Ga0496109_0000789
706 Ga0496109_0209647
707 Ga0496109_0300321
708 Ga0496109_0598394
709 Ga0496110_0001213
710 Ga0496110_0006394
711 Ga0496110_0317867
712 Ga0496111_0001732
713 Ga0496111_0071030
714 Ga0496111_0211961
715 Ga0496112_0126472
716 Ga0496113_0027794
717 Ga0496113_0259760
718 Ga0496114_0100644
719 Ga0496114_0183250
720 Ga0501031_0028777
721 Ga0501031_0029197
722 Ga0501031_0033480
723 Ga0501031_0119659
724 Ga0501032_0004462
725 Ga0501032_0064168
726 Ga0501032_0158896
727 Ga0501034_0603425
728 Ga0501036_0001711
729 Ga0501036_0020996
730 Ga0501036_0051750
731 Ga0501036_0070515
732 Ga0501036_0282923
733 Ga0501036_0380449
734 Ga0501037_0010385
735 Ga0501037_0238219
736 Ga0501038_0004943
737 Ga0501038_0090380
738 Ga0501038_0145738
739 Ga0501038_0146116
740 Ga0501039_0023342
741 Ga0501039_0058788
742 Ga0501039_0061588
743 Ga0501039_0070787
744 Ga0501040_0001583
745 Ga0501040_0004868
746 Ga0501040_0005044
747 Ga0501040_0048164
748 Ga0501040_0076552
749 Ga0501040_0870264
750 Ga0501041_0001552
751 Ga0501041_0002924
752 Ga0501041_0010834
753 Ga0501041_0028584
754 Ga0501041_0032775
755 Ga0501041_0122495
756 Ga0501042_0003779
757 Ga0501042_0008861
758 Ga0501042_0008961
759 Ga0501042_0040602
760 Ga0501042_0151323
761 Ga0501042_0301620
762 Ga0501042_0428775
763 Ga0501043_0006002
764 Ga0501043_0230567
765 Ga0501046_0007692
766 Ga0501046_0031439
767 Ga0501046_0069100
768 Ga0501046_0095849
769 Ga0501047_0215535
770 Ga0501047_0708583
771 Ga0501048_0013350
772 Ga0501048_0025436
773 Ga0501048_0036341
774 Ga0501048_0054427
775 Ga0501048_0056232
776 Ga0501048_0090759
777 Ga0501067_0135232
778 Ga0501068_0004275
779 Ga0501068_0018935
780 Ga0501068_0158113
781 Ga0501069_0004516
782 Ga0501069_0006925
783 Ga0501069_0071023
784 Ga0501069_0140938
785 Ga0501069_0162949
786 Ga0501069_0278611
787 Ga0501070_0061379
788 Ga0501070_0066899
789 Ga0501070_0367854
790 Ga0501071_0019983
791 Ga0501071_0045209
792 Ga0501071_0109123
793 Ga0501071_0112235
794 Ga0501071_0166895
795 Ga0501071_0190608
796 Ga0501071_0216291
797 Ga0501071_0372928
798 Ga0501071_0596954
799 Ga0501072_0000140
800 Ga0501072_0008683
801 Ga0501072_0011799
802 Ga0501072_0014420
803 Ga0501072_0119158
804 Ga0501072_0119334
805 Ga0501073_0011110
806 Ga0501073_0053807
807 Ga0501073_0300179
808 Ga0501073_0377593
809 Ga0501074_0001713
810 Ga0501074_0006539
811 Ga0501074_0009266
812 Ga0501074_0077102
813 Ga0501074_0100778
814 Ga0501074_0448662
815 Ga0501075_0001917
816 Ga0501075_0009357
817 Ga0501075_0015984
818 Ga0501075_0016739
819 Ga0501075_0020543
820 Ga0501075_0050013
821 Ga0501075_0126852
822 Ga0501076_0005291
823 Ga0501076_0034415
824 Ga0501076_0046827
825 Ga0501076_0076492
826 Ga0501076_0102160
827 Ga0501076_0116224
828 Ga0501076_0665176
829 Ga0501076_0712344
830 Ga0501077_0005451
831 Ga0501077_0005602
832 Ga0501077_0012396
833 Ga0501077_0037504
834 Ga0501077_0098363
835 Ga0501079_0001062
836 Ga0501079_0028148
837 Ga0501079_0110827
838 Ga0501079_0126039
839 Ga0501079_0143027
840 Ga0501079_0160883
841 Ga0501079_0213695
842 Ga0501080_0025320
843 Ga0501080_0039990
844 Ga0501080_0112499
845 Ga0501080_0128960
846 Ga0501080_0459704
847 Ga0501081_0003647
848 Ga0501081_0006032
849 Ga0501081_0041719
850 Ga0501081_0146849
851 Ga0501081_0250417
852 Ga0501081_0519342
853 Ga0501035_0002024
854 Ga0501035_0020893
855 Ga0501035_0079845
856 Ga0501035_0098477
857 Ga0501035_0337036
858 Ga0501044_0227044
859 Ga0501045_0011169
860 Ga0501045_0021928
861 Ga0501045_0024448
862 Ga0501045_0057476
863 Ga0501045_0102980
864 Ga0501045_0131797
865 Ga0501045_0330589
866 nmdc:mga00v17_429421_c1
867 nmdc:mga05p37_201189_c1
868 nmdc:mga05p37_68657_c1
869 nmdc:mga09592_172866_c1
870 nmdc:mga08y16_217342_c1
871 nmdc:mga08y16_355676_c1
872 nmdc:mga08y16_62036_c1
873 nmdc:mga0n895_938956_c1
874 nmdc:mga0rr50_182461_c1
875 nmdc:mga0a205_699082_c1
876 nmdc:mga0a205_846554_c1
877 Ga0501084_0001484
878 Ga0501084_0015272
879 Ga0501084_0042707
880 Ga0501084_0055038
881 Ga0501084_0131711
882 Ga0501084_0158720
883 Ga0501084_0168859
884 Ga0501084_0358950
885 Ga0501084_0429657
886 Ga0501084_0825069
887 Ga0501084_1053419
888 Ga0590071_007603
889 Ga0590075_005946
890 Ga0590077_022998
891 Ga0501082_0004124
892 Ga0501082_0033952
893 Ga0501082_0054718
894 Ga0501082_0063203
895 Ga0501082_0116496
896 Ga0501082_0193997
897 Ga0501082_0806917
898 Ga0530510_0004717
899 Ga0530510_0235101
900 Ga0530510_0242781

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01121

CoaE

Dephospho-CoA kinase

21

197

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2grj-assembly2.cif.gz_B crystal structure of dephospho-coa kinase (ec 2.7.1.24) (dephosphocoenzyme a kinase) (tm1387) from thermotoga maritima at 2.60 a resolution 0.8632 8 196
4i1u-assembly1.cif.gz_A apo crystal structure of a dephospho-coa kinase from burkholderia vietnamiensis 0.8592 8 206
2f6r-assembly1.cif.gz_A crystal structure of bifunctional coenzyme a synthase (coa synthase): (18044849) from mus musculus at 1.70 a resolution 0.8483 9 197
2grj-assembly2.cif.gz_B crystal structure of dephospho-coa kinase (ec 2.7.1.24) (dephosphocoenzyme a kinase) (tm1387) from thermotoga maritima at 2.60 a resolution 0.8409 8 196
1n3b-assembly1.cif.gz_C crystal structure of dephosphocoenzyme a kinase from escherichia coli 0.8327 9 203
ID Description Score Start End Superfamily
af_Q9VRP4_309_517_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8882 8 205 3.40.50.300
af_P9WNL3_25_184_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.887 9 30 3.40.50.300
af_A0A2R8RQN4_186_364_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8782 10 31 3.40.50.300
af_Q13057_357_562_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8653 9 200 3.40.50.300
4i1uA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8592 8 206 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A538CHM9-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9722 8 198 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A7W1LEH9-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9701 7 205 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A7W1GM54-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9583 7 206 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A7W1LEH9-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9514 7 205 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A7W1QA97-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.949 1 198 GO:0004140
GO:0005524
GO:0005737
GO:0015937

Map