F446650

General Info

Members Datasets Scaffolds Average Seq Length
450 196 419 163

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0108045|Ga0466967_0108045_122_676
Length 184
Sequence MRTAGALIAPAAPDNRGRIEMASKLTTCLWFDKGEARKAAEFYASVFPDTRVGPPHAAPTDFPSGSEGDELTVEFTLLGQQFVGLNGGPNFKPNEAVSFMVLTDDQDETDRYWNAITRNGGEESACGWCKDRWGFSWQITPKRLLELTSDNGERGKRAFQAMMTMKKIDIAALDAAVEGVPADA

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
4 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
5 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
6 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
7 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
8 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
9 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
10 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
11 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
12 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
13 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
14 2904699407
15 2906610324
16 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
17 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
18 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
19 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
20 2922425934
21 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
22 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
23 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
24 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
25 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
26 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
27 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
28 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
29 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
30 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
31 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
32 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
125 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
126 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
131 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
139 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
140 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
172 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
173 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
193 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
194 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
195 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
196 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.59
Metatranscriptomes 5.15
Isolates 6.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.89
Nodule 5.33
Rhizoplane 6.22
Rhizosphere 84.44
Stem 0
Stem Tuber 0
Unclassified 3.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1002765 3300001915 Bacteria 4440
2 JGI24740J21852_10002180 3300001979 Bacteria 8953
3 JGI24740J21852_10051341 3300001979 Bacteria 1181
4 JGI24739J22299_10012451 3300001989 Bacteria 3124
5 JGI24737J22298_10007641 3300001990 Bacteria 3643
6 JGI24737J22298_10072935 3300001990 Bacteria 1024
7 JGI24735J21928_10001228 3300002067 Bacteria 9104
8 JGI24735J21928_10008713 3300002067 Bacteria 3275
9 JGI24735J21928_10021250 3300002067 Bacteria 1982
10 JGI25165J46597_1023063 3300003214 Bacteria 810
11 Ga0070658_10003956 3300005327 Bacteria 12146
12 Ga0070658_10058799 3300005327 Bacteria 3130
13 Ga0070658_10107743 3300005327 Bacteria 2306
14 Ga0070658_10145231 3300005327 Bacteria 1983
15 Ga0070658_10253409 3300005327 Bacteria 1493
16 Ga0070658_10334541 3300005327 Bacteria 1294
17 Ga0070658_10548379 3300005327 Bacteria 1000
18 Ga0070658_10716969 3300005327 Bacteria 868
19 Ga0070658_10967207 3300005327 Bacteria 740
20 Ga0070683_100069686 3300005329 Bacteria 3279
21 Ga0070683_100174677 3300005329 Bacteria 2039
22 Ga0070683_100703718 3300005329 Bacteria 968
23 Ga0070683_100834755 3300005329 Bacteria 884
24 Ga0070670_100137500 3300005331 Bacteria 2111
25 Ga0070680_100000197 3300005336 Bacteria 39326
26 Ga0070680_100020621 3300005336 Bacteria 5233
27 Ga0070680_100564933 3300005336 Bacteria 975
28 Ga0070680_101567570 3300005336 Bacteria 571
29 Ga0070682_100051490 3300005337 Bacteria 2573
30 Ga0070660_100085239 3300005339 Bacteria 2484
31 Ga0070660_100154181 3300005339 Bacteria 1849
32 Ga0070660_100275706 3300005339 Bacteria 1375
33 Ga0070660_100553885 3300005339 Bacteria 959
34 Ga0070660_100837432 3300005339 Bacteria 774
35 Ga0070691_10104491 3300005341 Bacteria 1410
36 Ga0070691_10141364 3300005341 Bacteria 1227
37 Ga0070691_10371642 3300005341 Bacteria 799
38 Ga0070687_100614156 3300005343 Bacteria 749
39 Ga0070661_100049631 3300005344 Bacteria 3072
40 Ga0070661_100616330 3300005344 Bacteria 878
41 Ga0070661_100724713 3300005344 Bacteria 812
42 Ga0070661_101303693 3300005344 Bacteria 609
43 Ga0070692_10050031 3300005345 Bacteria 2169
44 Ga0070692_10067114 3300005345 Bacteria 1903
45 Ga0070692_10345951 3300005345 Bacteria 922
46 Ga0070692_10370392 3300005345 Bacteria 896
47 Ga0070692_10552241 3300005345 Bacteria 755
48 Ga0070671_100025385 3300005355 Bacteria 4862
49 Ga0070671_100120739 3300005355 Bacteria 2205
50 Ga0070673_100091114 3300005364 Bacteria 2492
51 Ga0070659_100004304 3300005366 Bacteria 10163
52 Ga0070659_100042901 3300005366 Bacteria 3537
53 Ga0070659_100343309 3300005366 Bacteria 1251
54 Ga0070659_100499716 3300005366 Bacteria 1036
55 Ga0070667_100635734 3300005367 Bacteria 985
56 Ga0070714_100026118 3300005435 Bacteria 4825
57 Ga0070714_100046707 3300005435 Bacteria 3674
58 Ga0070714_100355389 3300005435 Bacteria 1377
59 Ga0070714_101250025 3300005435 Bacteria 725
60 Ga0070663_100021474 3300005455 Bacteria 4294
61 Ga0070663_100028766 3300005455 Bacteria 3788
62 Ga0070663_100058513 3300005455 Bacteria 2767
63 Ga0070663_100096243 3300005455 Bacteria 2202
64 Ga0070663_100416827 3300005455 Bacteria 1101
65 Ga0070663_101364700 3300005455 Bacteria 627
66 Ga0070662_100098768 3300005457 Bacteria 2206
67 Ga0070681_10003859 3300005458 Bacteria 14106
68 Ga0070681_10112312 3300005458 Bacteria 2664
69 Ga0070681_10410193 3300005458 Bacteria 1266
70 Ga0068867_100095611 3300005459 Bacteria 2260
71 Ga0070679_100125827 3300005530 Bacteria 2545
72 Ga0070679_100187294 3300005530 Bacteria 2040
73 Ga0070679_100434109 3300005530 Bacteria 1258
74 Ga0070684_100030635 3300005535 Bacteria 4572
75 Ga0070684_100182045 3300005535 Bacteria 1911
76 Ga0070684_100391356 3300005535 Bacteria 1281
77 Ga0068853_100029357 3300005539 Bacteria 4635
78 Ga0068853_100072655 3300005539 Bacteria 2998
79 Ga0068853_100098988 3300005539 Bacteria 2575
80 Ga0068853_100385486 3300005539 Bacteria 1309
81 Ga0070672_100149713 3300005543 Bacteria 1930
82 Ga0070693_100095810 3300005547 Bacteria 1798
83 Ga0068855_100189224 3300005563 Bacteria 2323
84 Ga0068855_100352724 3300005563 Bacteria 1620
85 Ga0068855_100543457 3300005563 Bacteria 1258
86 Ga0068855_100579028 3300005563 Bacteria 1212
87 Ga0070664_100072624 3300005564 Bacteria 2951
88 Ga0070664_100129891 3300005564 Bacteria 2212
89 Ga0070664_100279378 3300005564 Bacteria 1506
90 Ga0068857_100037178 3300005577 Bacteria 4313
91 Ga0068857_100038795 3300005577 Bacteria 4217
92 Ga0068857_100189031 3300005577 Bacteria 1875
93 Ga0068854_100012472 3300005578 Bacteria 5567
94 Ga0068854_100015348 3300005578 Bacteria 5071
95 Ga0068854_100039034 3300005578 Bacteria 3342
96 Ga0068854_100099953 3300005578 Bacteria 2173
97 Ga0068854_100205756 3300005578 Bacteria 1550
98 Ga0068854_100219334 3300005578 Bacteria 1504
99 Ga0068856_100298498 3300005614 Bacteria 1628
100 Ga0068856_100702490 3300005614 Bacteria 1032
101 Ga0068856_100809398 3300005614 Bacteria 956
102 Ga0068856_101048057 3300005614 Bacteria 833
103 Ga0068856_101590096 3300005614 Bacteria 667
104 Ga0068856_102266082 3300005614 Bacteria 551
105 Ga0068852_100120223 3300005616 Bacteria 2403
106 Ga0068852_100203006 3300005616 Bacteria 1876
107 Ga0068852_100442408 3300005616 Bacteria 1285
108 Ga0068859_100038532 3300005617 Bacteria 4795
109 Ga0068864_100015803 3300005618 Bacteria 6279
110 Ga0068864_100050171 3300005618 Bacteria 3591
111 Ga0068851_10017699 3300005834 Bacteria 3426
112 Ga0068851_10036363 3300005834 Bacteria 2465
113 Ga0068851_10358758 3300005834 Bacteria 850
114 Ga0068863_100023410 3300005841 Bacteria 5899
115 Ga0068863_100111732 3300005841 Bacteria 2602
116 Ga0075366_10123360 3300006195 Bacteria 1562
117 Ga0068871_101293930 3300006358 Bacteria 686
118 Ga0097620_100038532 3300006931 Bacteria 4795
119 Ga0099824_1009385 3300006942 Bacteria 12065
120 Ga0105251_10015937 3300009011 Bacteria 4086
121 Ga0105240_10049777 3300009093 Bacteria 5286
122 Ga0105240_10064276 3300009093 Bacteria 4560
123 Ga0111539_11494195 3300009094 Bacteria 783
124 Ga0105247_10825933 3300009101 Bacteria 709
125 Ga0105241_10650763 3300009174 Bacteria 957
126 Ga0105237_10020284 3300009545 Bacteria 6856
127 Ga0105237_10235260 3300009545 Bacteria 1833
128 Ga0105238_10032221 3300009551 Bacteria 5334
129 Ga0157373_10016222 3300013100 Bacteria 5436
130 Ga0157373_10072072 3300013100 Bacteria 2439
131 Ga0157373_10104524 3300013100 Bacteria 1992
132 Ga0157373_10173728 3300013100 Bacteria 1516
133 Ga0157371_10032113 3300013102 Bacteria 3779
134 Ga0157371_10034950 3300013102 Bacteria 3604
135 Ga0157371_10035748 3300013102 Bacteria 3559
136 Ga0157371_10108891 3300013102 Bacteria 1966
137 Ga0157371_10134385 3300013102 Bacteria 1761
138 Ga0157371_10140807 3300013102 Bacteria 1718
139 Ga0157371_10205836 3300013102 Bacteria 1411
140 Ga0157371_10244370 3300013102 Bacteria 1292
141 Ga0157371_10549620 3300013102 Bacteria 856
142 Ga0157370_10030850 3300013104 Bacteria 5251
143 Ga0157370_10031809 3300013104 Bacteria 5158
144 Ga0157370_10066542 3300013104 Bacteria 3407
145 Ga0157370_10079692 3300013104 Bacteria 3084
146 Ga0157370_10281839 3300013104 Bacteria 1535
147 Ga0157370_10297621 3300013104 Bacteria 1490
148 Ga0157370_11217405 3300013104 Bacteria 679
149 Ga0157369_10055618 3300013105 Bacteria 4271
150 Ga0157369_10078998 3300013105 Bacteria 3524
151 Ga0157369_10260191 3300013105 Bacteria 1810
152 Ga0157369_10427577 3300013105 Bacteria 1373
153 Ga0157369_10560654 3300013105 Bacteria 1180
154 Ga0157369_11040622 3300013105 Bacteria 838
155 Ga0157372_10002766 3300013307 Bacteria 18963
156 Ga0157372_10105601 3300013307 Bacteria 3221
157 Ga0157372_10108758 3300013307 Bacteria 3174
158 Ga0157372_10124379 3300013307 Bacteria 2965
159 Ga0157372_10311588 3300013307 Bacteria 1832
160 Ga0157372_10389156 3300013307 Bacteria 1625
161 Ga0157372_10416399 3300013307 Bacteria 1566
162 Ga0163163_10154921 3300014325 Bacteria 2335
163 Ga0163163_10511284 3300014325 Bacteria 1263
164 Ga0157379_10059760 3300014968 Bacteria 3409
165 Ga0163161_10060136 3300017792 Bacteria 2764
166 Ga0197907_10523261 3300020069 Bacteria 2439
167 Ga0206356_10753987 3300020070 Bacteria 1063
168 Ga0206356_10805298 3300020070 Bacteria 1574
169 Ga0206356_11474859 3300020070 Bacteria 1557
170 Ga0206353_10139520 3300020082 Bacteria 833
171 Ga0206353_10552381 3300020082 Bacteria 1755
172 Ga0206353_11737401 3300020082 Bacteria 2476
173 Ga0224712_10087416 3300022467 Bacteria 1299
174 Ga0209233_1010685 3300025261 Bacteria 2736
175 Ga0207656_10093887 3300025321 Bacteria 1366
176 Ga0207647_10003088 3300025904 Bacteria 12521
177 Ga0207647_10015866 3300025904 Bacteria 5154
178 Ga0207647_10033384 3300025904 Bacteria 3295
179 Ga0207647_10170265 3300025904 Bacteria 1268
180 Ga0207647_10192306 3300025904 Bacteria 1182
181 Ga0207705_10024261 3300025909 Bacteria 4329
182 Ga0207705_10055192 3300025909 Bacteria 2864
183 Ga0207705_10057055 3300025909 Bacteria 2816
184 Ga0207705_10070409 3300025909 Bacteria 2535
185 Ga0207705_10131857 3300025909 Bacteria 1860
186 Ga0207705_10134373 3300025909 Bacteria 1843
187 Ga0207705_10138241 3300025909 Bacteria 1817
188 Ga0207705_10232760 3300025909 Bacteria 1402
189 Ga0207705_10421907 3300025909 Bacteria 1033
190 Ga0207707_10003841 3300025912 Bacteria 13310
191 Ga0207707_10116038 3300025912 Bacteria 2340
192 Ga0207707_10124753 3300025912 Bacteria 2252
193 Ga0207707_10381045 3300025912 Bacteria 1212
194 Ga0207695_10022897 3300025913 Bacteria 7076
195 Ga0207695_10028155 3300025913 Bacteria 6239
196 Ga0207671_10106463 3300025914 Bacteria 2129
197 Ga0207671_10191245 3300025914 Bacteria 1596
198 Ga0207660_10001245 3300025917 Bacteria 17060
199 Ga0207660_10018450 3300025917 Bacteria 4651
200 Ga0207660_10039279 3300025917 Bacteria 3308
201 Ga0207660_10676343 3300025917 Bacteria 842
202 Ga0207660_10762515 3300025917 Bacteria 790
203 Ga0207660_11201392 3300025917 Bacteria 617
204 Ga0207657_10021889 3300025919 Bacteria 6004
205 Ga0207657_10049375 3300025919 Bacteria 3667
206 Ga0207657_10144126 3300025919 Bacteria 1944
207 Ga0207657_10178880 3300025919 Bacteria 1715
208 Ga0207649_10001548 3300025920 Bacteria 13488
209 Ga0207649_10003288 3300025920 Bacteria 8848
210 Ga0207649_10044088 3300025920 Bacteria 2730
211 Ga0207652_10012311 3300025921 Bacteria 6911
212 Ga0207652_10147062 3300025921 Bacteria 2109
213 Ga0207652_10180071 3300025921 Bacteria 1899
214 Ga0207652_10192730 3300025921 Bacteria 1833
215 Ga0207652_10418339 3300025921 Bacteria 1209
216 Ga0207694_10012198 3300025924 Bacteria 6482
217 Ga0207650_10397462 3300025925 Bacteria 1140
218 Ga0207664_10010609 3300025929 Bacteria 6511
219 Ga0207644_10619485 3300025931 Bacteria 899
220 Ga0207690_10003956 3300025932 Bacteria 8766
221 Ga0207690_10006257 3300025932 Bacteria 7048
222 Ga0207690_10009691 3300025932 Bacteria 5720
223 Ga0207690_10134008 3300025932 Bacteria 1817
224 Ga0207690_10170360 3300025932 Bacteria 1631
225 Ga0207690_10264587 3300025932 Bacteria 1333
226 Ga0207706_10003286 3300025933 Bacteria 15472
227 Ga0207706_10137577 3300025933 Bacteria 2148
228 Ga0207711_10013733 3300025941 Bacteria 6725
229 Ga0207661_10532124 3300025944 Bacteria 1075
230 Ga0207661_10679149 3300025944 Bacteria 947
231 Ga0207679_10282695 3300025945 Bacteria 1423
232 Ga0207679_10309733 3300025945 Bacteria 1364
233 Ga0207667_10012556 3300025949 Bacteria 9746
234 Ga0207667_10052347 3300025949 Bacteria 4300
235 Ga0207667_10300005 3300025949 Bacteria 1641
236 Ga0207667_10446013 3300025949 Bacteria 1315
237 Ga0207651_10387877 3300025960 Bacteria 1185
238 Ga0207712_10773970 3300025961 Bacteria 842
239 Ga0207668_10844025 3300025972 Bacteria 813
240 Ga0207640_10006261 3300025981 Bacteria 6525
241 Ga0207640_10014231 3300025981 Bacteria 4575
242 Ga0207640_10021744 3300025981 Bacteria 3828
243 Ga0207640_10185567 3300025981 Bacteria 1563
244 Ga0207640_10235092 3300025981 Bacteria 1412
245 Ga0207640_10262839 3300025981 Bacteria 1346
246 Ga0207658_10027084 3300025986 Bacteria 4025
247 Ga0207639_10000289 3300026041 Bacteria 35884
248 Ga0207639_10026310 3300026041 Bacteria 4228
249 Ga0207639_10042087 3300026041 Bacteria 3422
250 Ga0207678_10008361 3300026067 Bacteria 9126
251 Ga0207678_10009286 3300026067 Bacteria 8654
252 Ga0207678_10018808 3300026067 Bacteria 6068
253 Ga0207678_10028075 3300026067 Bacteria 4914
254 Ga0207678_10137296 3300026067 Bacteria 2086
255 Ga0207678_10140889 3300026067 Bacteria 2058
256 Ga0207702_10044154 3300026078 Bacteria 3745
257 Ga0207702_10269221 3300026078 Bacteria 1606
258 Ga0207702_10399688 3300026078 Bacteria 1325
259 Ga0207702_10583636 3300026078 Bacteria 1096
260 Ga0207702_10645550 3300026078 Bacteria 1041
261 Ga0207641_10038567 3300026088 Bacteria 3994
262 Ga0207641_10127944 3300026088 Bacteria 2277
263 Ga0207641_10136612 3300026088 Bacteria 2207
264 Ga0207648_10013255 3300026089 Bacteria 7680
265 Ga0207676_10191150 3300026095 Bacteria 1801
266 Ga0207676_10236689 3300026095 Bacteria 1635
267 Ga0207674_10000859 3300026116 Bacteria 39717
268 Ga0207674_10007432 3300026116 Bacteria 12769
269 Ga0207674_10008100 3300026116 Bacteria 12183
270 Ga0207674_10018416 3300026116 Bacteria 7590
271 Ga0207674_10076557 3300026116 Bacteria 3353
272 Ga0207674_10203199 3300026116 Bacteria 1931
273 Ga0207698_10012407 3300026142 Bacteria 5574
274 Ga0207698_10125273 3300026142 Bacteria 2183
275 Ga0207698_10206355 3300026142 Bacteria 1764
276 Ga0207698_10237895 3300026142 Bacteria 1657
277 Ga0209589_1000001 3300027357 Bacteria 794224
278 Ga0209489_100001 3300027361 Bacteria 794224
279 Ga0209700_100001 3300027363 Bacteria 794224
280 Ga0307413_10053916 3300031824 Bacteria 2437
281 Ga0307413_10919587 3300031824 Bacteria 744
282 Ga0307412_11316778 3300031911 Bacteria 651
283 Ga0307414_10040806 3300032004 Bacteria 3137
284 Ga0307414_10061613 3300032004 Bacteria 2658
285 Ga0307414_10113482 3300032004 Bacteria 2068
286 Ga0307414_10231923 3300032004 Bacteria 1522
287 Ga0307414_11382029 3300032004 Bacteria 654
288 Ga0315911_1000006 3300033442 Bacteria 414563
289 Ga0373961_0345552 3300035241 Bacteria 560
290 Ga0395899_0009786 3300037312 Bacteria 7356
291 Ga0395899_0101845 3300037312 Bacteria 2072
292 Ga0395899_0198314 3300037312 Bacteria 1401
293 Ga0395899_0265901 3300037312 Bacteria 1171
294 Ga0395899_0331572 3300037312 Bacteria 1022
295 Ga0395899_0333568 3300037312 Bacteria 1018
296 Ga0395900_0000192 3300037418 Bacteria 98186
297 Ga0395900_0015409 3300037418 Bacteria 7792
298 Ga0395900_0018120 3300037418 Bacteria 7186
299 Ga0395900_0087288 3300037418 Bacteria 3206
300 Ga0395900_0138756 3300037418 Bacteria 2490
301 Ga0395900_0175263 3300037418 Bacteria 2181
302 Ga0395900_0181669 3300037418 Bacteria 2137
303 Ga0395900_0238041 3300037418 Bacteria 1827
304 Ga0395900_0904951 3300037418 Bacteria 806
305 Ga0395900_1203304 3300037418 Bacteria 673
306 Ga0395900_1242548 3300037418 Bacteria 660
307 Ga0395898_0000055 3300037466 Bacteria 278557
308 Ga0395898_0019008 3300037466 Bacteria 6997
309 Ga0395898_0038740 3300037466 Bacteria 4722
310 Ga0395898_0053527 3300037466 Bacteria 3942
311 Ga0395898_0145732 3300037466 Bacteria 2266
312 Ga0395898_0434670 3300037466 Bacteria 1250
313 Ga0395898_1074047 3300037466 Bacteria 739
314 Ga0395905_0000067 3300037471 Bacteria 181887
315 Ga0395905_0014745 3300037471 Bacteria 7451
316 Ga0395905_0049718 3300037471 Bacteria 3929
317 Ga0395905_0081311 3300037471 Bacteria 3036
318 Ga0395905_0083351 3300037471 Bacteria 2995
319 Ga0395905_0160444 3300037471 Bacteria 2113
320 Ga0395905_0164749 3300037471 Bacteria 2083
321 Ga0395905_0246279 3300037471 Bacteria 1670
322 Ga0395905_0272285 3300037471 Bacteria 1579
323 Ga0395905_0274345 3300037471 Bacteria 1572
324 Ga0395905_0288281 3300037471 Bacteria 1528
325 Ga0395905_0302722 3300037471 Bacteria 1486
326 Ga0395905_0611291 3300037471 Bacteria 992
327 Ga0395905_0633728 3300037471 Bacteria 971
328 Ga0395905_0882042 3300037471 Bacteria 798
329 Ga0395905_1155588 3300037471 Bacteria 677
330 Ga0436364_0653289 3300037853 Bacteria 12578
331 Ga0395901_0000041 3300038443 Bacteria 202314
332 Ga0395901_0003222 3300038443 Bacteria 16416
333 Ga0395901_0006034 3300038443 Bacteria 12278
334 Ga0395901_0010662 3300038443 Bacteria 9315
335 Ga0395901_0011951 3300038443 Bacteria 8803
336 Ga0395901_0076679 3300038443 Bacteria 3488
337 Ga0395901_0193544 3300038443 Bacteria 2132
338 Ga0395901_0209259 3300038443 Bacteria 2042
339 Ga0395901_0775320 3300038443 Bacteria 950
340 Ga0395901_1159179 3300038443 Bacteria 740
341 Ga0395901_1430481 3300038443 Bacteria 649
342 Ga0451791_0509147 3300041451 Bacteria 611
343 Ga0466972_0067319 3300044658 Bacteria 1711
344 Ga0466965_0543359 3300044683 Bacteria 655
345 Ga0466966_0165268 3300044684 Bacteria 1346
346 Ga0466961_0118357 3300044693 Bacteria 1664
347 Ga0466963_0326585 3300044694 Bacteria 1080
348 Ga0466963_0371636 3300044694 Bacteria 1007
349 Ga0466963_0676311 3300044694 Bacteria 728
350 Ga0466971_0445348 3300044719 Bacteria 635
351 Ga0466968_0221126 3300044735 Bacteria 892
352 Ga0466970_0397091 3300044765 Bacteria 786
353 Ga0466957_0129948 3300044842 Bacteria 1613
354 Ga0466957_0218308 3300044842 Bacteria 1258
355 Ga0466960_0009083 3300044901 Bacteria 4088
356 Ga0466958_0250233 3300045836 Bacteria 1133
357 Ga0466958_0359731 3300045836 Bacteria 938
358 Ga0466967_0108045 3300045976 Bacteria 2552
359 Ga0466967_0204776 3300045976 Bacteria 1870
360 Ga0466967_0328688 3300045976 Bacteria 1476
361 Ga0466967_0532022 3300045976 Bacteria 1156
362 Ga0466967_2553606 3300045976 Bacteria 506
363 Ga0495618_0784575 3300046514 Bacteria 556
364 Ga0495588_0047366 3300046674 Bacteria 2207
365 Ga0495669_0049557 3300046684 Bacteria 1881
366 Ga0495676_0264762 3300047321 Bacteria 1168
367 Ga0495683_0198648 3300047323 Bacteria 906
368 Ga0496100_0079600 3300048903 Bacteria 2209
369 Ga0496101_0122954 3300048904 Bacteria 1964
370 Ga0496101_1037809 3300048904 Bacteria 644
371 Ga0496102_0349172 3300048905 Bacteria 1393
372 Ga0496104_0383144 3300048907 Bacteria 1319
373 Ga0496104_0538273 3300048907 Bacteria 1079
374 Ga0496105_0156620 3300048908 Bacteria 1871
375 Ga0496106_0254552 3300048909 Bacteria 1404
376 Ga0496106_0405239 3300048909 Bacteria 1096
377 Ga0496107_0024339 3300048910 Bacteria 4284
378 Ga0496107_0085495 3300048910 Bacteria 2301
379 Ga0496108_0119621 3300048911 Bacteria 2258
380 Ga0496108_0244147 3300048911 Bacteria 1562
381 Ga0496109_0067455 3300048912 Bacteria 3277
382 Ga0496109_0120934 3300048912 Bacteria 2439
383 Ga0496110_0062465 3300048913 Bacteria 3289
384 Ga0496110_0460385 3300048913 Bacteria 1159
385 Ga0496111_0026747 3300048914 Bacteria 4075
386 Ga0496111_0153013 3300048914 Bacteria 1711
387 Ga0496112_0028088 3300048915 Bacteria 5427
388 Ga0496112_0260548 3300048915 Bacteria 1683
389 Ga0496113_0023595 3300048916 Bacteria 4362
390 Ga0496113_0053121 3300048916 Bacteria 3029
391 Ga0496113_0579592 3300048916 Bacteria 899
392 Ga0496114_0385640 3300048917 Bacteria 1241
393 Ga0496115_0759199 3300048918 Bacteria 758
394 Ga0496116_0030437 3300048919 Bacteria 3877
395 Ga0496121_0630496 3300048924 Bacteria 656
396 Ga0496124_0303892 3300048927 Bacteria 1151
397 Ga0496125_0000771 3300048928 Bacteria 52335
398 Ga0496126_0088595 3300048929 Bacteria 2726
399 Ga0496126_0643957 3300048929 Bacteria 830
400 Ga0495678_222323 3300049459 Bacteria 572
401 Ga0501069_0074083 3300049585 Bacteria 1910
402 Ga0501035_0002141 3300049822 Bacteria 19628
403 nmdc:mga0k408_226502_c1 3300050493 Bacteria 1116
404 Ga0587073_0010139 3300059492 Bacteria 1573
405 Ga0587073_0123256 3300059492 Bacteria 702
406 Ga0587082_040575 3300059504 Bacteria 852
407 Ga0587088_006571 3300059508 Bacteria 1575
408 Ga0587099_000649 3300059622 Bacteria 2127
409 Ga0587115_006533 3300059626 Bacteria 1349
410 Ga0587122_001102 3300059628 Bacteria 1684
411 Ga0587067_026364 3300059640 Bacteria 1041
412 Ga0587075_000976 3300059644 Bacteria 2601
413 Ga0587075_002052 3300059644 Bacteria 2071
414 Ga0587076_009007 3300059645 Bacteria 1408
415 Ga0587079_007627 3300059647 Bacteria 1627
416 Ga0587107_081862 3300059652 Bacteria 608
417 Ga0587071_003326 3300060344 Bacteria 2294
418 Ga0587071_005126 3300060344 Bacteria 1989
419 Ga0530510_0859146 3300061734 Bacteria 693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047321 Ga0495676_0264762 Ga0495676_0264762_361_843 125
2 3300044694 Ga0466963_0371636 Ga0466963_0371636_200_694 148
3 3300044842 Ga0466957_0218308 Ga0466957_0218308_431_916 149
4 3300025909 Ga0207705_10232760 Ga0207705_102327602 150
5 3300037471 Ga0395905_0633728 Ga0395905_0633728_75_563 150
6 3300045976 Ga0466967_0328688 Ga0466967_0328688_465_953 150
7 3300005344 Ga0070661_101303693 Ga0070661_1013036931 151
8 3300005455 Ga0070663_100021474 Ga0070663_1000214747 151
9 3300005563 Ga0068855_100543457 Ga0068855_1005434572 151
10 3300005578 Ga0068854_100039034 Ga0068854_1000390343 151
11 3300005614 Ga0068856_100298498 Ga0068856_1002984982 151
12 3300009174 Ga0105241_10650763 Ga0105241_106507632 151
13 3300013102 Ga0157371_10205836 Ga0157371_102058362 151
14 3300013104 Ga0157370_10297621 Ga0157370_102976213 151
15 3300013307 Ga0157372_10311588 Ga0157372_103115882 151
16 3300022467 Ga0224712_10087416 Ga0224712_100874162 151
17 3300025904 Ga0207647_10015866 Ga0207647_100158668 151
18 3300025932 Ga0207690_10003956 Ga0207690_100039562 151
19 3300025949 Ga0207667_10052347 Ga0207667_100523473 151
20 3300025981 Ga0207640_10185567 Ga0207640_101855673 151
21 3300026067 Ga0207678_10009286 Ga0207678_1000928611 151
22 3300026078 Ga0207702_10269221 Ga0207702_102692213 151
23 3300044735 Ga0466968_0221126 Ga0466968_0221126_225_719 151
24 iso_pu_bacteria 2501025502 2501085258 152
25 iso_pu_bacteria 2510917013 2511090682 152
26 iso_pu_bacteria 2513237096 2513657945 152
27 iso_pu_bacteria 2513237137 2513855642 152
28 iso_pu_bacteria 2513237145 2513919962 152
29 iso_pu_bacteria 2517572143 2517892182 152
30 iso_pu_bacteria 2667528175 2671120567 152
31 iso_pu_bacteria 2791355197 2793068748 152
32 iso_pu_bacteria 2885374607 2885382688 152
33 iso_pu_bacteria 2903748898 2903753957 152
34 iso_pu_bacteria 2906610324 2906617306 152
35 iso_pu_bacteria 2906635258 2906642671 152
36 iso_pu_bacteria 2906660503 2906666151 152
37 iso_pu_bacteria 2908739725 2908742457 152
38 iso_pu_bacteria 2908756301 2908760064 152
39 iso_pu_bacteria 2922425934 2922430519 152
40 iso_pu_bacteria 3005474847 3005480430 152
41 iso_pu_bacteria 8019555841 8019556515 152
42 iso_pu_bacteria 8019565922 8019568795 152
43 iso_pu_bacteria 2524023228 2524534275 153
44 iso_pu_bacteria 2904699407 2904702325 153
45 iso_pu_bacteria 2935630451 2935631447 153
46 iso_pu_bacteria 2941507105 2941510189 153
47 iso_pu_bacteria 2941515067 2941518725 153
48 iso_pu_bacteria 2941523033 2941525588 153
49 iso_pu_bacteria 8006933436 8006940446 153
50 iso_pu_bacteria 8006973647 8006980135 153
51 3300003214 JGI25165J46597_1023063 JGI25165J46597_10230631 156
52 3300006942 Ga0099824_1009385 Ga0099824_10093853 156
53 3300025261 Ga0209233_1010685 Ga0209233_10106852 156
54 3300027357 Ga0209589_1000001 Ga0209589_1000001128 156
55 3300027361 Ga0209489_100001 Ga0209489_100001128 156
56 3300027363 Ga0209700_100001 Ga0209700_100001128 156
57 3300033442 Ga0315911_1000006 Ga0315911_100000679 156
58 3300048924 Ga0496121_0630496 Ga0496121_0630496_140_613 156
59 3300061734 Ga0530510_0859146 Ga0530510_0859146_22_492 156
60 iso_pu_bacteria 2830075706 2830079112 156
61 3300046674 Ga0495588_0047366 Ga0495588_0047366_702_1178 157
62 3300047323 Ga0495683_0198648 Ga0495683_0198648_414_890 157
63 3300048904 Ga0496101_1037809 Ga0496101_1037809_145_621 157
64 3300048905 Ga0496102_0349172 Ga0496102_0349172_751_1227 157
65 3300048913 Ga0496110_0460385 Ga0496110_0460385_532_1008 157
66 3300048917 Ga0496114_0385640 Ga0496114_0385640_318_794 157
67 3300048929 Ga0496126_0088595 Ga0496126_0088595_818_1294 157
68 3300049459 Ga0495678_222323 Ga0495678_222323_41_517 157
69 iso_pu_bacteria 2941485952 2941489322 157
70 3300031824 Ga0307413_10919587 Ga0307413_109195871 158
71 3300017792 Ga0163161_10060136 Ga0163161_100601362 160
72 3300037418 Ga0395900_0904951 Ga0395900_0904951_292_774 160
73 3300037471 Ga0395905_0164749 Ga0395905_0164749_386_868 160
74 3300037471 Ga0395905_0302722 Ga0395905_0302722_21_503 160
75 3300045976 Ga0466967_2553606 Ga0466967_2553606_11_493 160
76 3300005435 Ga0070714_100046707 Ga0070714_1000467073 161
77 3300005614 Ga0068856_100702490 Ga0068856_1007024902 161
78 3300025909 Ga0207705_10131857 Ga0207705_101318572 161
79 3300025929 Ga0207664_10010609 Ga0207664_100106094 161
80 3300031824 Ga0307413_10053916 Ga0307413_100539165 161
81 3300032004 Ga0307414_10040806 Ga0307414_100408064 161
82 3300032004 Ga0307414_10061613 Ga0307414_100616133 161
83 3300032004 Ga0307414_10113482 Ga0307414_101134822 161
84 3300032004 Ga0307414_10231923 Ga0307414_102319233 161
85 3300032004 Ga0307414_11382029 Ga0307414_113820291 161
86 3300046514 Ga0495618_0784575 Ga0495618_0784575_37_525 161
87 3300048918 Ga0496115_0759199 Ga0496115_0759199_99_590 161
88 3300048927 Ga0496124_0303892 Ga0496124_0303892_30_521 161
89 iso_pu_bacteria 2894232714 2894237305 161
90 iso_pu_bacteria 2894232714 2894237672 161
91 3300001990 JGI24737J22298_10007641 JGI24737J22298_100076413 162
92 3300005327 Ga0070658_10253409 Ga0070658_102534092 162
93 3300005329 Ga0070683_100703718 Ga0070683_1007037182 162
94 3300005331 Ga0070670_100137500 Ga0070670_1001375003 162
95 3300005345 Ga0070692_10067114 Ga0070692_100671143 162
96 3300005345 Ga0070692_10370392 Ga0070692_103703922 162
97 3300005366 Ga0070659_100042901 Ga0070659_1000429015 162
98 3300005435 Ga0070714_100026118 Ga0070714_1000261182 162
99 3300005435 Ga0070714_101250025 Ga0070714_1012500252 162
100 3300005455 Ga0070663_100096243 Ga0070663_1000962432 162
101 3300005530 Ga0070679_100187294 Ga0070679_1001872943 162
102 3300005535 Ga0070684_100182045 Ga0070684_1001820452 162
103 3300005563 Ga0068855_100189224 Ga0068855_1001892242 162
104 3300005614 Ga0068856_102266082 Ga0068856_1022660821 162
105 3300005841 Ga0068863_100023410 Ga0068863_1000234107 162
106 3300006195 Ga0075366_10123360 Ga0075366_101233602 162
107 3300006358 Ga0068871_101293930 Ga0068871_1012939302 162
108 3300013100 Ga0157373_10104524 Ga0157373_101045242 162
109 3300013102 Ga0157371_10034950 Ga0157371_100349506 162
110 3300013102 Ga0157371_10134385 Ga0157371_101343853 162
111 3300013104 Ga0157370_11217405 Ga0157370_112174052 162
112 3300013105 Ga0157369_10078998 Ga0157369_100789986 162
113 3300013307 Ga0157372_10108758 Ga0157372_101087583 162
114 3300014325 Ga0163163_10154921 Ga0163163_101549213 162
115 3300020082 Ga0206353_11737401 Ga0206353_117374013 162
116 3300025904 Ga0207647_10033384 Ga0207647_100333844 162
117 3300025909 Ga0207705_10057055 Ga0207705_100570554 162
118 3300025917 Ga0207660_10001245 Ga0207660_1000124513 162
119 3300025925 Ga0207650_10397462 Ga0207650_103974623 162
120 3300025932 Ga0207690_10134008 Ga0207690_101340082 162
121 3300025932 Ga0207690_10170360 Ga0207690_101703603 162
122 3300025949 Ga0207667_10300005 Ga0207667_103000053 162
123 3300025972 Ga0207668_10844025 Ga0207668_108440252 162
124 3300026078 Ga0207702_10044154 Ga0207702_100441542 162
125 3300026088 Ga0207641_10038567 Ga0207641_100385673 162
126 3300026116 Ga0207674_10203199 Ga0207674_102031992 162
127 3300037312 Ga0395899_0101845 Ga0395899_0101845_1031_1519 162
128 3300037312 Ga0395899_0331572 Ga0395899_0331572_298_786 162
129 3300037418 Ga0395900_0018120 Ga0395900_0018120_4622_5110 162
130 3300037418 Ga0395900_0087288 Ga0395900_0087288_2444_2932 162
131 3300037466 Ga0395898_0053527 Ga0395898_0053527_1798_2286 162
132 3300037466 Ga0395898_0145732 Ga0395898_0145732_211_699 162
133 3300037471 Ga0395905_0049718 Ga0395905_0049718_554_1042 162
134 3300037471 Ga0395905_0160444 Ga0395905_0160444_1398_1886 162
135 3300037471 Ga0395905_0288281 Ga0395905_0288281_581_1069 162
136 3300038443 Ga0395901_0000041 Ga0395901_0000041_195173_195661 162
137 3300038443 Ga0395901_0193544 Ga0395901_0193544_763_1251 162
138 3300044694 Ga0466963_0676311 Ga0466963_0676311_174_662 162
139 3300044719 Ga0466971_0445348 Ga0466971_0445348_11_499 162
140 3300048929 Ga0496126_0643957 Ga0496126_0643957_167_655 162
141 3300050493 nmdc:mga0k408_226502_c1 nmdc:mga0k408_226502_c1_96_584 162
142 3300001990 JGI24737J22298_10072935 JGI24737J22298_100729351 163
143 3300005327 Ga0070658_10145231 Ga0070658_101452312 163
144 3300025909 Ga0207705_10070409 Ga0207705_100704093 163
145 3300041451 Ga0451791_0509147 Ga0451791_0509147_64_558 163
146 3300001915 JGI24741J21665_1002765 JGI24741J21665_10027655 164
147 3300001979 JGI24740J21852_10002180 JGI24740J21852_100021803 164
148 3300001979 JGI24740J21852_10051341 JGI24740J21852_100513412 164
149 3300001989 JGI24739J22299_10012451 JGI24739J22299_100124512 164
150 3300002067 JGI24735J21928_10001228 JGI24735J21928_100012283 164
151 3300002067 JGI24735J21928_10008713 JGI24735J21928_100087132 164
152 3300002067 JGI24735J21928_10021250 JGI24735J21928_100212502 164
153 3300005327 Ga0070658_10003956 Ga0070658_1000395614 164
154 3300005327 Ga0070658_10058799 Ga0070658_100587994 164
155 3300005327 Ga0070658_10107743 Ga0070658_101077432 164
156 3300005327 Ga0070658_10334541 Ga0070658_103345412 164
157 3300005327 Ga0070658_10548379 Ga0070658_105483791 164
158 3300005327 Ga0070658_10716969 Ga0070658_107169692 164
159 3300005327 Ga0070658_10967207 Ga0070658_109672071 164
160 3300005329 Ga0070683_100069686 Ga0070683_1000696862 164
161 3300005329 Ga0070683_100174677 Ga0070683_1001746772 164
162 3300005329 Ga0070683_100834755 Ga0070683_1008347552 164
163 3300005336 Ga0070680_100000197 Ga0070680_10000019738 164
164 3300005336 Ga0070680_100020621 Ga0070680_1000206217 164
165 3300005336 Ga0070680_100564933 Ga0070680_1005649331 164
166 3300005336 Ga0070680_101567570 Ga0070680_1015675701 164
167 3300005337 Ga0070682_100051490 Ga0070682_1000514903 164
168 3300005339 Ga0070660_100085239 Ga0070660_1000852393 164
169 3300005339 Ga0070660_100154181 Ga0070660_1001541812 164
170 3300005339 Ga0070660_100275706 Ga0070660_1002757061 164
171 3300005339 Ga0070660_100553885 Ga0070660_1005538852 164
172 3300005339 Ga0070660_100837432 Ga0070660_1008374322 164
173 3300005341 Ga0070691_10104491 Ga0070691_101044912 164
174 3300005341 Ga0070691_10141364 Ga0070691_101413642 164
175 3300005341 Ga0070691_10371642 Ga0070691_103716421 164
176 3300005343 Ga0070687_100614156 Ga0070687_1006141561 164
177 3300005344 Ga0070661_100049631 Ga0070661_1000496312 164
178 3300005344 Ga0070661_100616330 Ga0070661_1006163302 164
179 3300005344 Ga0070661_100724713 Ga0070661_1007247131 164
180 3300005345 Ga0070692_10050031 Ga0070692_100500314 164
181 3300005345 Ga0070692_10345951 Ga0070692_103459512 164
182 3300005345 Ga0070692_10552241 Ga0070692_105522412 164
183 3300005355 Ga0070671_100025385 Ga0070671_1000253852 164
184 3300005355 Ga0070671_100120739 Ga0070671_1001207393 164
185 3300005364 Ga0070673_100091114 Ga0070673_1000911143 164
186 3300005366 Ga0070659_100004304 Ga0070659_1000043046 164
187 3300005366 Ga0070659_100343309 Ga0070659_1003433092 164
188 3300005366 Ga0070659_100499716 Ga0070659_1004997162 164
189 3300005367 Ga0070667_100635734 Ga0070667_1006357342 164
190 3300005435 Ga0070714_100355389 Ga0070714_1003553892 164
191 3300005455 Ga0070663_100028766 Ga0070663_1000287665 164
192 3300005455 Ga0070663_100058513 Ga0070663_1000585134 164
193 3300005455 Ga0070663_100416827 Ga0070663_1004168272 164
194 3300005455 Ga0070663_101364700 Ga0070663_1013647001 164
195 3300005457 Ga0070662_100098768 Ga0070662_1000987684 164
196 3300005458 Ga0070681_10003859 Ga0070681_100038596 164
197 3300005458 Ga0070681_10112312 Ga0070681_101123124 164
198 3300005458 Ga0070681_10410193 Ga0070681_104101932 164
199 3300005459 Ga0068867_100095611 Ga0068867_1000956113 164
200 3300005530 Ga0070679_100125827 Ga0070679_1001258274 164
201 3300005530 Ga0070679_100434109 Ga0070679_1004341091 164
202 3300005535 Ga0070684_100030635 Ga0070684_1000306353 164
203 3300005535 Ga0070684_100391356 Ga0070684_1003913562 164
204 3300005539 Ga0068853_100029357 Ga0068853_1000293574 164
205 3300005539 Ga0068853_100072655 Ga0068853_1000726552 164
206 3300005539 Ga0068853_100098988 Ga0068853_1000989883 164
207 3300005539 Ga0068853_100385486 Ga0068853_1003854862 164
208 3300005543 Ga0070672_100149713 Ga0070672_1001497133 164
209 3300005547 Ga0070693_100095810 Ga0070693_1000958101 164
210 3300005563 Ga0068855_100352724 Ga0068855_1003527242 164
211 3300005563 Ga0068855_100579028 Ga0068855_1005790282 164
212 3300005564 Ga0070664_100072624 Ga0070664_1000726243 164
213 3300005564 Ga0070664_100129891 Ga0070664_1001298912 164
214 3300005564 Ga0070664_100279378 Ga0070664_1002793782 164
215 3300005577 Ga0068857_100037178 Ga0068857_1000371785 164
216 3300005577 Ga0068857_100038795 Ga0068857_1000387955 164
217 3300005577 Ga0068857_100189031 Ga0068857_1001890312 164
218 3300005578 Ga0068854_100012472 Ga0068854_1000124725 164
219 3300005578 Ga0068854_100015348 Ga0068854_1000153487 164
220 3300005578 Ga0068854_100099953 Ga0068854_1000999532 164
221 3300005578 Ga0068854_100205756 Ga0068854_1002057563 164
222 3300005578 Ga0068854_100219334 Ga0068854_1002193343 164
223 3300005614 Ga0068856_100809398 Ga0068856_1008093982 164
224 3300005614 Ga0068856_101048057 Ga0068856_1010480572 164
225 3300005614 Ga0068856_101590096 Ga0068856_1015900962 164
226 3300005616 Ga0068852_100120223 Ga0068852_1001202234 164
227 3300005616 Ga0068852_100203006 Ga0068852_1002030062 164
228 3300005616 Ga0068852_100442408 Ga0068852_1004424082 164
229 3300005617 Ga0068859_100038532 Ga0068859_1000385324 164
230 3300005618 Ga0068864_100015803 Ga0068864_1000158033 164
231 3300005618 Ga0068864_100050171 Ga0068864_1000501714 164
232 3300005834 Ga0068851_10017699 Ga0068851_100176994 164
233 3300005834 Ga0068851_10036363 Ga0068851_100363633 164
234 3300005834 Ga0068851_10358758 Ga0068851_103587582 164
235 3300005841 Ga0068863_100111732 Ga0068863_1001117324 164
236 3300006931 Ga0097620_100038532 Ga0097620_1000385326 164
237 3300009011 Ga0105251_10015937 Ga0105251_100159372 164
238 3300009093 Ga0105240_10049777 Ga0105240_100497777 164
239 3300009093 Ga0105240_10064276 Ga0105240_100642766 164
240 3300009094 Ga0111539_11494195 Ga0111539_114941951 164
241 3300009101 Ga0105247_10825933 Ga0105247_108259331 164
242 3300009545 Ga0105237_10020284 Ga0105237_100202842 164
243 3300009545 Ga0105237_10235260 Ga0105237_102352602 164
244 3300009551 Ga0105238_10032221 Ga0105238_100322215 164
245 3300013100 Ga0157373_10016222 Ga0157373_100162225 164
246 3300013100 Ga0157373_10072072 Ga0157373_100720722 164
247 3300013100 Ga0157373_10173728 Ga0157373_101737283 164
248 3300013102 Ga0157371_10032113 Ga0157371_100321133 164
249 3300013102 Ga0157371_10035748 Ga0157371_100357486 164
250 3300013102 Ga0157371_10108891 Ga0157371_101088913 164
251 3300013102 Ga0157371_10140807 Ga0157371_101408073 164
252 3300013102 Ga0157371_10244370 Ga0157371_102443702 164
253 3300013102 Ga0157371_10549620 Ga0157371_105496201 164
254 3300013104 Ga0157370_10030850 Ga0157370_100308507 164
255 3300013104 Ga0157370_10031809 Ga0157370_100318096 164
256 3300013104 Ga0157370_10066542 Ga0157370_100665422 164
257 3300013104 Ga0157370_10079692 Ga0157370_100796922 164
258 3300013104 Ga0157370_10281839 Ga0157370_102818392 164
259 3300013105 Ga0157369_10055618 Ga0157369_100556182 164
260 3300013105 Ga0157369_10260191 Ga0157369_102601913 164
261 3300013105 Ga0157369_10427577 Ga0157369_104275772 164
262 3300013105 Ga0157369_10560654 Ga0157369_105606542 164
263 3300013105 Ga0157369_11040622 Ga0157369_110406222 164
264 3300013307 Ga0157372_10002766 Ga0157372_1000276619 164
265 3300013307 Ga0157372_10105601 Ga0157372_101056015 164
266 3300013307 Ga0157372_10124379 Ga0157372_101243793 164
267 3300013307 Ga0157372_10389156 Ga0157372_103891563 164
268 3300013307 Ga0157372_10416399 Ga0157372_104163992 164
269 3300014325 Ga0163163_10511284 Ga0163163_105112842 164
270 3300014968 Ga0157379_10059760 Ga0157379_100597602 164
271 3300020069 Ga0197907_10523261 Ga0197907_105232613 164
272 3300020070 Ga0206356_10753987 Ga0206356_107539872 164
273 3300020070 Ga0206356_10805298 Ga0206356_108052982 164
274 3300020070 Ga0206356_11474859 Ga0206356_114748592 164
275 3300020082 Ga0206353_10139520 Ga0206353_101395202 164
276 3300020082 Ga0206353_10552381 Ga0206353_105523812 164
277 3300025321 Ga0207656_10093887 Ga0207656_100938872 164
278 3300025904 Ga0207647_10003088 Ga0207647_1000308813 164
279 3300025904 Ga0207647_10170265 Ga0207647_101702652 164
280 3300025904 Ga0207647_10192306 Ga0207647_101923062 164
281 3300025909 Ga0207705_10024261 Ga0207705_100242616 164
282 3300025909 Ga0207705_10055192 Ga0207705_100551923 164
283 3300025909 Ga0207705_10134373 Ga0207705_101343733 164
284 3300025909 Ga0207705_10138241 Ga0207705_101382413 164
285 3300025909 Ga0207705_10421907 Ga0207705_104219072 164
286 3300025912 Ga0207707_10003841 Ga0207707_1000384112 164
287 3300025912 Ga0207707_10116038 Ga0207707_101160382 164
288 3300025912 Ga0207707_10124753 Ga0207707_101247532 164
289 3300025912 Ga0207707_10381045 Ga0207707_103810452 164
290 3300025913 Ga0207695_10022897 Ga0207695_100228972 164
291 3300025913 Ga0207695_10028155 Ga0207695_100281556 164
292 3300025914 Ga0207671_10106463 Ga0207671_101064632 164
293 3300025914 Ga0207671_10191245 Ga0207671_101912452 164
294 3300025917 Ga0207660_10018450 Ga0207660_100184505 164
295 3300025917 Ga0207660_10039279 Ga0207660_100392795 164
296 3300025917 Ga0207660_10676343 Ga0207660_106763432 164
297 3300025917 Ga0207660_10762515 Ga0207660_107625152 164
298 3300025917 Ga0207660_11201392 Ga0207660_112013921 164
299 3300025919 Ga0207657_10021889 Ga0207657_100218894 164
300 3300025919 Ga0207657_10049375 Ga0207657_100493753 164
301 3300025919 Ga0207657_10144126 Ga0207657_101441263 164
302 3300025919 Ga0207657_10178880 Ga0207657_101788803 164
303 3300025920 Ga0207649_10001548 Ga0207649_1000154817 164
304 3300025920 Ga0207649_10003288 Ga0207649_100032886 164
305 3300025920 Ga0207649_10044088 Ga0207649_100440884 164
306 3300025921 Ga0207652_10012311 Ga0207652_100123115 164
307 3300025921 Ga0207652_10147062 Ga0207652_101470623 164
308 3300025921 Ga0207652_10180071 Ga0207652_101800713 164
309 3300025921 Ga0207652_10192730 Ga0207652_101927302 164
310 3300025921 Ga0207652_10418339 Ga0207652_104183392 164
311 3300025924 Ga0207694_10012198 Ga0207694_100121984 164
312 3300025931 Ga0207644_10619485 Ga0207644_106194852 164
313 3300025932 Ga0207690_10006257 Ga0207690_100062578 164
314 3300025932 Ga0207690_10009691 Ga0207690_100096914 164
315 3300025932 Ga0207690_10264587 Ga0207690_102645872 164
316 3300025933 Ga0207706_10003286 Ga0207706_1000328611 164
317 3300025933 Ga0207706_10137577 Ga0207706_101375774 164
318 3300025941 Ga0207711_10013733 Ga0207711_100137338 164
319 3300025944 Ga0207661_10532124 Ga0207661_105321242 164
320 3300025944 Ga0207661_10679149 Ga0207661_106791492 164
321 3300025945 Ga0207679_10282695 Ga0207679_102826952 164
322 3300025945 Ga0207679_10309733 Ga0207679_103097332 164
323 3300025949 Ga0207667_10012556 Ga0207667_100125566 164
324 3300025949 Ga0207667_10446013 Ga0207667_104460132 164
325 3300025960 Ga0207651_10387877 Ga0207651_103878771 164
326 3300025961 Ga0207712_10773970 Ga0207712_107739702 164
327 3300025981 Ga0207640_10006261 Ga0207640_100062617 164
328 3300025981 Ga0207640_10014231 Ga0207640_100142313 164
329 3300025981 Ga0207640_10021744 Ga0207640_100217442 164
330 3300025981 Ga0207640_10235092 Ga0207640_102350922 164
331 3300025981 Ga0207640_10262839 Ga0207640_102628392 164
332 3300025986 Ga0207658_10027084 Ga0207658_100270844 164
333 3300026041 Ga0207639_10000289 Ga0207639_100002896 164
334 3300026041 Ga0207639_10026310 Ga0207639_100263103 164
335 3300026041 Ga0207639_10042087 Ga0207639_100420874 164
336 3300026067 Ga0207678_10008361 Ga0207678_100083613 164
337 3300026067 Ga0207678_10018808 Ga0207678_100188088 164
338 3300026067 Ga0207678_10028075 Ga0207678_100280755 164
339 3300026067 Ga0207678_10137296 Ga0207678_101372962 164
340 3300026067 Ga0207678_10140889 Ga0207678_101408893 164
341 3300026078 Ga0207702_10399688 Ga0207702_103996882 164
342 3300026078 Ga0207702_10583636 Ga0207702_105836361 164
343 3300026078 Ga0207702_10645550 Ga0207702_106455502 164
344 3300026088 Ga0207641_10127944 Ga0207641_101279443 164
345 3300026088 Ga0207641_10136612 Ga0207641_101366124 164
346 3300026089 Ga0207648_10013255 Ga0207648_100132558 164
347 3300026095 Ga0207676_10191150 Ga0207676_101911502 164
348 3300026095 Ga0207676_10236689 Ga0207676_102366893 164
349 3300026116 Ga0207674_10000859 Ga0207674_1000085921 164
350 3300026116 Ga0207674_10007432 Ga0207674_100074326 164
351 3300026116 Ga0207674_10008100 Ga0207674_1000810010 164
352 3300026116 Ga0207674_10018416 Ga0207674_100184167 164
353 3300026116 Ga0207674_10076557 Ga0207674_100765573 164
354 3300026142 Ga0207698_10012407 Ga0207698_100124073 164
355 3300026142 Ga0207698_10125273 Ga0207698_101252733 164
356 3300026142 Ga0207698_10206355 Ga0207698_102063552 164
357 3300026142 Ga0207698_10237895 Ga0207698_102378953 164
358 3300031911 Ga0307412_11316778 Ga0307412_113167782 164
359 3300035241 Ga0373961_0345552 Ga0373961_0345552_11_508 164
360 3300037312 Ga0395899_0009786 Ga0395899_0009786_847_1344 164
361 3300037312 Ga0395899_0198314 Ga0395899_0198314_321_815 164
362 3300037312 Ga0395899_0265901 Ga0395899_0265901_219_713 164
363 3300037312 Ga0395899_0333568 Ga0395899_0333568_345_839 164
364 3300037418 Ga0395900_0000192 Ga0395900_0000192_37274_37771 164
365 3300037418 Ga0395900_0015409 Ga0395900_0015409_5893_6405 164
366 3300037418 Ga0395900_0138756 Ga0395900_0138756_720_1214 164
367 3300037418 Ga0395900_0175263 Ga0395900_0175263_1011_1505 164
368 3300037418 Ga0395900_0181669 Ga0395900_0181669_76_570 164
369 3300037418 Ga0395900_0238041 Ga0395900_0238041_765_1262 164
370 3300037418 Ga0395900_1203304 Ga0395900_1203304_138_635 164
371 3300037418 Ga0395900_1242548 Ga0395900_1242548_132_626 164
372 3300037466 Ga0395898_0000055 Ga0395898_0000055_237189_237686 164
373 3300037466 Ga0395898_0019008 Ga0395898_0019008_3144_3656 164
374 3300037466 Ga0395898_0038740 Ga0395898_0038740_3961_4455 164
375 3300037466 Ga0395898_0434670 Ga0395898_0434670_376_870 164
376 3300037466 Ga0395898_1074047 Ga0395898_1074047_224_718 164
377 3300037471 Ga0395905_0000067 Ga0395905_0000067_40872_41369 164
378 3300037471 Ga0395905_0014745 Ga0395905_0014745_1388_1900 164
379 3300037471 Ga0395905_0081311 Ga0395905_0081311_1481_1975 164
380 3300037471 Ga0395905_0083351 Ga0395905_0083351_1858_2352 164
381 3300037471 Ga0395905_0246279 Ga0395905_0246279_621_1118 164
382 3300037471 Ga0395905_0272285 Ga0395905_0272285_208_702 164
383 3300037471 Ga0395905_0274345 Ga0395905_0274345_683_1177 164
384 3300037471 Ga0395905_0611291 Ga0395905_0611291_201_695 164
385 3300037471 Ga0395905_0882042 Ga0395905_0882042_159_653 164
386 3300037471 Ga0395905_1155588 Ga0395905_1155588_60_554 164
387 3300037853 Ga0436364_0653289 Ga0436364_0653289_1133_1630 164
388 3300038443 Ga0395901_0003222 Ga0395901_0003222_7549_8046 164
389 3300038443 Ga0395901_0006034 Ga0395901_0006034_10080_10592 164
390 3300038443 Ga0395901_0010662 Ga0395901_0010662_1411_1905 164
391 3300038443 Ga0395901_0011951 Ga0395901_0011951_330_824 164
392 3300038443 Ga0395901_0076679 Ga0395901_0076679_2451_2945 164
393 3300038443 Ga0395901_0209259 Ga0395901_0209259_608_1102 164
394 3300038443 Ga0395901_0775320 Ga0395901_0775320_121_615 164
395 3300038443 Ga0395901_1159179 Ga0395901_1159179_124_618 164
396 3300038443 Ga0395901_1430481 Ga0395901_1430481_48_545 164
397 3300044658 Ga0466972_0067319 Ga0466972_0067319_863_1360 164
398 3300044683 Ga0466965_0543359 Ga0466965_0543359_105_602 164
399 3300044684 Ga0466966_0165268 Ga0466966_0165268_497_991 164
400 3300044693 Ga0466961_0118357 Ga0466961_0118357_907_1401 164
401 3300044694 Ga0466963_0326585 Ga0466963_0326585_288_782 164
402 3300044765 Ga0466970_0397091 Ga0466970_0397091_71_565 164
403 3300044842 Ga0466957_0129948 Ga0466957_0129948_472_966 164
404 3300044901 Ga0466960_0009083 Ga0466960_0009083_2124_2621 164
405 3300045836 Ga0466958_0250233 Ga0466958_0250233_584_1078 164
406 3300045836 Ga0466958_0359731 Ga0466958_0359731_219_713 164
407 3300045976 Ga0466967_0108045 Ga0466967_0108045_122_676 164
408 3300045976 Ga0466967_0204776 Ga0466967_0204776_186_680 164
409 3300045976 Ga0466967_0532022 Ga0466967_0532022_131_628 164
410 3300046684 Ga0495669_0049557 Ga0495669_0049557_509_1003 164
411 3300048903 Ga0496100_0079600 Ga0496100_0079600_259_753 164
412 3300048904 Ga0496101_0122954 Ga0496101_0122954_1150_1644 164
413 3300048907 Ga0496104_0383144 Ga0496104_0383144_532_1026 164
414 3300048907 Ga0496104_0538273 Ga0496104_0538273_36_533 164
415 3300048908 Ga0496105_0156620 Ga0496105_0156620_1282_1776 164
416 3300048909 Ga0496106_0254552 Ga0496106_0254552_275_769 164
417 3300048909 Ga0496106_0405239 Ga0496106_0405239_79_573 164
418 3300048910 Ga0496107_0024339 Ga0496107_0024339_3128_3622 164
419 3300048910 Ga0496107_0085495 Ga0496107_0085495_1729_2223 164
420 3300048911 Ga0496108_0119621 Ga0496108_0119621_1736_2230 164
421 3300048911 Ga0496108_0244147 Ga0496108_0244147_1012_1506 164
422 3300048912 Ga0496109_0067455 Ga0496109_0067455_2768_3262 164
423 3300048912 Ga0496109_0120934 Ga0496109_0120934_1286_1780 164
424 3300048913 Ga0496110_0062465 Ga0496110_0062465_1919_2413 164
425 3300048914 Ga0496111_0026747 Ga0496111_0026747_2276_2770 164
426 3300048914 Ga0496111_0153013 Ga0496111_0153013_941_1435 164
427 3300048915 Ga0496112_0028088 Ga0496112_0028088_3645_4157 164
428 3300048915 Ga0496112_0260548 Ga0496112_0260548_499_993 164
429 3300048916 Ga0496113_0023595 Ga0496113_0023595_2209_2703 164
430 3300048916 Ga0496113_0053121 Ga0496113_0053121_1228_1740 164
431 3300048916 Ga0496113_0579592 Ga0496113_0579592_277_771 164
432 3300048919 Ga0496116_0030437 Ga0496116_0030437_2581_3081 164
433 3300048928 Ga0496125_0000771 Ga0496125_0000771_9747_10247 164
434 3300049585 Ga0501069_0074083 Ga0501069_0074083_295_792 164
435 3300049822 Ga0501035_0002141 Ga0501035_0002141_18154_18834 164
436 3300059492 Ga0587073_0010139 Ga0587073_0010139_348_845 164
437 3300059492 Ga0587073_0123256 Ga0587073_0123256_104_598 164
438 3300059504 Ga0587082_040575 Ga0587082_040575_150_644 164
439 3300059508 Ga0587088_006571 Ga0587088_006571_535_1032 164
440 3300059622 Ga0587099_000649 Ga0587099_000649_726_1223 164
441 3300059626 Ga0587115_006533 Ga0587115_006533_729_1226 164
442 3300059628 Ga0587122_001102 Ga0587122_001102_729_1223 164
443 3300059640 Ga0587067_026364 Ga0587067_026364_145_642 164
444 3300059644 Ga0587075_000976 Ga0587075_000976_1134_1631 164
445 3300059644 Ga0587075_002052 Ga0587075_002052_1392_1886 164
446 3300059645 Ga0587076_009007 Ga0587076_009007_486_983 164
447 3300059647 Ga0587079_007627 Ga0587079_007627_327_824 164
448 3300059652 Ga0587107_081862 Ga0587107_081862_82_576 164
449 3300060344 Ga0587071_003326 Ga0587071_003326_781_1278 164
450 3300060344 Ga0587071_005126 Ga0587071_005126_1374_1868 164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

23

140

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9488 3 157
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9474 3 157
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9467 3 157
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9363 3 157
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9357 3 157
ID Description Score Start End Superfamily
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9441 3 157 3.10.180.10
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9314 3 157 3.10.180.10
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8835 76 121 3.30.720.110
af_P9WLN7_64_211_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7803 101 121 3.50.50.60
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7506 9 117 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A534H6Z1-F1-model_v4 VOC family protein 0.9847 81 159
AF-A0A520HVK6-F1-model_v4 VOC family protein 0.9813 3 144
AF-A0A091B7S7-F1-model_v4 PhnB-like domain-containing protein 0.9805 56 159
AF-A0A3B9YS34-F1-model_v4 PhnB-like domain-containing protein 0.9765 3 107
AF-A0A7W7ZHY8-F1-model_v4 Putative 3-demethylubiquinone-9 3-methyltransferase (Glyoxalase superfamily) 0.9744 1 123 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
90.39 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map