metagRoot

F446646

General Info

Members	Datasets	Scaffolds	Average Seq Length
450	220	450	319

Family's Representative Sequence

Representative Sequence	3300044706\|Ga0466964_0027065\|Ga0466964_0027065_58_1044
Length	328
Sequence	VIITVTLNTAIDKTLSVPNLRLGRRHRSVEQTTMPGGKGVNVARVLKTLGAPVIATGLAGGATGRQLVDQLTQLSVLSDFVTIAEESRTNTALIDPTTGEQTEINERGPRVAEAEIELFVEKLLYLAKGASWCVFAGSLPAEVDSDLYARLIRELKRMEVKTVVDTDGDPLRRTVRAEPDIISPNVLEAEELVGHEFNDDEDRMIAVREMRELGARAAIMTMHDGCFALIPPDKDEPGDPVLYRVRLAPGAIEPRGTVGSGDAFLAGYIASRYTGKPTEEALAFAVACGAESTQHLGAGLVDPDRVGRLRSDITVDRPELEAPVRPHS

Samples

	Sample ID	Description	Type	Environment
1	3300003373	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
2	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
3	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
4	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
5	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
6	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
7	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
8	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
9	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
10	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
11	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
12	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
13	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
14	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
15	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
16	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
17	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
18	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
19	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
20	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
21	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
22	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
23	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
24	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
25	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
26	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
27	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
28	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
29	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
30	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
31	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
32	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
33	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
34	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
35	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
36	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
37	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
38	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
39	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
40	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
41	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
42	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
43	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
44	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
45	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
46	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
47	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
48	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
49	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
50	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
51	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
52	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
53	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
54	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
55	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
56	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
57	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
58	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
59	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
60	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
61	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
62	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
63	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
64	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
65	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
66	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
67	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
68	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
69	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
70	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
71	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
72	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
73	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
74	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
75	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
76	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
77	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
78	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
79	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
80	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
81	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
82	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
83	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
84	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
132	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
135	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
136	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
137	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
138	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
139	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
140	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
141	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
142	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
143	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
144	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
145	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
146	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
147	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
148	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
149	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
150	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
151	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
152	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
153	3300042119	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902	Metagenome	Rhizosphere
154	3300042137	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519	Metagenome	Rhizosphere
155	3300042142	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610	Metagenome	Rhizosphere
156	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
157	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
158	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
159	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
160	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
161	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
162	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
163	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
164	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
165	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
166	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
167	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
168	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
169	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
170	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
171	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
172	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
173	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
174	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
175	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
176	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
177	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
178	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
179	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
180	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
181	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
182	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
183	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
184	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
185	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
186	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
187	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
188	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
189	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
190	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
191	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
192	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
193	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
194	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
195	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
196	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
197	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
198	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
199	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
200	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
201	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
202	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
203	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
204	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
205	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
206	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
207	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
208	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
209	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
210	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
211	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
212	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
213	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
214	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
215	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
216	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
217	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
218	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
219	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
220	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.78
Metatranscriptomes	0.22
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.67
Nodule	0
Rhizoplane	7.78
Rhizosphere	91.33
Stem	0
Stem Tuber	0
Unclassified	0.22

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25407J50210_10006116	3300003373	Bacteria	2985
2	JGI25407J50210_10019258	3300003373	Bacteria	1774
3	Ga0070683_100025141	3300005329	Bacteria	5344
4	Ga0070690_100165950	3300005330	Bacteria	1517
5	Ga0068869_100152791	3300005334	Bacteria	1791
6	Ga0068869_100226008	3300005334	Bacteria	1485
7	Ga0070680_100001187	3300005336	Bacteria	18758
8	Ga0070680_100042736	3300005336	Bacteria	3679
9	Ga0070680_100052231	3300005336	Bacteria	3336
10	Ga0070682_100005813	3300005337	Bacteria	6887
11	Ga0068868_100006726	3300005338	Bacteria	8161
12	Ga0068868_100060382	3300005338	Bacteria	3002
13	Ga0068868_100318332	3300005338	Bacteria	1325
14	Ga0070660_100016262	3300005339	Bacteria	5396
15	Ga0070660_100041779	3300005339	Bacteria	3496
16	Ga0070689_100028617	3300005340	Bacteria	4213
17	Ga0070691_10055438	3300005341	Bacteria	1899
18	Ga0070692_10020795	3300005345	Bacteria	3185
19	Ga0070692_10023327	3300005345	Bacteria	3031
20	Ga0070692_10107907	3300005345	Bacteria	1536
21	Ga0070668_100021351	3300005347	Bacteria	4891
22	Ga0070668_100039218	3300005347	Bacteria	3622
23	Ga0070668_100102398	3300005347	Bacteria	2270
24	Ga0070675_100010151	3300005354	Bacteria	7344
25	Ga0070675_100086203	3300005354	Bacteria	2624
26	Ga0070674_100019225	3300005356	Bacteria	4336
27	Ga0070674_100025931	3300005356	Bacteria	3822
28	Ga0070674_100071990	3300005356	Bacteria	2446
29	Ga0070673_100003981	3300005364	Bacteria	9297
30	Ga0070688_100274008	3300005365	Bacteria	1210
31	Ga0070659_100002630	3300005366	Bacteria	12777
32	Ga0070659_100041567	3300005366	Bacteria	3595
33	Ga0070659_100050664	3300005366	Bacteria	3263
34	Ga0070659_100206135	3300005366	Bacteria	1619
35	Ga0070713_100017801	3300005436	Bacteria	5388
36	Ga0070701_10032094	3300005438	Bacteria	2612
37	Ga0070701_10202933	3300005438	Bacteria	1173
38	Ga0070705_100351237	3300005440	Bacteria	1075
39	Ga0070700_100004505	3300005441	Bacteria	7281
40	Ga0070700_100061035	3300005441	Bacteria	2378
41	Ga0070700_100114019	3300005441	Bacteria	1801
42	Ga0070700_100154377	3300005441	Bacteria	1573
43	Ga0070678_100071816	3300005456	Bacteria	2592
44	Ga0070678_100197903	3300005456	Bacteria	1656
45	Ga0070662_100006834	3300005457	Bacteria	7376
46	Ga0070662_100013245	3300005457	Bacteria	5483
47	Ga0070662_100097792	3300005457	Bacteria	2216
48	Ga0070662_100365553	3300005457	Bacteria	1185
49	Ga0070681_10002872	3300005458	Bacteria	15923
50	Ga0070685_10009419	3300005466	Bacteria	5045
51	Ga0070679_100013048	3300005530	Bacteria	7954
52	Ga0070679_100114099	3300005530	Bacteria	2687
53	Ga0070684_100004356	3300005535	Bacteria	10759
54	Ga0070684_100004410	3300005535	Bacteria	10712
55	Ga0070684_100069430	3300005535	Bacteria	3098
56	Ga0070684_100402717	3300005535	Bacteria	1262
57	Ga0070672_100027440	3300005543	Bacteria	4246
58	Ga0070672_100029908	3300005543	Bacteria	4088
59	Ga0070693_100076600	3300005547	Bacteria	1983
60	Ga0070665_100041989	3300005548	Bacteria	4597
61	Ga0070704_100058269	3300005549	Bacteria	2750
62	Ga0070704_100215058	3300005549	Bacteria	1559
63	Ga0068855_100052554	3300005563	Bacteria	4796
64	Ga0070664_100013548	3300005564	Bacteria	6644
65	Ga0070664_100024053	3300005564	Bacteria	5035
66	Ga0068857_100227214	3300005577	Bacteria	1706
67	Ga0068854_100030664	3300005578	Bacteria	3731
68	Ga0068854_100252423	3300005578	Bacteria	1409
69	Ga0068856_100001409	3300005614	Bacteria	25206
70	Ga0070702_100125809	3300005615	Bacteria	1611
71	Ga0068852_100035594	3300005616	Bacteria	4155
72	Ga0068852_100052553	3300005616	Bacteria	3502
73	Ga0068859_100040976	3300005617	Bacteria	4652
74	Ga0068864_100008628	3300005618	Bacteria	8409
75	Ga0068864_100036391	3300005618	Bacteria	4196
76	Ga0068861_100005932	3300005719	Bacteria	8298
77	Ga0068861_100007341	3300005719	Bacteria	7551
78	Ga0068861_100052221	3300005719	Bacteria	3106
79	Ga0068861_100245682	3300005719	Bacteria	1524
80	Ga0068863_100349868	3300005841	Bacteria	1439
81	Ga0068858_100275080	3300005842	Bacteria	1603
82	Ga0081455_10011010	3300005937	Bacteria	9112
83	Ga0081455_10076849	3300005937	Bacteria	2749
84	Ga0081455_10104189	3300005937	Bacteria	2270
85	Ga0081538_10000018	3300005981	Bacteria	143542
86	Ga0081538_10000500	3300005981	Bacteria	43814
87	Ga0081538_10001017	3300005981	Bacteria	29941
88	Ga0081538_10001110	3300005981	Bacteria	28504
89	Ga0081538_10001514	3300005981	Bacteria	23833
90	Ga0081538_10001640	3300005981	Bacteria	22960
91	Ga0081538_10002046	3300005981	Bacteria	20129
92	Ga0081538_10004075	3300005981	Bacteria	13591
93	Ga0081538_10004675	3300005981	Bacteria	12546
94	Ga0081538_10004875	3300005981	Bacteria	12216
95	Ga0081538_10011691	3300005981	Bacteria	7094
96	Ga0081538_10015362	3300005981	Bacteria	5932
97	Ga0081538_10019191	3300005981	Bacteria	5096
98	Ga0081538_10023479	3300005981	Bacteria	4432
99	Ga0081538_10026202	3300005981	Bacteria	4084
100	Ga0081538_10067312	3300005981	Bacteria	2001
101	Ga0081540_1018999	3300005983	Bacteria	4195
102	Ga0081539_10000855	3300005985	Bacteria	58253
103	Ga0070717_10208831	3300006028	Unclassified	1713
104	Ga0075365_10112585	3300006038	Bacteria	1871
105	Ga0075432_10059183	3300006058	Bacteria	1362
106	Ga0070712_100298581	3300006175	Unclassified	1303
107	Ga0075428_100012114	3300006844	Bacteria	9594
108	Ga0075428_100022208	3300006844	Bacteria	7025
109	Ga0075428_100314362	3300006844	Bacteria	1684
110	Ga0075430_100004701	3300006846	Bacteria	11482
111	Ga0075430_100005054	3300006846	Bacteria	11103
112	Ga0075430_100018177	3300006846	Bacteria	5984
113	Ga0075430_100074891	3300006846	Bacteria	2838
114	Ga0075430_100112515	3300006846	Bacteria	2269
115	Ga0075430_100409148	3300006846	Bacteria	1120
116	Ga0075431_100003238	3300006847	Bacteria	15768
117	Ga0075431_100025761	3300006847	Bacteria	6027
118	Ga0075431_100063697	3300006847	Bacteria	3805
119	Ga0075433_10005224	3300006852	Bacteria	10174
120	Ga0075433_10009344	3300006852	Bacteria	7839
121	Ga0075433_10117939	3300006852	Bacteria	2356
122	Ga0075433_10120492	3300006852	Bacteria	2329
123	Ga0075434_100003191	3300006871	Bacteria	14624
124	Ga0075434_100029566	3300006871	Bacteria	5391
125	Ga0075434_100486733	3300006871	Bacteria	1255
126	Ga0075429_100006521	3300006880	Bacteria	10107
127	Ga0075429_100058415	3300006880	Bacteria	3359
128	Ga0075429_100270678	3300006880	Bacteria	1488
129	Ga0075436_100023245	3300006914	Bacteria	4257
130	Ga0097620_100040976	3300006931	Bacteria	4652
131	Ga0075435_100102943	3300007076	Bacteria	2367
132	Ga0111539_10030332	3300009094	Bacteria	6574
133	Ga0111539_10050614	3300009094	Bacteria	4949
134	Ga0111539_10176824	3300009094	Bacteria	2493
135	Ga0111539_10313148	3300009094	Bacteria	1827
136	Ga0111539_10313206	3300009094	Bacteria	1827
137	Ga0111539_10530795	3300009094	Bacteria	1371
138	Ga0111539_10595970	3300009094	Bacteria	1287
139	Ga0111539_10758046	3300009094	Bacteria	1130
140	Ga0105245_10012648	3300009098	Bacteria	7348
141	Ga0105245_10038221	3300009098	Bacteria	4271
142	Ga0105245_10302630	3300009098	Bacteria	1569
143	Ga0105245_10635727	3300009098	Bacteria	1096
144	Ga0114129_10003187	3300009147	Bacteria	23006
145	Ga0114129_10006305	3300009147	Bacteria	16820
146	Ga0114129_10011648	3300009147	Bacteria	12518
147	Ga0114129_10067067	3300009147	Bacteria	5005
148	Ga0114129_10082257	3300009147	Bacteria	4475
149	Ga0114129_10115528	3300009147	Bacteria	3699
150	Ga0114129_10173598	3300009147	Bacteria	2937
151	Ga0114129_10198292	3300009147	Bacteria	2721
152	Ga0114129_10538048	3300009147	Bacteria	1521
153	Ga0114129_10646468	3300009147	Bacteria	1365
154	Ga0105243_10008859	3300009148	Bacteria	7701
155	Ga0105243_10035596	3300009148	Bacteria	3860
156	Ga0105243_10048977	3300009148	Bacteria	3333
157	Ga0105243_10081672	3300009148	Bacteria	2640
158	Ga0105243_10399972	3300009148	Bacteria	1276
159	Ga0105242_10019678	3300009176	Bacteria	5290
160	Ga0105248_10073846	3300009177	Bacteria	3833
161	Ga0105248_10317109	3300009177	Bacteria	1756
162	Ga0105237_10021595	3300009545	Bacteria	6617
163	Ga0105238_10006637	3300009551	Bacteria	11536
164	Ga0105238_10166082	3300009551	Bacteria	2183
165	Ga0105238_10182166	3300009551	Unclassified	2077
166	Ga0105249_10148850	3300009553	Bacteria	2252
167	Ga0105249_10291634	3300009553	Bacteria	1633
168	Ga0105239_10146510	3300010375	Bacteria	2634
169	Ga0105246_10061711	3300011119	Bacteria	2609
170	Ga0157371_10006665	3300013102	Bacteria	9452
171	Ga0157371_10188756	3300013102	Bacteria	1475
172	Ga0157369_10031148	3300013105	Bacteria	5878
173	Ga0157374_10015293	3300013296	Bacteria	6729
174	Ga0157374_10068540	3300013296	Bacteria	3338
175	Ga0157378_10242980	3300013297	Bacteria	1720
176	Ga0163162_10065466	3300013306	Bacteria	3681
177	Ga0163162_10150767	3300013306	Bacteria	2443
178	Ga0163162_10229699	3300013306	Bacteria	1986
179	Ga0157372_10007829	3300013307	Bacteria	11349
180	Ga0157372_10017114	3300013307	Bacteria	7781
181	Ga0157375_10021237	3300013308	Bacteria	5949
182	Ga0157375_10046804	3300013308	Bacteria	4220
183	Ga0157375_10581294	3300013308	Bacteria	1280
184	Ga0163163_10176535	3300014325	Bacteria	2183
185	Ga0163163_10669513	3300014325	Bacteria	1101
186	Ga0157380_10083086	3300014326	Bacteria	2622
187	Ga0157377_10022985	3300014745	Bacteria	3299
188	Ga0157377_10180322	3300014745	Bacteria	1328
189	Ga0157379_10057745	3300014968	Bacteria	3468
190	Ga0206353_10034427	3300020082	Bacteria	4356
191	Ga0207656_10056971	3300025321	Bacteria	1704
192	Ga0207642_10006310	3300025899	Bacteria	3932
193	Ga0207710_10028596	3300025900	Bacteria	2420
194	Ga0207688_10007602	3300025901	Bacteria	5899
195	Ga0207688_10023691	3300025901	Bacteria	3364
196	Ga0207688_10098329	3300025901	Bacteria	1687
197	Ga0207645_10150040	3300025907	Bacteria	1521
198	Ga0207643_10157010	3300025908	Bacteria	1367
199	Ga0207705_10174517	3300025909	Bacteria	1619
200	Ga0207705_10207794	3300025909	Bacteria	1485
201	Ga0207707_10004634	3300025912	Bacteria	12072
202	Ga0207707_10197659	3300025912	Bacteria	1753
203	Ga0207695_10059957	3300025913	Bacteria	3943
204	Ga0207693_10008735	3300025915	Bacteria	8282
205	Ga0207660_10013572	3300025917	Bacteria	5341
206	Ga0207660_10295273	3300025917	Unclassified	1289
207	Ga0207657_10003497	3300025919	Bacteria	16771
208	Ga0207657_10019931	3300025919	Bacteria	6354
209	Ga0207649_10029281	3300025920	Bacteria	3252
210	Ga0207652_10005694	3300025921	Bacteria	10115
211	Ga0207652_10038709	3300025921	Bacteria	4044
212	Ga0207681_10163774	3300025923	Bacteria	1679
213	Ga0207659_10086825	3300025926	Bacteria	2327
214	Ga0207687_10201669	3300025927	Bacteria	1555
215	Ga0207687_10205036	3300025927	Bacteria	1544
216	Ga0207700_10000028	3300025928	Bacteria	135555
217	Ga0207690_10014089	3300025932	Bacteria	4821
218	Ga0207690_10023662	3300025932	Bacteria	3836
219	Ga0207690_10025440	3300025932	Bacteria	3717
220	Ga0207706_10013629	3300025933	Bacteria	7383
221	Ga0207706_10023974	3300025933	Bacteria	5475
222	Ga0207706_10142478	3300025933	Bacteria	2108
223	Ga0207686_10101579	3300025934	Bacteria	1921
224	Ga0207709_10032104	3300025935	Bacteria	3073
225	Ga0207709_10120925	3300025935	Bacteria	1768
226	Ga0207670_10010728	3300025936	Bacteria	5288
227	Ga0207669_10002615	3300025937	Bacteria	7702
228	Ga0207669_10186474	3300025937	Bacteria	1492
229	Ga0207704_10029766	3300025938	Bacteria	3051
230	Ga0207691_10149382	3300025940	Bacteria	2055
231	Ga0207691_10209150	3300025940	Bacteria	1695
232	Ga0207711_10404683	3300025941	Bacteria	1268
233	Ga0207689_10023855	3300025942	Bacteria	5132
234	Ga0207661_10000288	3300025944	Bacteria	31795
235	Ga0207661_10203743	3300025944	Bacteria	1740
236	Ga0207661_10209034	3300025944	Bacteria	1719
237	Ga0207679_10065883	3300025945	Bacteria	2712
238	Ga0207679_10166357	3300025945	Bacteria	1811
239	Ga0207651_10042661	3300025960	Bacteria	3021
240	Ga0207712_10010522	3300025961	Bacteria	5872
241	Ga0207712_10061252	3300025961	Bacteria	2670
242	Ga0207712_10065956	3300025961	Bacteria	2586
243	Ga0207668_10008826	3300025972	Bacteria	6025
244	Ga0207668_10135251	3300025972	Bacteria	1888
245	Ga0207668_10212456	3300025972	Bacteria	1548
246	Ga0207640_10050223	3300025981	Bacteria	2704
247	Ga0207640_10105544	3300025981	Bacteria	1985
248	Ga0207677_10013432	3300026023	Bacteria	4746
249	Ga0207677_10018873	3300026023	Bacteria	4150
250	Ga0207677_10317198	3300026023	Bacteria	1294
251	Ga0207703_10073616	3300026035	Bacteria	2826
252	Ga0207703_10469736	3300026035	Bacteria	1177
253	Ga0207639_10100763	3300026041	Bacteria	2334
254	Ga0207639_10209741	3300026041	Bacteria	1676
255	Ga0207678_10019381	3300026067	Bacteria	5976
256	Ga0207678_10071702	3300026067	Bacteria	2970
257	Ga0207678_10094813	3300026067	Bacteria	2550
258	Ga0207708_10006108	3300026075	Bacteria	8930
259	Ga0207708_10008033	3300026075	Bacteria	7823
260	Ga0207708_10037140	3300026075	Bacteria	3710
261	Ga0207708_10163032	3300026075	Bacteria	1761
262	Ga0207708_10207796	3300026075	Bacteria	1564
263	Ga0207702_10015018	3300026078	Bacteria	6422
264	Ga0207641_10056680	3300026088	Bacteria	3331
265	Ga0207641_10429813	3300026088	Bacteria	1273
266	Ga0207648_10020778	3300026089	Bacteria	5910
267	Ga0207676_10423649	3300026095	Bacteria	1249
268	Ga0207674_10095507	3300026116	Bacteria	2958
269	Ga0207675_100002986	3300026118	Bacteria	16622
270	Ga0207675_100021842	3300026118	Bacteria	5958
271	Ga0207675_100028556	3300026118	Bacteria	5194
272	Ga0207675_100095386	3300026118	Bacteria	2799
273	Ga0207675_100133517	3300026118	Bacteria	2354
274	Ga0207683_10236722	3300026121	Bacteria	1665
275	Ga0207683_10263454	3300026121	Bacteria	1574
276	Ga0207698_10002735	3300026142	Bacteria	10509
277	Ga0207698_10072699	3300026142	Bacteria	2735
278	Ga0207698_10077610	3300026142	Bacteria	2664
279	Ga0207698_10210324	3300026142	Bacteria	1750
280	Ga0207428_10090221	3300027907	Bacteria	2381
281	Ga0207428_10193077	3300027907	Bacteria	1534
282	Ga0207428_10295141	3300027907	Bacteria	1200
283	Ga0268266_10031300	3300028379	Bacteria	4517
284	Ga0268266_10152402	3300028379	Bacteria	2085
285	Ga0268264_10095063	3300028381	Bacteria	2578
286	Ga0307408_100084739	3300031548	Bacteria	2378
287	Ga0307405_10023435	3300031731	Bacteria	3508
288	Ga0307405_10101454	3300031731	Bacteria	1931
289	Ga0307413_10052880	3300031824	Bacteria	2456
290	Ga0307413_10067065	3300031824	Bacteria	2242
291	Ga0307413_10241786	3300031824	Bacteria	1333
292	Ga0307410_10187414	3300031852	Bacteria	1571
293	Ga0307406_10153233	3300031901	Bacteria	1647
294	Ga0307412_10176914	3300031911	Bacteria	1601
295	Ga0307412_10473597	3300031911	Bacteria	1037
296	Ga0307409_100004311	3300031995	Bacteria	7964
297	Ga0307409_100049872	3300031995	Bacteria	3194
298	Ga0307409_100097428	3300031995	Bacteria	2429
299	Ga0307409_100108461	3300031995	Bacteria	2322
300	Ga0307409_100191062	3300031995	Bacteria	1823
301	Ga0307409_100407683	3300031995	Bacteria	1300
302	Ga0307416_100120272	3300032002	Bacteria	2338
303	Ga0307416_100138415	3300032002	Bacteria	2207
304	Ga0307415_100004521	3300032126	Bacteria	7236
305	Ga0307415_100096585	3300032126	Bacteria	2154
306	Ga0307415_100210084	3300032126	Bacteria	1552
307	Ga0307415_100226082	3300032126	Bacteria	1504
308	Ga0373959_0007575	3300034820	Bacteria	1828
309	Ga0373949_0021828	3300035090	Bacteria	1472
310	Ga0373952_0046939	3300035092	Bacteria	1017
311	Ga0373939_0018692	3300035114	Bacteria	1861
312	Ga0373941_0013628	3300035115	Bacteria	2154
313	Ga0373941_0034060	3300035115	Bacteria	1534
314	Ga0373931_0009457	3300035691	Bacteria	4662
315	Ga0373937_0055547	3300036401	Bacteria	3635
316	Ga0395898_0644061	3300037466	Bacteria	1002
317	Ga0395898_0663393	3300037466	Bacteria	985
318	Ga0395898_0676679	3300037466	Bacteria	974
319	Ga0395901_0038476	3300038443	Bacteria	4948
320	Ga0395901_0266878	3300038443	Unclassified	1781
321	Ga0395901_0381827	3300038443	Bacteria	1450
322	Ga0436362_0822259	3300039453	Bacteria	1908
323	Ga0450915_001255	3300042119	Bacteria	1148
324	Ga0450902_018306	3300042137	Bacteria	1148
325	Ga0450905_012868	3300042142	Bacteria	1182
326	Ga0466963_0291793	3300044694	Bacteria	1146
327	Ga0466964_0027065	3300044706	Bacteria	2249
328	Ga0466971_0021673	3300044719	Bacteria	2860
329	Ga0466968_0025132	3300044735	Bacteria	2438
330	Ga0466960_0080759	3300044901	Bacteria	1638
331	Ga0466958_0090974	3300045836	Bacteria	1888
332	Ga0466967_0005920	3300045976	Bacteria	8572
333	Ga0466967_0034832	3300045976	Bacteria	4278
334	Ga0466967_0044576	3300045976	Bacteria	3848
335	Ga0466967_0171532	3300045976	Bacteria	2041
336	Ga0466967_0432253	3300045976	Bacteria	1284
337	Ga0466967_0530839	3300045976	Bacteria	1157
338	Ga0495641_0005375	3300046461	Bacteria	8671
339	Ga0495662_0045470	3300046476	Unclassified	2119
340	Ga0495596_0048997	3300046500	Bacteria	1656
341	Ga0495631_0038426	3300046518	Bacteria	2128
342	Ga0495644_0021883	3300046523	Bacteria	2437
343	Ga0495663_0027573	3300046525	Bacteria	1667
344	Ga0495656_0000524	3300046615	Bacteria	12472
345	Ga0495611_0102204	3300046648	Bacteria	1332
346	Ga0495657_0069875	3300046675	Bacteria	2296
347	Ga0495670_0188860	3300046691	Bacteria	1089
348	Ga0495672_0035199	3300047320	Bacteria	3085
349	Ga0495686_0000020	3300047472	Bacteria	429191
350	Ga0495686_0003226	3300047472	Bacteria	14333
351	Ga0496100_0039475	3300048903	Bacteria	2998
352	Ga0496100_0113468	3300048903	Bacteria	1886
353	Ga0496101_0140174	3300048904	Bacteria	1842
354	Ga0496101_0188021	3300048904	Bacteria	1593
355	Ga0496102_0088907	3300048905	Bacteria	2857
356	Ga0496102_0096398	3300048905	Bacteria	2742
357	Ga0496102_0124423	3300048905	Bacteria	2410
358	Ga0496102_0344169	3300048905	Bacteria	1404
359	Ga0496102_0450568	3300048905	Bacteria	1207
360	Ga0496103_0014012	3300048906	Bacteria	4759
361	Ga0496104_0018612	3300048907	Bacteria	6339
362	Ga0496105_0028477	3300048908	Bacteria	4568
363	Ga0496106_0039166	3300048909	Bacteria	3550
364	Ga0496106_0071747	3300048909	Bacteria	2647
365	Ga0496106_0431382	3300048909	Bacteria	1059
366	Ga0496108_0005424	3300048911	Bacteria	10309
367	Ga0496108_0152225	3300048911	Bacteria	1996
368	Ga0496109_0039135	3300048912	Bacteria	4291
369	Ga0496109_0097399	3300048912	Bacteria	2726
370	Ga0496109_0199357	3300048912	Bacteria	1882
371	Ga0496109_0434105	3300048912	Bacteria	1241
372	Ga0496110_0011563	3300048913	Bacteria	7233
373	Ga0496110_0016163	3300048913	Bacteria	6223
374	Ga0496110_0067008	3300048913	Bacteria	3176
375	Ga0496110_0113447	3300048913	Bacteria	2437
376	Ga0496110_0119587	3300048913	Bacteria	2373
377	Ga0496110_0169648	3300048913	Bacteria	1980
378	Ga0496110_0285764	3300048913	Bacteria	1502
379	Ga0496111_0007016	3300048914	Bacteria	7358
380	Ga0496111_0029022	3300048914	Bacteria	3925
381	Ga0496112_0091899	3300048915	Bacteria	3004
382	Ga0496112_0220404	3300048915	Bacteria	1853
383	Ga0496114_0037212	3300048917	Bacteria	4024
384	Ga0496114_0077436	3300048917	Bacteria	2804
385	Ga0496114_0178513	3300048917	Bacteria	1853
386	Ga0496126_0222195	3300048929	Bacteria	1586
387	Ga0501031_0013812	3300049568	Bacteria	5264
388	Ga0501031_0070955	3300049568	Bacteria	2269
389	Ga0501034_0224058	3300049571	Bacteria	1832
390	Ga0501036_0260098	3300049572	Bacteria	1454
391	Ga0501037_0218813	3300049573	Bacteria	1341
392	Ga0501038_0093923	3300049574	Bacteria	2508
393	Ga0501039_0138888	3300049575	Bacteria	1908
394	Ga0501040_0102695	3300049576	Bacteria	1995
395	Ga0501042_0108287	3300049578	Bacteria	2001
396	Ga0501046_0219618	3300049580	Bacteria	1408
397	Ga0501047_0233463	3300049581	Bacteria	1692
398	Ga0501048_0074620	3300049582	Bacteria	2393
399	Ga0501048_0189040	3300049582	Bacteria	1459
400	Ga0501071_0052097	3300049587	Bacteria	2951
401	Ga0501071_0059279	3300049587	Bacteria	2769
402	Ga0501072_0127994	3300049588	Bacteria	2023
403	Ga0501072_0300488	3300049588	Bacteria	1276
404	Ga0501072_0610904	3300049588	Bacteria	859
405	Ga0501075_0177421	3300049591	Bacteria	1626
406	Ga0501075_0184537	3300049591	Bacteria	1591
407	Ga0501076_0059565	3300049592	Bacteria	3037
408	Ga0501076_0248582	3300049592	Bacteria	1455
409	Ga0501076_0260600	3300049592	Bacteria	1419
410	Ga0501079_0386484	3300049741	Bacteria	1097
411	Ga0501079_0408978	3300049741	Bacteria	1064
412	Ga0501081_0143918	3300049743	Archaea	1710
413	nmdc:mga0yw44_203401_c1	3300050492	Bacteria	1308
414	nmdc:mga05p37_10760_c1	3300050507	Bacteria	10861
415	nmdc:mga05p37_128379_c1	3300050507	Bacteria	3112
416	nmdc:mga05p37_135566_c1	3300050507	Bacteria	3019
417	nmdc:mga05p37_363390_c1	3300050507	Bacteria	1701
418	nmdc:mga05p37_536361_c1	3300050507	Bacteria	1335
419	nmdc:mga05p37_5635_c1	3300050507	Bacteria	14720
420	nmdc:mga05p37_82050_c1	3300050507	Bacteria	3972
421	nmdc:mga09592_29966_c1	3300050508	Bacteria	4527
422	nmdc:mga09592_308816_c1	3300050508	Bacteria	1371
423	nmdc:mga0qj67_102103_c1	3300050509	Bacteria	2312
424	nmdc:mga0qj67_162678_c1	3300050509	Bacteria	1812
425	nmdc:mga0qj67_1756_c1	3300050509	Bacteria	15338
426	nmdc:mga0qj67_27132_c1	3300050509	Bacteria	4436
427	nmdc:mga0qj67_4785_c1	3300050509	Bacteria	9843
428	nmdc:mga0qj67_497224_c1	3300050509	Bacteria	980
429	nmdc:mga06r32_4522_c1	3300050510	Bacteria	12461
430	nmdc:mga06r32_64074_c1	3300050510	Bacteria	3544
431	nmdc:mga08y16_36554_c1	3300050511	Bacteria	5158
432	nmdc:mga08y16_416343_c1	3300050511	Bacteria	1374
433	nmdc:mga08y16_524923_c1	3300050511	Bacteria	1200
434	nmdc:mga08y16_64501_c1	3300050511	Bacteria	3825
435	nmdc:mga0n895_173058_c1	3300050512	Bacteria	2191
436	nmdc:mga0n895_185929_c1	3300050512	Bacteria	2109
437	nmdc:mga0n895_567302_c1	3300050512	Bacteria	1140
438	nmdc:mga0n895_84251_c1	3300050512	Bacteria	3172
439	nmdc:mga0rr50_33843_c1	3300050513	Bacteria	3654
440	nmdc:mga08x19_239462_c1	3300050514	Bacteria	1250
441	nmdc:mga08x19_74286_c1	3300050514	Bacteria	2221
442	nmdc:mga0a205_104136_c1	3300050515	Bacteria	2737
443	nmdc:mga0a205_80662_c1	3300050515	Bacteria	3143
444	nmdc:mga0a205_8121_c1	3300050515	Bacteria	9536
445	Ga0500628_011817	3300053129	Bacteria	1595
446	Ga0501084_0111899	3300054114	Bacteria	2294
447	Ga0501084_0271214	3300054114	Bacteria	1433
448	Ga0501082_0033300	3300060353	Bacteria	4446
449	Ga0466962_0018911	3300061719	Bacteria	3310
450	Ga0530510_0090525	3300061734	Bacteria	2231

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049588	Ga0501072_0610904	Ga0501072_0610904_50_832	259
2	3300046525	Ga0495663_0027573	Ga0495663_0027573_833_1630	264
3	3300050509	nmdc:mga0qj67_497224_c1	nmdc:mga0qj67_497224_c1_17_829	267
4	3300037466	Ga0395898_0676679	Ga0395898_0676679_155_964	268
5	3300037466	Ga0395898_0663393	Ga0395898_0663393_88_948	285
6	3300050511	nmdc:mga08y16_64501_c1	nmdc:mga08y16_64501_c1_2955_3815	285
7	3300048913	Ga0496110_0285764	Ga0496110_0285764_584_1459	286
8	3300035092	Ga0373952_0046939	Ga0373952_0046939_113_979	287
9	3300049741	Ga0501079_0386484	Ga0501079_0386484_202_1068	287
10	3300047472	Ga0495686_0000020	Ga0495686_0000020_381982_382935	289
11	3300049576	Ga0501040_0102695	Ga0501040_0102695_24_914	291
12	3300050492	nmdc:mga0yw44_203401_c1	nmdc:mga0yw44_203401_c1_133_1083	313
13	3300005330	Ga0070690_100165950	Ga0070690_1001659502	315
14	3300005334	Ga0068869_100152791	Ga0068869_1001527912	315
15	3300005336	Ga0070680_100052231	Ga0070680_1000522313	315
16	3300005337	Ga0070682_100005813	Ga0070682_1000058134	315
17	3300005338	Ga0068868_100006726	Ga0068868_1000067263	315
18	3300005339	Ga0070660_100016262	Ga0070660_1000162622	315
19	3300005340	Ga0070689_100028617	Ga0070689_1000286172	315
20	3300005345	Ga0070692_10020795	Ga0070692_100207953	315
21	3300005345	Ga0070692_10023327	Ga0070692_100233272	315
22	3300005354	Ga0070675_100010151	Ga0070675_1000101512	315
23	3300005356	Ga0070674_100025931	Ga0070674_1000259312	315
24	3300005356	Ga0070674_100071990	Ga0070674_1000719902	315
25	3300005364	Ga0070673_100003981	Ga0070673_10000398110	315
26	3300005366	Ga0070659_100206135	Ga0070659_1002061352	315
27	3300005438	Ga0070701_10032094	Ga0070701_100320942	315
28	3300005441	Ga0070700_100061035	Ga0070700_1000610352	315
29	3300005441	Ga0070700_100154377	Ga0070700_1001543772	315
30	3300005456	Ga0070678_100071816	Ga0070678_1000718161	315
31	3300005457	Ga0070662_100006834	Ga0070662_1000068345	315
32	3300005466	Ga0070685_10009419	Ga0070685_100094194	315
33	3300005530	Ga0070679_100114099	Ga0070679_1001140992	315
34	3300005535	Ga0070684_100004356	Ga0070684_1000043563	315
35	3300005543	Ga0070672_100027440	Ga0070672_1000274403	315
36	3300005543	Ga0070672_100029908	Ga0070672_1000299083	315
37	3300005548	Ga0070665_100041989	Ga0070665_1000419894	315
38	3300005563	Ga0068855_100052554	Ga0068855_1000525542	315
39	3300005564	Ga0070664_100024053	Ga0070664_1000240534	315
40	3300005578	Ga0068854_100030664	Ga0068854_1000306642	315
41	3300005615	Ga0070702_100125809	Ga0070702_1001258092	315
42	3300005616	Ga0068852_100052553	Ga0068852_1000525532	315
43	3300005617	Ga0068859_100040976	Ga0068859_1000409762	315
44	3300005618	Ga0068864_100036391	Ga0068864_1000363912	315
45	3300005719	Ga0068861_100052221	Ga0068861_1000522211	315
46	3300006931	Ga0097620_100040976	Ga0097620_1000409762	315
47	3300009098	Ga0105245_10038221	Ga0105245_100382213	315
48	3300009148	Ga0105243_10008859	Ga0105243_1000885910	315
49	3300009148	Ga0105243_10081672	Ga0105243_100816722	315
50	3300009176	Ga0105242_10019678	Ga0105242_100196782	315
51	3300009177	Ga0105248_10073846	Ga0105248_100738462	315
52	3300009551	Ga0105238_10166082	Ga0105238_101660822	315
53	3300009551	Ga0105238_10182166	Ga0105238_101821661	315
54	3300013102	Ga0157371_10006665	Ga0157371_1000666510	315
55	3300013296	Ga0157374_10068540	Ga0157374_100685403	315
56	3300013297	Ga0157378_10242980	Ga0157378_102429802	315
57	3300013307	Ga0157372_10017114	Ga0157372_100171143	315
58	3300013308	Ga0157375_10021237	Ga0157375_100212372	315
59	3300014745	Ga0157377_10180322	Ga0157377_101803222	315
60	3300014968	Ga0157379_10057745	Ga0157379_100577452	315
61	3300025321	Ga0207656_10056971	Ga0207656_100569712	315
62	3300025899	Ga0207642_10006310	Ga0207642_100063104	315
63	3300025900	Ga0207710_10028596	Ga0207710_100285962	315
64	3300025901	Ga0207688_10098329	Ga0207688_100983292	315
65	3300025917	Ga0207660_10295273	Ga0207660_102952731	315
66	3300025919	Ga0207657_10019931	Ga0207657_100199315	315
67	3300025921	Ga0207652_10038709	Ga0207652_100387092	315
68	3300025923	Ga0207681_10163774	Ga0207681_101637742	315
69	3300025926	Ga0207659_10086825	Ga0207659_100868252	315
70	3300025932	Ga0207690_10023662	Ga0207690_100236622	315
71	3300025933	Ga0207706_10023974	Ga0207706_100239742	315
72	3300025934	Ga0207686_10101579	Ga0207686_101015792	315
73	3300025935	Ga0207709_10120925	Ga0207709_101209252	315
74	3300025936	Ga0207670_10010728	Ga0207670_100107284	315
75	3300025937	Ga0207669_10186474	Ga0207669_101864742	315
76	3300025938	Ga0207704_10029766	Ga0207704_100297662	315
77	3300025940	Ga0207691_10149382	Ga0207691_101493822	315
78	3300025944	Ga0207661_10203743	Ga0207661_102037432	315
79	3300025960	Ga0207651_10042661	Ga0207651_100426613	315
80	3300025981	Ga0207640_10105544	Ga0207640_101055442	315
81	3300026023	Ga0207677_10013432	Ga0207677_100134322	315
82	3300026035	Ga0207703_10073616	Ga0207703_100736162	315
83	3300026041	Ga0207639_10209741	Ga0207639_102097412	315
84	3300026067	Ga0207678_10019381	Ga0207678_100193812	315
85	3300026067	Ga0207678_10071702	Ga0207678_100717022	315
86	3300026088	Ga0207641_10056680	Ga0207641_100566802	315
87	3300026118	Ga0207675_100095386	Ga0207675_1000953862	315
88	3300026121	Ga0207683_10263454	Ga0207683_102634542	315
89	3300026142	Ga0207698_10077610	Ga0207698_100776102	315
90	3300028379	Ga0268266_10031300	Ga0268266_100313002	315
91	3300028381	Ga0268264_10095063	Ga0268264_100950632	315
92	3300034820	Ga0373959_0007575	Ga0373959_0007575_573_1526	315
93	3300035115	Ga0373941_0034060	Ga0373941_0034060_264_1217	315
94	3300048903	Ga0496100_0039475	Ga0496100_0039475_799_1752	315
95	3300048904	Ga0496101_0140174	Ga0496101_0140174_122_1075	315
96	3300048905	Ga0496102_0344169	Ga0496102_0344169_251_1204	315
97	3300048907	Ga0496104_0018612	Ga0496104_0018612_3906_4859	315
98	3300048908	Ga0496105_0028477	Ga0496105_0028477_2187_3140	315
99	3300048911	Ga0496108_0005424	Ga0496108_0005424_90_1043	315
100	3300048911	Ga0496108_0152225	Ga0496108_0152225_90_1043	315
101	3300048912	Ga0496109_0097399	Ga0496109_0097399_1121_2074	315
102	3300048913	Ga0496110_0113447	Ga0496110_0113447_201_1154	315
103	3300048917	Ga0496114_0037212	Ga0496114_0037212_903_1856	315
104	3300048917	Ga0496114_0178513	Ga0496114_0178513_470_1423	315
105	3300005345	Ga0070692_10107907	Ga0070692_101079072	316
106	3300005438	Ga0070701_10202933	Ga0070701_102029331	316
107	3300006852	Ga0075433_10009344	Ga0075433_100093442	316
108	3300006871	Ga0075434_100029566	Ga0075434_1000295663	316
109	3300009098	Ga0105245_10635727	Ga0105245_106357272	316
110	3300009147	Ga0114129_10198292	Ga0114129_101982922	316
111	3300025908	Ga0207643_10157010	Ga0207643_101570102	316
112	3300035115	Ga0373941_0013628	Ga0373941_0013628_855_1808	316
113	3300036401	Ga0373937_0055547	Ga0373937_0055547_1197_2150	316
114	3300037466	Ga0395898_0644061	Ga0395898_0644061_39_992	316
115	3300038443	Ga0395901_0266878	Ga0395901_0266878_627_1580	316
116	3300045976	Ga0466967_0005920	Ga0466967_0005920_2721_3686	316
117	3300046461	Ga0495641_0005375	Ga0495641_0005375_225_1178	316
118	3300046476	Ga0495662_0045470	Ga0495662_0045470_351_1304	316
119	3300046500	Ga0495596_0048997	Ga0495596_0048997_591_1544	316
120	3300046518	Ga0495631_0038426	Ga0495631_0038426_978_1931	316
121	3300046523	Ga0495644_0021883	Ga0495644_0021883_172_1125	316
122	3300046615	Ga0495656_0000524	Ga0495656_0000524_4760_5713	316
123	3300046648	Ga0495611_0102204	Ga0495611_0102204_15_968	316
124	3300046675	Ga0495657_0069875	Ga0495657_0069875_1050_2003	316
125	3300046691	Ga0495670_0188860	Ga0495670_0188860_107_1060	316
126	3300047472	Ga0495686_0003226	Ga0495686_0003226_1645_2598	316
127	3300048917	Ga0496114_0077436	Ga0496114_0077436_1283_2236	316
128	3300048929	Ga0496126_0222195	Ga0496126_0222195_132_1097	316
129	3300049571	Ga0501034_0224058	Ga0501034_0224058_589_1554	316
130	3300049743	Ga0501081_0143918	Ga0501081_0143918_149_1102	316
131	3300050512	nmdc:mga0n895_173058_c1	nmdc:mga0n895_173058_c1_743_1696	316
132	3300050514	nmdc:mga08x19_239462_c1	nmdc:mga08x19_239462_c1_148_1101	316
133	3300053129	Ga0500628_011817	Ga0500628_011817_604_1557	316
134	3300009147	Ga0114129_10011648	Ga0114129_100116482	317
135	3300031731	Ga0307405_10101454	Ga0307405_101014542	317
136	3300031995	Ga0307409_100049872	Ga0307409_1000498723	317
137	3300031995	Ga0307409_100191062	Ga0307409_1001910621	317
138	3300032002	Ga0307416_100138415	Ga0307416_1001384152	317
139	3300032126	Ga0307415_100096585	Ga0307415_1000965852	317
140	3300044694	Ga0466963_0291793	Ga0466963_0291793_125_1093	317
141	3300044719	Ga0466971_0021673	Ga0466971_0021673_1029_1997	317
142	3300045836	Ga0466958_0090974	Ga0466958_0090974_700_1668	317
143	3300048912	Ga0496109_0199357	Ga0496109_0199357_324_1292	317
144	3300049575	Ga0501039_0138888	Ga0501039_0138888_288_1256	317
145	3300049587	Ga0501071_0052097	Ga0501071_0052097_280_1248	317
146	3300049591	Ga0501075_0177421	Ga0501075_0177421_27_995	317
147	3300050511	nmdc:mga08y16_416343_c1	nmdc:mga08y16_416343_c1_62_1018	317
148	3300005338	Ga0068868_100318332	Ga0068868_1003183321	318
149	3300005341	Ga0070691_10055438	Ga0070691_100554382	318
150	3300005347	Ga0070668_100021351	Ga0070668_1000213512	318
151	3300005354	Ga0070675_100086203	Ga0070675_1000862033	318
152	3300005356	Ga0070674_100019225	Ga0070674_1000192253	318
153	3300005365	Ga0070688_100274008	Ga0070688_1002740081	318
154	3300005366	Ga0070659_100041567	Ga0070659_1000415675	318
155	3300005366	Ga0070659_100050664	Ga0070659_1000506642	318
156	3300005436	Ga0070713_100017801	Ga0070713_1000178015	318
157	3300005441	Ga0070700_100004505	Ga0070700_1000045059	318
158	3300005457	Ga0070662_100097792	Ga0070662_1000977922	318
159	3300005535	Ga0070684_100069430	Ga0070684_1000694303	318
160	3300005547	Ga0070693_100076600	Ga0070693_1000766002	318
161	3300005564	Ga0070664_100013548	Ga0070664_10001354811	318
162	3300005578	Ga0068854_100252423	Ga0068854_1002524232	318
163	3300005614	Ga0068856_100001409	Ga0068856_10000140916	318
164	3300005618	Ga0068864_100008628	Ga0068864_10000862813	318
165	3300005719	Ga0068861_100005932	Ga0068861_1000059323	318
166	3300005841	Ga0068863_100349868	Ga0068863_1003498682	318
167	3300005937	Ga0081455_10076849	Ga0081455_100768491	318
168	3300005981	Ga0081538_10026202	Ga0081538_100262024	318
169	3300006028	Ga0070717_10208831	Ga0070717_102088313	318
170	3300006058	Ga0075432_10059183	Ga0075432_100591831	318
171	3300006175	Ga0070712_100298581	Ga0070712_1002985812	318
172	3300006846	Ga0075430_100018177	Ga0075430_1000181775	318
173	3300006846	Ga0075430_100074891	Ga0075430_1000748912	318
174	3300006847	Ga0075431_100063697	Ga0075431_1000636974	318
175	3300006852	Ga0075433_10117939	Ga0075433_101179392	318
176	3300006871	Ga0075434_100486733	Ga0075434_1004867332	318
177	3300006880	Ga0075429_100006521	Ga0075429_1000065212	318
178	3300006914	Ga0075436_100023245	Ga0075436_1000232452	318
179	3300007076	Ga0075435_100102943	Ga0075435_1001029432	318
180	3300009094	Ga0111539_10030332	Ga0111539_1003033211	318
181	3300009094	Ga0111539_10176824	Ga0111539_101768242	318
182	3300009098	Ga0105245_10012648	Ga0105245_1001264811	318
183	3300009147	Ga0114129_10115528	Ga0114129_101155284	318
184	3300009148	Ga0105243_10035596	Ga0105243_100355964	318
185	3300009177	Ga0105248_10317109	Ga0105248_103171092	318
186	3300009553	Ga0105249_10148850	Ga0105249_101488502	318
187	3300013102	Ga0157371_10188756	Ga0157371_101887562	318
188	3300013296	Ga0157374_10015293	Ga0157374_100152935	318
189	3300013306	Ga0163162_10065466	Ga0163162_100654663	318
190	3300013308	Ga0157375_10046804	Ga0157375_100468042	318
191	3300013308	Ga0157375_10581294	Ga0157375_105812942	318
192	3300014325	Ga0163163_10176535	Ga0163163_101765352	318
193	3300014326	Ga0157380_10083086	Ga0157380_100830862	318
194	3300014745	Ga0157377_10022985	Ga0157377_100229854	318
195	3300025901	Ga0207688_10007602	Ga0207688_100076023	318
196	3300025907	Ga0207645_10150040	Ga0207645_101500402	318
197	3300025915	Ga0207693_10008735	Ga0207693_100087352	318
198	3300025927	Ga0207687_10205036	Ga0207687_102050361	318
199	3300025928	Ga0207700_10000028	Ga0207700_10000028105	318
200	3300025932	Ga0207690_10025440	Ga0207690_100254403	318
201	3300025933	Ga0207706_10142478	Ga0207706_101424782	318
202	3300025937	Ga0207669_10002615	Ga0207669_100026152	318
203	3300025941	Ga0207711_10404683	Ga0207711_104046832	318
204	3300025942	Ga0207689_10023855	Ga0207689_100238552	318
205	3300025945	Ga0207679_10065883	Ga0207679_100658832	318
206	3300025961	Ga0207712_10061252	Ga0207712_100612522	318
207	3300025961	Ga0207712_10065956	Ga0207712_100659562	318
208	3300025972	Ga0207668_10135251	Ga0207668_101352512	318
209	3300026023	Ga0207677_10317198	Ga0207677_103171981	318
210	3300026067	Ga0207678_10094813	Ga0207678_100948133	318
211	3300026075	Ga0207708_10006108	Ga0207708_1000610813	318
212	3300026088	Ga0207641_10429813	Ga0207641_104298131	318
213	3300026089	Ga0207648_10020778	Ga0207648_100207785	318
214	3300026116	Ga0207674_10095507	Ga0207674_100955072	318
215	3300026118	Ga0207675_100028556	Ga0207675_1000285565	318
216	3300026142	Ga0207698_10072699	Ga0207698_100726992	318
217	3300027907	Ga0207428_10090221	Ga0207428_100902212	318
218	3300028379	Ga0268266_10152402	Ga0268266_101524022	318
219	3300038443	Ga0395901_0381827	Ga0395901_0381827_363_1322	318
220	3300044735	Ga0466968_0025132	Ga0466968_0025132_215_1174	318
221	3300044901	Ga0466960_0080759	Ga0466960_0080759_136_1104	318
222	3300045976	Ga0466967_0171532	Ga0466967_0171532_1032_1991	318
223	3300048903	Ga0496100_0113468	Ga0496100_0113468_675_1634	318
224	3300048904	Ga0496101_0188021	Ga0496101_0188021_467_1426	318
225	3300048905	Ga0496102_0096398	Ga0496102_0096398_598_1557	318
226	3300048905	Ga0496102_0450568	Ga0496102_0450568_104_1063	318
227	3300048906	Ga0496103_0014012	Ga0496103_0014012_1104_2063	318
228	3300048909	Ga0496106_0071747	Ga0496106_0071747_233_1192	318
229	3300048909	Ga0496106_0431382	Ga0496106_0431382_15_974	318
230	3300048913	Ga0496110_0011563	Ga0496110_0011563_1415_2374	318
231	3300048913	Ga0496110_0016163	Ga0496110_0016163_495_1454	318
232	3300048914	Ga0496111_0007016	Ga0496111_0007016_666_1625	318
233	3300048914	Ga0496111_0029022	Ga0496111_0029022_1407_2366	318
234	3300050507	nmdc:mga05p37_536361_c1	nmdc:mga05p37_536361_c1_308_1273	318
235	3300050508	nmdc:mga09592_29966_c1	nmdc:mga09592_29966_c1_2949_3914	318
236	3300050509	nmdc:mga0qj67_27132_c1	nmdc:mga0qj67_27132_c1_2564_3523	318
237	3300050509	nmdc:mga0qj67_4785_c1	nmdc:mga0qj67_4785_c1_5267_6226	318
238	3300050510	nmdc:mga06r32_64074_c1	nmdc:mga06r32_64074_c1_1797_2756	318
239	3300050512	nmdc:mga0n895_185929_c1	nmdc:mga0n895_185929_c1_687_1646	318
240	3300050512	nmdc:mga0n895_567302_c1	nmdc:mga0n895_567302_c1_38_997	318
241	3300050513	nmdc:mga0rr50_33843_c1	nmdc:mga0rr50_33843_c1_752_1711	318
242	3300050514	nmdc:mga08x19_74286_c1	nmdc:mga08x19_74286_c1_291_1250	318
243	3300050515	nmdc:mga0a205_104136_c1	nmdc:mga0a205_104136_c1_423_1382	318
244	3300003373	JGI25407J50210_10019258	JGI25407J50210_100192582	319
245	3300005329	Ga0070683_100025141	Ga0070683_1000251413	319
246	3300005334	Ga0068869_100226008	Ga0068869_1002260082	319
247	3300005336	Ga0070680_100001187	Ga0070680_1000011879	319
248	3300005338	Ga0068868_100060382	Ga0068868_1000603822	319
249	3300005339	Ga0070660_100041779	Ga0070660_1000417793	319
250	3300005347	Ga0070668_100039218	Ga0070668_1000392182	319
251	3300005366	Ga0070659_100002630	Ga0070659_10000263010	319
252	3300005440	Ga0070705_100351237	Ga0070705_1003512371	319
253	3300005441	Ga0070700_100114019	Ga0070700_1001140192	319
254	3300005456	Ga0070678_100197903	Ga0070678_1001979031	319
255	3300005457	Ga0070662_100365553	Ga0070662_1003655531	319
256	3300005458	Ga0070681_10002872	Ga0070681_1000287211	319
257	3300005530	Ga0070679_100013048	Ga0070679_1000130485	319
258	3300005535	Ga0070684_100004410	Ga0070684_1000044104	319
259	3300005535	Ga0070684_100402717	Ga0070684_1004027171	319
260	3300005549	Ga0070704_100058269	Ga0070704_1000582692	319
261	3300005549	Ga0070704_100215058	Ga0070704_1002150582	319
262	3300005577	Ga0068857_100227214	Ga0068857_1002272142	319
263	3300005616	Ga0068852_100035594	Ga0068852_1000355943	319
264	3300005719	Ga0068861_100245682	Ga0068861_1002456822	319
265	3300005842	Ga0068858_100275080	Ga0068858_1002750802	319
266	3300005937	Ga0081455_10011010	Ga0081455_100110109	319
267	3300005937	Ga0081455_10104189	Ga0081455_101041892	319
268	3300005981	Ga0081538_10002046	Ga0081538_1000204618	319
269	3300005981	Ga0081538_10004075	Ga0081538_1000407515	319
270	3300005981	Ga0081538_10011691	Ga0081538_100116911	319
271	3300005981	Ga0081538_10015362	Ga0081538_100153625	319
272	3300005981	Ga0081538_10023479	Ga0081538_100234792	319
273	3300005985	Ga0081539_10000855	Ga0081539_1000085530	319
274	3300006038	Ga0075365_10112585	Ga0075365_101125851	319
275	3300006844	Ga0075428_100314362	Ga0075428_1003143621	319
276	3300006852	Ga0075433_10005224	Ga0075433_100052245	319
277	3300006871	Ga0075434_100003191	Ga0075434_1000031915	319
278	3300009094	Ga0111539_10313148	Ga0111539_103131482	319
279	3300009094	Ga0111539_10595970	Ga0111539_105959702	319
280	3300009094	Ga0111539_10758046	Ga0111539_107580461	319
281	3300009098	Ga0105245_10302630	Ga0105245_103026302	319
282	3300009147	Ga0114129_10003187	Ga0114129_1000318710	319
283	3300009147	Ga0114129_10173598	Ga0114129_101735982	319
284	3300009147	Ga0114129_10538048	Ga0114129_105380482	319
285	3300009147	Ga0114129_10646468	Ga0114129_106464682	319
286	3300009148	Ga0105243_10048977	Ga0105243_100489773	319
287	3300009148	Ga0105243_10399972	Ga0105243_103999721	319
288	3300009545	Ga0105237_10021595	Ga0105237_100215954	319
289	3300009551	Ga0105238_10006637	Ga0105238_1000663714	319
290	3300009553	Ga0105249_10291634	Ga0105249_102916342	319
291	3300011119	Ga0105246_10061711	Ga0105246_100617112	319
292	3300013105	Ga0157369_10031148	Ga0157369_100311485	319
293	3300013306	Ga0163162_10150767	Ga0163162_101507672	319
294	3300013307	Ga0157372_10007829	Ga0157372_100078294	319
295	3300014325	Ga0163163_10669513	Ga0163163_106695131	319
296	3300020082	Ga0206353_10034427	Ga0206353_100344274	319
297	3300025909	Ga0207705_10174517	Ga0207705_101745172	319
298	3300025909	Ga0207705_10207794	Ga0207705_102077942	319
299	3300025912	Ga0207707_10004634	Ga0207707_1000463412	319
300	3300025913	Ga0207695_10059957	Ga0207695_100599574	319
301	3300025917	Ga0207660_10013572	Ga0207660_100135722	319
302	3300025919	Ga0207657_10003497	Ga0207657_100034973	319
303	3300025920	Ga0207649_10029281	Ga0207649_100292814	319
304	3300025921	Ga0207652_10005694	Ga0207652_100056943	319
305	3300025927	Ga0207687_10201669	Ga0207687_102016691	319
306	3300025932	Ga0207690_10014089	Ga0207690_100140894	319
307	3300025935	Ga0207709_10032104	Ga0207709_100321042	319
308	3300025940	Ga0207691_10209150	Ga0207691_102091502	319
309	3300025944	Ga0207661_10000288	Ga0207661_1000028813	319
310	3300025944	Ga0207661_10209034	Ga0207661_102090342	319
311	3300025945	Ga0207679_10166357	Ga0207679_101663573	319
312	3300025972	Ga0207668_10212456	Ga0207668_102124561	319
313	3300025981	Ga0207640_10050223	Ga0207640_100502232	319
314	3300026023	Ga0207677_10018873	Ga0207677_100188733	319
315	3300026035	Ga0207703_10469736	Ga0207703_104697362	319
316	3300026041	Ga0207639_10100763	Ga0207639_101007633	319
317	3300026075	Ga0207708_10008033	Ga0207708_100080339	319
318	3300026075	Ga0207708_10037140	Ga0207708_100371403	319
319	3300026078	Ga0207702_10015018	Ga0207702_100150184	319
320	3300026095	Ga0207676_10423649	Ga0207676_104236492	319
321	3300026118	Ga0207675_100021842	Ga0207675_1000218422	319
322	3300026118	Ga0207675_100133517	Ga0207675_1001335172	319
323	3300026121	Ga0207683_10236722	Ga0207683_102367222	319
324	3300026142	Ga0207698_10002735	Ga0207698_1000273512	319
325	3300026142	Ga0207698_10210324	Ga0207698_102103242	319
326	3300027907	Ga0207428_10193077	Ga0207428_101930771	319
327	3300027907	Ga0207428_10295141	Ga0207428_102951412	319
328	3300031731	Ga0307405_10023435	Ga0307405_100234351	319
329	3300031824	Ga0307413_10052880	Ga0307413_100528802	319
330	3300031824	Ga0307413_10241786	Ga0307413_102417862	319
331	3300031901	Ga0307406_10153233	Ga0307406_101532332	319
332	3300031911	Ga0307412_10176914	Ga0307412_101769142	319
333	3300031911	Ga0307412_10473597	Ga0307412_104735971	319
334	3300031995	Ga0307409_100004311	Ga0307409_1000043117	319
335	3300031995	Ga0307409_100097428	Ga0307409_1000974282	319
336	3300031995	Ga0307409_100407683	Ga0307409_1004076831	319
337	3300032002	Ga0307416_100120272	Ga0307416_1001202722	319
338	3300032126	Ga0307415_100004521	Ga0307415_1000045212	319
339	3300032126	Ga0307415_100210084	Ga0307415_1002100842	319
340	3300032126	Ga0307415_100226082	Ga0307415_1002260821	319
341	3300039453	Ga0436362_0822259	Ga0436362_0822259_274_1245	319
342	3300042119	Ga0450915_001255	Ga0450915_001255_31_1008	319
343	3300042137	Ga0450902_018306	Ga0450902_018306_48_1025	319
344	3300042142	Ga0450905_012868	Ga0450905_012868_44_1021	319
345	3300045976	Ga0466967_0530839	Ga0466967_0530839_103_1077	319
346	3300047320	Ga0495672_0035199	Ga0495672_0035199_924_1883	319
347	3300048905	Ga0496102_0088907	Ga0496102_0088907_1042_2010	319
348	3300048905	Ga0496102_0124423	Ga0496102_0124423_352_1326	319
349	3300048909	Ga0496106_0039166	Ga0496106_0039166_2383_3357	319
350	3300048912	Ga0496109_0434105	Ga0496109_0434105_141_1115	319
351	3300048913	Ga0496110_0067008	Ga0496110_0067008_2107_3075	319
352	3300048913	Ga0496110_0119587	Ga0496110_0119587_1047_2021	319
353	3300048915	Ga0496112_0091899	Ga0496112_0091899_912_1886	319
354	3300049568	Ga0501031_0013812	Ga0501031_0013812_4265_5239	319
355	3300049573	Ga0501037_0218813	Ga0501037_0218813_47_1006	319
356	3300049574	Ga0501038_0093923	Ga0501038_0093923_284_1258	319
357	3300049580	Ga0501046_0219618	Ga0501046_0219618_385_1359	319
358	3300049581	Ga0501047_0233463	Ga0501047_0233463_673_1647	319
359	3300049582	Ga0501048_0074620	Ga0501048_0074620_945_1919	319
360	3300049582	Ga0501048_0189040	Ga0501048_0189040_17_991	319
361	3300049587	Ga0501071_0059279	Ga0501071_0059279_510_1484	319
362	3300049588	Ga0501072_0127994	Ga0501072_0127994_263_1237	319
363	3300049592	Ga0501076_0059565	Ga0501076_0059565_1089_2063	319
364	3300049592	Ga0501076_0260600	Ga0501076_0260600_420_1394	319
365	3300049741	Ga0501079_0408978	Ga0501079_0408978_22_996	319
366	3300050507	nmdc:mga05p37_128379_c1	nmdc:mga05p37_128379_c1_457_1425	319
367	3300050507	nmdc:mga05p37_5635_c1	nmdc:mga05p37_5635_c1_3818_4786	319
368	3300050509	nmdc:mga0qj67_102103_c1	nmdc:mga0qj67_102103_c1_1017_1976	319
369	3300050511	nmdc:mga08y16_524923_c1	nmdc:mga08y16_524923_c1_89_1063	319
370	3300050512	nmdc:mga0n895_84251_c1	nmdc:mga0n895_84251_c1_1113_2081	319
371	3300050515	nmdc:mga0a205_8121_c1	nmdc:mga0a205_8121_c1_4401_5369	319
372	3300054114	Ga0501084_0111899	Ga0501084_0111899_1037_2011	319
373	3300054114	Ga0501084_0271214	Ga0501084_0271214_365_1324	319
374	3300060353	Ga0501082_0033300	Ga0501082_0033300_562_1521	319
375	3300061719	Ga0466962_0018911	Ga0466962_0018911_331_1299	319
376	3300061734	Ga0530510_0090525	Ga0530510_0090525_1207_2181	319
377	3300003373	JGI25407J50210_10006116	JGI25407J50210_100061163	320
378	3300005336	Ga0070680_100042736	Ga0070680_1000427362	320
379	3300005347	Ga0070668_100102398	Ga0070668_1001023982	320
380	3300005457	Ga0070662_100013245	Ga0070662_1000132453	320
381	3300005719	Ga0068861_100007341	Ga0068861_1000073414	320
382	3300005981	Ga0081538_10000018	Ga0081538_1000001846	320
383	3300005981	Ga0081538_10000500	Ga0081538_1000050014	320
384	3300005981	Ga0081538_10001017	Ga0081538_1000101723	320
385	3300005981	Ga0081538_10001110	Ga0081538_1000111025	320
386	3300005981	Ga0081538_10001514	Ga0081538_1000151415	320
387	3300005981	Ga0081538_10001640	Ga0081538_100016406	320
388	3300005981	Ga0081538_10004675	Ga0081538_100046754	320
389	3300005981	Ga0081538_10004875	Ga0081538_1000487512	320
390	3300005981	Ga0081538_10019191	Ga0081538_100191912	320
391	3300005981	Ga0081538_10067312	Ga0081538_100673122	320
392	3300005983	Ga0081540_1018999	Ga0081540_10189993	320
393	3300006844	Ga0075428_100012114	Ga0075428_10001211413	320
394	3300006844	Ga0075428_100022208	Ga0075428_1000222087	320
395	3300006846	Ga0075430_100004701	Ga0075430_10000470114	320
396	3300006846	Ga0075430_100005054	Ga0075430_1000050541	320
397	3300006846	Ga0075430_100112515	Ga0075430_1001125152	320
398	3300006846	Ga0075430_100409148	Ga0075430_1004091481	320
399	3300006847	Ga0075431_100003238	Ga0075431_10000323820	320
400	3300006847	Ga0075431_100025761	Ga0075431_1000257615	320
401	3300006852	Ga0075433_10120492	Ga0075433_101204922	320
402	3300006880	Ga0075429_100058415	Ga0075429_1000584152	320
403	3300006880	Ga0075429_100270678	Ga0075429_1002706782	320
404	3300009094	Ga0111539_10050614	Ga0111539_100506145	320
405	3300009094	Ga0111539_10313206	Ga0111539_103132062	320
406	3300009094	Ga0111539_10530795	Ga0111539_105307951	320
407	3300009147	Ga0114129_10006305	Ga0114129_1000630518	320
408	3300009147	Ga0114129_10067067	Ga0114129_100670676	320
409	3300009147	Ga0114129_10082257	Ga0114129_100822573	320
410	3300010375	Ga0105239_10146510	Ga0105239_101465102	320
411	3300013306	Ga0163162_10229699	Ga0163162_102296992	320
412	3300025901	Ga0207688_10023691	Ga0207688_100236914	320
413	3300025912	Ga0207707_10197659	Ga0207707_101976592	320
414	3300025933	Ga0207706_10013629	Ga0207706_100136297	320
415	3300025961	Ga0207712_10010522	Ga0207712_100105223	320
416	3300025972	Ga0207668_10008826	Ga0207668_100088262	320
417	3300026075	Ga0207708_10163032	Ga0207708_101630322	320
418	3300026075	Ga0207708_10207796	Ga0207708_102077962	320
419	3300026118	Ga0207675_100002986	Ga0207675_10000298620	320
420	3300031548	Ga0307408_100084739	Ga0307408_1000847392	320
421	3300031824	Ga0307413_10067065	Ga0307413_100670651	320
422	3300031852	Ga0307410_10187414	Ga0307410_101874142	320
423	3300031995	Ga0307409_100108461	Ga0307409_1001084611	320
424	3300035090	Ga0373949_0021828	Ga0373949_0021828_442_1407	320
425	3300035114	Ga0373939_0018692	Ga0373939_0018692_439_1404	320
426	3300035691	Ga0373931_0009457	Ga0373931_0009457_3070_4035	320
427	3300038443	Ga0395901_0038476	Ga0395901_0038476_298_1263	320
428	3300044706	Ga0466964_0027065	Ga0466964_0027065_58_1044	320
429	3300045976	Ga0466967_0034832	Ga0466967_0034832_3260_4246	320
430	3300045976	Ga0466967_0044576	Ga0466967_0044576_904_1890	320
431	3300045976	Ga0466967_0432253	Ga0466967_0432253_262_1227	320
432	3300048912	Ga0496109_0039135	Ga0496109_0039135_409_1374	320
433	3300048913	Ga0496110_0169648	Ga0496110_0169648_352_1317	320
434	3300048915	Ga0496112_0220404	Ga0496112_0220404_412_1377	320
435	3300049568	Ga0501031_0070955	Ga0501031_0070955_287_1252	320
436	3300049572	Ga0501036_0260098	Ga0501036_0260098_18_989	320
437	3300049578	Ga0501042_0108287	Ga0501042_0108287_128_1099	320
438	3300049588	Ga0501072_0300488	Ga0501072_0300488_128_1099	320
439	3300049591	Ga0501075_0184537	Ga0501075_0184537_192_1157	320
440	3300049592	Ga0501076_0248582	Ga0501076_0248582_279_1244	320
441	3300050507	nmdc:mga05p37_10760_c1	nmdc:mga05p37_10760_c1_2602_3564	320
442	3300050507	nmdc:mga05p37_135566_c1	nmdc:mga05p37_135566_c1_424_1386	320
443	3300050507	nmdc:mga05p37_363390_c1	nmdc:mga05p37_363390_c1_499_1464	320
444	3300050507	nmdc:mga05p37_82050_c1	nmdc:mga05p37_82050_c1_2945_3910	320
445	3300050508	nmdc:mga09592_308816_c1	nmdc:mga09592_308816_c1_246_1208	320
446	3300050509	nmdc:mga0qj67_162678_c1	nmdc:mga0qj67_162678_c1_17_979	320
447	3300050509	nmdc:mga0qj67_1756_c1	nmdc:mga0qj67_1756_c1_7740_8702	320
448	3300050510	nmdc:mga06r32_4522_c1	nmdc:mga06r32_4522_c1_8399_9361	320
449	3300050511	nmdc:mga08y16_36554_c1	nmdc:mga08y16_36554_c1_1243_2214	320
450	3300050515	nmdc:mga0a205_80662_c1	nmdc:mga0a205_80662_c1_2067_3032	320

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00294

PfkB

pfkB family carbohydrate kinase

4

305

0.89 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2q5r-assembly2.cif.gz_C	structure of apo staphylococcus aureus d-tagatose-6-phosphate kinase	0.9223	1	312
3uqd-assembly1.cif.gz_C	crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products	0.9186	2	305
2awd-assembly1.cif.gz_B	crystal structure of lacc from enterococcus faecalis	0.9165	2	313
2q5r-assembly2.cif.gz_C	structure of apo staphylococcus aureus d-tagatose-6-phosphate kinase	0.9165	1	312
2awd-assembly1.cif.gz_B	crystal structure of lacc from enterococcus faecalis	0.9082	2	313

ID	Description	Score	Start	End	Superfamily
af_P9WID3_12_317_3.40.1190.20	Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase	0.9324	2	308	3.40.1190.20
af_P0AEW9_2_310_3.40.1190.20	Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase	0.9255	2	310	3.40.1190.20
af_P9WID3_12_317_3.40.1190.20	Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase	0.9236	2	308	3.40.1190.20
2awdB00	Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase	0.9129	2	313	3.40.1190.20
af_P0AEW9_2_310_3.40.1190.20	Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase	0.9112	2	310	3.40.1190.20

ID	Description	Score	Start	End	GO Terms
AF-A0A7V9VRE8-F1-model_v4	deleted	0.9922	1	298
AF-A0A7V9VRE8-F1-model_v4	deleted	0.9856	1	298
AF-A0A538D0D1-F1-model_v4	1-phosphofructokinase family hexose kinase	0.9838	2	316	GO:0005524 GO:0005829 GO:0008443
AF-A0A7W0UUS3-F1-model_v4	1-phosphofructokinase family hexose kinase	0.9781	141	313	GO:0005524 GO:0016301
AF-A0A538FXQ8-F1-model_v4	1-phosphofructokinase family hexose kinase	0.9765	36	316	GO:0005524 GO:0005829 GO:0008443

Feature Viewer

pLDDT	pTM	Quality
93.39	0.92	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F446646

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00294

PfkB

pfkB family carbohydrate kinase

4

305

0.89

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map