F446600

General Info

Members Datasets Scaffolds Average Seq Length
450 202 900 393

Family's Representative Sequence

Representative Sequence 3300025932|Ga0207690_10056988|Ga0207690_100569881
Length 466
Sequence MATAVCLKRQRQCKKEWLRWFDQASVAALCERRRHCRAQIGRRSETAATAHFRSLNDFACRRTSAEIMVRVSYMIRRDYLVVGASIGGASACEGIRKYDKRSSVTLVGAEAFPPYKRWIISKGFLREKEPNLKKLQEFDDRWFEAHKIEARFGTVVTQFNIERRLAVLANGESIEFTKACLAMGSRPVRPAMAGTGLGNVIYLRTIRDALALREMASLEKTIMVVGGGLLACEAAASLRMMKMKVGLMHRDSYLLNRYIDPDTGAWLTDYFAKHGVVLSMGEALNGFEGKTVLRNIQTKSGNRFPVGLAVVACGAEPNLDLVRNTPLAGPHGSPVTEYLETEEKGIYAIGDLAFYPDRIMGGMRRQTHWENARQQGLVAGANMTGKKRIRYEQVPYFWTEMFDLRLDFVGDFTLAPTRVNLDGTYPKKKFIARYYQGDKLRGILLCQQTQREVDAAKNQLRQALSK

Samples

Sample ID Description Type Environment
1 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
155 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
172 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
202 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 9.11
Rhizosphere 88.22
Stem 0
Stem Tuber 0
Unclassified 19.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207690_10056988 3300025932 Bacteria 2638
2 SwRhRL2b_contig_181512 2162886007 Bacteria 1608
3 SwRhRL2b_contig_778618 2162886007 Bacteria 1784
4 CNXas_1000153 3300000545 Bacteria 11863
5 JGI24035J26624_1000844 3300002126 Bacteria 2895
6 JGI25406J46586_10040971 3300003203 Bacteria 1635
7 JGI25405J52794_10001479 3300003911 Bacteria 3875
8 JGI25405J52794_10005671 3300003911 Bacteria 2261
9 Ga0065704_10006724 3300005289 Bacteria 4206
10 Ga0065704_10012572 3300005289 Bacteria 2307
11 Ga0065712_10011629 3300005290 Bacteria 2380
12 Ga0065715_10004824 3300005293 Bacteria 3393
13 Ga0065715_10015554 3300005293 Bacteria 2663
14 Ga0065715_10108426 3300005293 Bacteria 2720
15 Ga0065715_10152559 3300005293 Bacteria 1712
16 Ga0065707_10003448 3300005295 Bacteria 5341
17 Ga0070658_10001569 3300005327 Bacteria 19372
18 Ga0070676_10003758 3300005328 Bacteria 7957
19 Ga0070676_10023566 3300005328 Bacteria 3460
20 Ga0070676_10027046 3300005328 Unclassified 3251
21 Ga0070676_10036225 3300005328 Bacteria 2841
22 Ga0070683_100006293 3300005329 Bacteria 9964
23 Ga0070683_100049246 3300005329 Unclassified 3896
24 Ga0070690_100036774 3300005330 Bacteria 3080
25 Ga0070690_100042064 3300005330 Bacteria 2894
26 Ga0070670_100009411 3300005331 Bacteria 8341
27 Ga0070670_100040133 3300005331 Bacteria 4025
28 Ga0070666_10007184 3300005335 Bacteria 6866
29 Ga0070666_10018273 3300005335 Unclassified 4505
30 Ga0070666_10024600 3300005335 Bacteria 3924
31 Ga0070666_10126952 3300005335 Bacteria 1770
32 Ga0068868_100018732 3300005338 Bacteria 5179
33 Ga0068868_100048580 3300005338 Bacteria 3328
34 Ga0068868_100078705 3300005338 Unclassified 2640
35 Ga0068868_100153674 3300005338 Bacteria 1896
36 Ga0070689_100002552 3300005340 Bacteria 11937
37 Ga0070689_100022760 3300005340 Bacteria 4683
38 Ga0070689_100022775 3300005340 Bacteria 4681
39 Ga0070689_100158624 3300005340 Bacteria 1828
40 Ga0070687_100049642 3300005343 Unclassified 2163
41 Ga0070661_100061124 3300005344 Bacteria 2765
42 Ga0070668_100002703 3300005347 Bacteria 13049
43 Ga0070668_100040235 3300005347 Unclassified 3577
44 Ga0070668_100061043 3300005347 Bacteria 2920
45 Ga0070668_100071899 3300005347 Bacteria 2695
46 Ga0070669_100023285 3300005353 Bacteria 4435
47 Ga0070669_100121575 3300005353 Bacteria 1993
48 Ga0070669_100142491 3300005353 Bacteria 1849
49 Ga0070675_100001913 3300005354 Bacteria 15388
50 Ga0070675_100002819 3300005354 Bacteria 13104
51 Ga0070675_100060769 3300005354 Bacteria 3119
52 Ga0070675_100062817 3300005354 Bacteria 3069
53 Ga0070675_100132794 3300005354 Unclassified 2123
54 Ga0070675_100158280 3300005354 Bacteria 1946
55 Ga0070671_100004671 3300005355 Bacteria 10866
56 Ga0070671_100008681 3300005355 Bacteria 8152
57 Ga0070671_100025816 3300005355 Bacteria 4824
58 Ga0070671_100052801 3300005355 Bacteria 3379
59 Ga0070671_100083975 3300005355 Bacteria 2663
60 Ga0070671_100154729 3300005355 Bacteria 1937
61 Ga0070671_100207718 3300005355 Bacteria 1661
62 Ga0070674_100006832 3300005356 Bacteria 6687
63 Ga0070673_100036756 3300005364 Bacteria 3726
64 Ga0070673_100053150 3300005364 Unclassified 3180
65 Ga0070673_100114081 3300005364 Bacteria 2244
66 Ga0070673_100161222 3300005364 Bacteria 1907
67 Ga0070688_100007151 3300005365 Bacteria 6007
68 Ga0070688_100056219 3300005365 Bacteria 2471
69 Ga0070659_100082636 3300005366 Bacteria 2566
70 Ga0070667_100004019 3300005367 Bacteria 12450
71 Ga0070667_100070903 3300005367 Unclassified 2967
72 Ga0070667_100087678 3300005367 Bacteria 2671
73 Ga0070703_10019440 3300005406 Unclassified 1969
74 Ga0070714_100294017 3300005435 Bacteria 1512
75 Ga0070713_100037656 3300005436 Bacteria 3911
76 Ga0070713_100204591 3300005436 Bacteria 1784
77 Ga0070710_10062971 3300005437 Archaea 2118
78 Ga0070711_100004847 3300005439 Bacteria 7984
79 Ga0070705_100012163 3300005440 Bacteria 4366
80 Ga0070705_100040358 3300005440 Bacteria 2654
81 Ga0070700_100005506 3300005441 Bacteria 6719
82 Ga0070708_100004119 3300005445 Bacteria 11411
83 Ga0070708_100010678 3300005445 Bacteria 7450
84 Ga0070708_100026057 3300005445 Bacteria 5001
85 Ga0070708_100037667 3300005445 Unclassified 4221
86 Ga0070708_100101766 3300005445 Bacteria 2632
87 Ga0070663_100045081 3300005455 Bacteria 3114
88 Ga0070678_100131820 3300005456 Unclassified 1987
89 Ga0070678_100145631 3300005456 Bacteria 1901
90 Ga0070662_100001230 3300005457 Bacteria 15735
91 Ga0070662_100012776 3300005457 Bacteria 5575
92 Ga0070662_100107167 3300005457 Unclassified 2124
93 Ga0070681_10141395 3300005458 Bacteria 2336
94 Ga0068867_100025474 3300005459 Unclassified 4244
95 Ga0070685_10032790 3300005466 Unclassified 2912
96 Ga0070706_100000012 3300005467 Bacteria 195040
97 Ga0070706_100008143 3300005467 Bacteria 9778
98 Ga0070706_100008837 3300005467 Bacteria 9387
99 Ga0070706_100029983 3300005467 Bacteria 5009
100 Ga0070706_100179949 3300005467 Unclassified 1974
101 Ga0070707_100002059 3300005468 Bacteria 19267
102 Ga0070707_100005403 3300005468 Bacteria 11956
103 Ga0070707_100011888 3300005468 Bacteria 8125
104 Ga0070707_100027841 3300005468 Bacteria 5376
105 Ga0070707_100052450 3300005468 Unclassified 3910
106 Ga0070707_100060684 3300005468 Bacteria 3627
107 Ga0070707_100103684 3300005468 Unclassified 2756
108 Ga0070707_100131175 3300005468 Bacteria 2437
109 Ga0070707_100174905 3300005468 Bacteria 2092
110 Ga0070707_100199757 3300005468 Unclassified 1949
111 Ga0070698_100004384 3300005471 Bacteria 15505
112 Ga0070699_100014817 3300005518 Bacteria 6704
113 Ga0070699_100037368 3300005518 Unclassified 4201
114 Ga0070684_100001480 3300005535 Bacteria 16949
115 Ga0070684_100047836 3300005535 Bacteria 3708
116 Ga0070684_100272537 3300005535 Bacteria 1549
117 Ga0070697_100004210 3300005536 Bacteria 11022
118 Ga0070697_100004427 3300005536 Bacteria 10788
119 Ga0070697_100010187 3300005536 Bacteria 7335
120 Ga0070697_100010757 3300005536 Bacteria 7144
121 Ga0070697_100011816 3300005536 Bacteria 6835
122 Ga0070697_100024842 3300005536 Bacteria 4772
123 Ga0070697_100036997 3300005536 Bacteria 3943
124 Ga0070697_100068297 3300005536 Unclassified 2910
125 Ga0070697_100122774 3300005536 Unclassified 2173
126 Ga0070672_100019338 3300005543 Bacteria 4942
127 Ga0070672_100054912 3300005543 Bacteria 3119
128 Ga0070686_100105768 3300005544 Bacteria 1909
129 Ga0070695_100114667 3300005545 Unclassified 1835
130 Ga0070696_100096772 3300005546 Bacteria 2110
131 Ga0070693_100030003 3300005547 Bacteria 2970
132 Ga0070665_100015262 3300005548 Bacteria 7712
133 Ga0070665_100067916 3300005548 Bacteria 3574
134 Ga0070665_100110761 3300005548 Unclassified 2748
135 Ga0070665_100177574 3300005548 Bacteria 2130
136 Ga0068855_100034130 3300005563 Bacteria 6070
137 Ga0070664_100039630 3300005564 Unclassified 3970
138 Ga0068856_100129242 3300005614 Bacteria 2530
139 Ga0068858_100075516 3300005842 Unclassified 3130
140 Ga0068858_100088554 3300005842 Bacteria 2880
141 Ga0068860_100007487 3300005843 Bacteria 10922
142 Ga0068860_100011303 3300005843 Bacteria 8797
143 Ga0068860_100143430 3300005843 Bacteria 2296
144 Ga0068862_100043630 3300005844 Unclassified 3824
145 Ga0081455_10001583 3300005937 Bacteria 27844
146 Ga0081455_10005310 3300005937 Bacteria 14147
147 Ga0081455_10006228 3300005937 Bacteria 12846
148 Ga0081455_10028340 3300005937 Bacteria 5118
149 Ga0081455_10034490 3300005937 Bacteria 4532
150 Ga0081455_10054596 3300005937 Bacteria 3403
151 Ga0081540_1000016 3300005983 Bacteria 165370
152 Ga0081540_1016917 3300005983 Bacteria 4539
153 Ga0081540_1023814 3300005983 Unclassified 3568
154 Ga0081540_1025514 3300005983 Bacteria 3397
155 Ga0081539_10000710 3300005985 Bacteria 66710
156 Ga0081539_10043104 3300005985 Unclassified 2619
157 Ga0081539_10115781 3300005985 Unclassified 1340
158 Ga0070717_10046888 3300006028 Bacteria 3538
159 Ga0070717_10063167 3300006028 Bacteria 3072
160 Ga0070717_10220027 3300006028 Bacteria 1669
161 Ga0070717_10224417 3300006028 Bacteria 1652
162 Ga0070716_100016992 3300006173 Bacteria 3765
163 Ga0070716_100074440 3300006173 Bacteria 2006
164 Ga0070716_100108509 3300006173 Bacteria 1715
165 Ga0070712_100007631 3300006175 Bacteria 6767
166 Ga0070712_100144344 3300006175 Bacteria 1820
167 Ga0070712_100196086 3300006175 Bacteria 1583
168 Ga0097621_100060230 3300006237 Bacteria 3111
169 Ga0097621_100140731 3300006237 Bacteria 2061
170 Ga0068871_100013101 3300006358 Bacteria 6148
171 Ga0068871_100016688 3300006358 Bacteria 5539
172 Ga0068871_100027873 3300006358 Bacteria 4423
173 Ga0068871_100144018 3300006358 Bacteria 2028
174 Ga0075434_100139987 3300006871 Bacteria 2439
175 Ga0075434_100172981 3300006871 Unclassified 2179
176 Ga0068865_100009064 3300006881 Bacteria 6154
177 Ga0075435_100221710 3300007076 Unclassified 1606
178 Ga0099795_10019179 3300007788 Unclassified 2209
179 Ga0105240_10133143 3300009093 Bacteria 2979
180 Ga0111539_10073974 3300009094 Bacteria 4016
181 Ga0111539_10178433 3300009094 Bacteria 2481
182 Ga0111539_10315080 3300009094 Bacteria 1821
183 Ga0105245_10004487 3300009098 Bacteria 12341
184 Ga0105245_10034033 3300009098 Unclassified 4517
185 Ga0105245_10090017 3300009098 Unclassified 2822
186 Ga0105245_10256887 3300009098 Bacteria 1699
187 Ga0105247_10062722 3300009101 Bacteria 2306
188 Ga0114129_10045022 3300009147 Bacteria 6205
189 Ga0114129_10247047 3300009147 Unclassified 2397
190 Ga0105242_10002735 3300009176 Bacteria 13799
191 Ga0105237_10032038 3300009545 Bacteria 5324
192 Ga0105249_10002668 3300009553 Bacteria 15426
193 Ga0105249_10024095 3300009553 Bacteria 5467
194 Ga0105239_10021662 3300010375 Bacteria 7085
195 Ga0105239_10118377 3300010375 Bacteria 2940
196 Ga0105239_10132247 3300010375 Bacteria 2776
197 Ga0105239_10174769 3300010375 Bacteria 2402
198 Ga0105239_10200641 3300010375 Bacteria 2235
199 Ga0157373_10119592 3300013100 Bacteria 1851
200 Ga0157371_10162683 3300013102 Bacteria 1594
201 Ga0157374_10019691 3300013296 Bacteria 5976
202 Ga0157374_10020298 3300013296 Bacteria 5894
203 Ga0157374_10056753 3300013296 Unclassified 3656
204 Ga0157374_10254724 3300013296 Bacteria 1728
205 Ga0157374_10458748 3300013296 Bacteria 1276
206 Ga0157378_10013724 3300013297 Bacteria 7086
207 Ga0157378_10016050 3300013297 Bacteria 6560
208 Ga0157378_10022345 3300013297 Bacteria 5568
209 Ga0157378_10029988 3300013297 Bacteria 4803
210 Ga0157378_10032338 3300013297 Bacteria 4623
211 Ga0157378_10048257 3300013297 Bacteria 3785
212 Ga0157378_10048623 3300013297 Bacteria 3771
213 Ga0157378_10074512 3300013297 Bacteria 3055
214 Ga0163162_10007087 3300013306 Bacteria 10879
215 Ga0163162_10009271 3300013306 Bacteria 9572
216 Ga0163162_10031726 3300013306 Bacteria 5242
217 Ga0163162_10128076 3300013306 Bacteria 2646
218 Ga0163162_10138599 3300013306 Bacteria 2544
219 Ga0163162_10339376 3300013306 Bacteria 1635
220 Ga0157372_10013476 3300013307 Bacteria 8737
221 Ga0157372_10037824 3300013307 Bacteria 5324
222 Ga0157372_10272475 3300013307 Unclassified 1967
223 Ga0157372_10351578 3300013307 Unclassified 1717
224 Ga0157375_10003300 3300013308 Bacteria 13973
225 Ga0157375_10025020 3300013308 Bacteria 5537
226 Ga0157375_10106434 3300013308 Unclassified 2896
227 Ga0157375_10107244 3300013308 Bacteria 2886
228 Ga0157377_10006181 3300014745 Bacteria 5692
229 Ga0157377_10035037 3300014745 Bacteria 2750
230 Ga0157376_10010930 3300014969 Bacteria 6668
231 Ga0157376_10068009 3300014969 Bacteria 3015
232 Ga0157376_10322740 3300014969 Bacteria 1468
233 Ga0213876_10006458 3300021384 Bacteria 6392
234 Ga0213876_10009458 3300021384 Bacteria 5247
235 Ga0213876_10025740 3300021384 Bacteria 3102
236 Ga0207666_1003249 3300025271 Bacteria 1991
237 Ga0209050_1000485 3300025298 Bacteria 69621
238 Ga0207697_10000238 3300025315 Bacteria 29919
239 Ga0207697_10000633 3300025315 Bacteria 20039
240 Ga0207697_10008312 3300025315 Bacteria 4552
241 Ga0207697_10013166 3300025315 Bacteria 3454
242 Ga0207697_10014191 3300025315 Bacteria 3311
243 Ga0207697_10053087 3300025315 Bacteria 1678
244 Ga0207688_10000429 3300025901 Bacteria 19807
245 Ga0207688_10002365 3300025901 Bacteria 10147
246 Ga0207680_10025051 3300025903 Unclassified 3286
247 Ga0207647_10009012 3300025904 Bacteria 7110
248 Ga0207685_10021848 3300025905 Bacteria 2152
249 Ga0207699_10054179 3300025906 Bacteria 2381
250 Ga0207645_10001920 3300025907 Bacteria 16778
251 Ga0207645_10002430 3300025907 Bacteria 14666
252 Ga0207645_10002801 3300025907 Bacteria 13548
253 Ga0207645_10009870 3300025907 Bacteria 6580
254 Ga0207645_10135309 3300025907 Bacteria 1605
255 Ga0207684_10000028 3300025910 Bacteria 306450
256 Ga0207684_10003057 3300025910 Bacteria 16580
257 Ga0207684_10013551 3300025910 Bacteria 7051
258 Ga0207684_10033158 3300025910 Bacteria 4393
259 Ga0207684_10038636 3300025910 Bacteria 4050
260 Ga0207671_10041812 3300025914 Bacteria 3392
261 Ga0207693_10000433 3300025915 Bacteria 38136
262 Ga0207693_10006226 3300025915 Bacteria 9897
263 Ga0207693_10076069 3300025915 Unclassified 2629
264 Ga0207693_10114031 3300025915 Bacteria 2120
265 Ga0207663_10051086 3300025916 Unclassified 2573
266 Ga0207663_10177698 3300025916 Bacteria 1517
267 Ga0207660_10030572 3300025917 Bacteria 3703
268 Ga0207662_10000531 3300025918 Bacteria 16918
269 Ga0207657_10007481 3300025919 Bacteria 11193
270 Ga0207649_10195940 3300025920 Bacteria 1424
271 Ga0207652_10155176 3300025921 Bacteria 2051
272 Ga0207646_10002142 3300025922 Bacteria 23602
273 Ga0207646_10006655 3300025922 Bacteria 11913
274 Ga0207646_10020596 3300025922 Bacteria 6109
275 Ga0207646_10040889 3300025922 Unclassified 4168
276 Ga0207646_10078691 3300025922 Unclassified 2947
277 Ga0207646_10093230 3300025922 Bacteria 2696
278 Ga0207646_10096189 3300025922 Unclassified 2653
279 Ga0207646_10112594 3300025922 Unclassified 2443
280 Ga0207646_10179040 3300025922 Bacteria 1915
281 Ga0207681_10010340 3300025923 Bacteria 5709
282 Ga0207681_10019769 3300025923 Unclassified 4261
283 Ga0207681_10074972 3300025923 Bacteria 2371
284 Ga0207681_10111216 3300025923 Bacteria 1993
285 Ga0207659_10011937 3300025926 Bacteria 5502
286 Ga0207659_10034096 3300025926 Bacteria 3508
287 Ga0207659_10098782 3300025926 Unclassified 2196
288 Ga0207687_10202534 3300025927 Unclassified 1552
289 Ga0207700_10007425 3300025928 Bacteria 6697
290 Ga0207664_10083507 3300025929 Bacteria 2604
291 Ga0207644_10042094 3300025931 Bacteria 3235
292 Ga0207644_10106218 3300025931 Bacteria 2116
293 Ga0207644_10166558 3300025931 Bacteria 1717
294 Ga0207706_10002639 3300025933 Bacteria 17466
295 Ga0207706_10006891 3300025933 Bacteria 10507
296 Ga0207706_10015605 3300025933 Bacteria 6864
297 Ga0207706_10023482 3300025933 Bacteria 5538
298 Ga0207706_10170864 3300025933 Unclassified 1910
299 Ga0207706_10172287 3300025933 Bacteria 1902
300 Ga0207686_10116817 3300025934 Bacteria 1809
301 Ga0207670_10016925 3300025936 Bacteria 4395
302 Ga0207670_10067839 3300025936 Bacteria 2455
303 Ga0207670_10070157 3300025936 Bacteria 2419
304 Ga0207665_10010103 3300025939 Bacteria 6198
305 Ga0207665_10038898 3300025939 Bacteria 3169
306 Ga0207665_10097566 3300025939 Bacteria 2046
307 Ga0207665_10148089 3300025939 Bacteria 1679
308 Ga0207691_10000306 3300025940 Bacteria 48746
309 Ga0207691_10000861 3300025940 Bacteria 30154
310 Ga0207691_10080350 3300025940 Unclassified 2932
311 Ga0207691_10136985 3300025940 Bacteria 2159
312 Ga0207689_10218227 3300025942 Bacteria 1576
313 Ga0207661_10092820 3300025944 Bacteria 2517
314 Ga0207661_10174233 3300025944 Bacteria 1874
315 Ga0207679_10139615 3300025945 Bacteria 1957
316 Ga0207679_10261794 3300025945 Bacteria 1475
317 Ga0207667_10016188 3300025949 Bacteria 8430
318 Ga0207667_10243073 3300025949 Unclassified 1842
319 Ga0207712_10026703 3300025961 Bacteria 3850
320 Ga0207712_10034283 3300025961 Unclassified 3439
321 Ga0207640_10296219 3300025981 Unclassified 1278
322 Ga0207658_10083819 3300025986 Bacteria 2451
323 Ga0207658_10145708 3300025986 Bacteria 1923
324 Ga0207677_10050290 3300026023 Bacteria 2818
325 Ga0207677_10057848 3300026023 Bacteria 2665
326 Ga0207703_10125835 3300026035 Bacteria 2206
327 Ga0207678_10003665 3300026067 Bacteria 13808
328 Ga0207641_10150904 3300026088 Unclassified 2104
329 Ga0207648_10051905 3300026089 Bacteria 3585
330 Ga0207648_10150414 3300026089 Bacteria 2054
331 Ga0207683_10011983 3300026121 Bacteria 7401
332 Ga0207683_10013132 3300026121 Bacteria 7065
333 Ga0207683_10015753 3300026121 Bacteria 6433
334 Ga0209971_1018590 3300027682 Bacteria 1649
335 Ga0268266_10112771 3300028379 Bacteria 2410
336 Ga0268265_10034880 3300028380 Unclassified 3671
337 Ga0268265_10058735 3300028380 Bacteria 2939
338 Ga0268265_10125804 3300028380 Bacteria 2121
339 Ga0268264_10056452 3300028381 Bacteria 3283
340 Ga0268264_10119531 3300028381 Bacteria 2320
341 Ga0373943_0012890 3300035170 Bacteria 3769
342 Ga0373943_0048415 3300035170 Unclassified 2082
343 Ga0373943_0073064 3300035170 Bacteria 1741
344 Ga0373955_0021396 3300035172 Bacteria 3264
345 Ga0373955_0044832 3300035172 Bacteria 2384
346 Ga0373931_0076362 3300035691 Unclassified 1840
347 Ga0373927_0095599 3300035695 Bacteria 1931
348 Ga0373947_0036821 3300035725 Bacteria 2902
349 Ga0373937_0032376 3300036401 Bacteria 4742
350 Ga0373925_0063066 3300037068 Unclassified 2788
351 Ga0395900_0002016 3300037418 Bacteria 22869
352 Ga0395900_0040192 3300037418 Bacteria 4820
353 Ga0395900_0338070 3300037418 Bacteria 1482
354 Ga0395898_0101756 3300037466 Unclassified 2759
355 Ga0395905_0005024 3300037471 Bacteria 13625
356 Ga0395905_0119073 3300037471 Unclassified 2482
357 Ga0395905_0365086 3300037471 Bacteria 1337
358 Ga0436364_1331903 3300037853 Bacteria 1862
359 Ga0395901_0003034 3300038443 Bacteria 16918
360 Ga0395901_0058616 3300038443 Unclassified 4005
361 Ga0395901_0169629 3300038443 Bacteria 2290
362 Ga0395901_0392415 3300038443 Unclassified 1427
363 Ga0436365_0213459 3300039437 Unclassified 1841
364 Ga0436365_0786173 3300039437 Bacteria 9533
365 Ga0436365_1394048 3300039437 Unclassified 2578
366 Ga0436365_1505403 3300039437 Bacteria 13109
367 Ga0436363_1059786 3300039450 Unclassified 1562
368 Ga0451851_0763916 3300041507 Bacteria 1370
369 Ga0439458_0025812 3300042157 Unclassified 1379
370 Ga0451577_0037525 3300042876 Bacteria 4361
371 Ga0451576_0004806 3300045051 Bacteria 17305
372 Ga0495651_0017490 3300046462 Bacteria 5553
373 Ga0495580_0118173 3300046472 Bacteria 1841
374 Ga0495580_0154751 3300046472 Bacteria 1588
375 Ga0495580_0176978 3300046472 Archaea 1474
376 Ga0495582_0119926 3300046473 Bacteria 1482
377 Ga0495605_0084761 3300046474 Unclassified 1477
378 Ga0495664_0094218 3300046477 Bacteria 1802
379 Ga0495643_0000815 3300046522 Bacteria 34055
380 Ga0495642_0052578 3300046528 Unclassified 1678
381 Ga0495652_0065680 3300046529 Unclassified 3047
382 Ga0495652_0081220 3300046529 Bacteria 2674
383 Ga0495586_0050576 3300046535 Bacteria 2249
384 Ga0495587_0081772 3300046536 Bacteria 1872
385 Ga0495598_0008594 3300046537 Unclassified 2384
386 Ga0495634_0091992 3300046642 Bacteria 1968
387 Ga0495599_0004467 3300046678 Bacteria 8286
388 Ga0495623_0103571 3300046679 Unclassified 1731
389 Ga0495646_0014278 3300046680 Bacteria 5052
390 Ga0495658_0034303 3300046683 Bacteria 2784
391 Ga0495669_0012268 3300046684 Unclassified 3645
392 Ga0495669_0050526 3300046684 Bacteria 1865
393 Ga0495674_0031926 3300047319 Unclassified 4779
394 Ga0495674_0122382 3300047319 Unclassified 2197
395 Ga0495675_0013090 3300047444 Bacteria 5232
396 Ga0495681_0078051 3300047470 Unclassified 1485
397 Ga0495684_0030903 3300047471 Bacteria 4112
398 Ga0495602_0126249 3300048088 Bacteria 2049
399 Ga0496100_0014555 3300048903 Bacteria 4569
400 Ga0496100_0140118 3300048903 Bacteria 1713
401 Ga0496101_0001941 3300048904 Bacteria 12525
402 Ga0496101_0170651 3300048904 Bacteria 1672
403 Ga0496101_0323661 3300048904 Unclassified 1210
404 Ga0496102_0093674 3300048905 Unclassified 2783
405 Ga0496102_0119186 3300048905 Bacteria 2464
406 Ga0496102_0176523 3300048905 Bacteria 2012
407 Ga0496103_0077917 3300048906 Bacteria 2081
408 Ga0496104_0006204 3300048907 Bacteria 10502
409 Ga0496104_0078099 3300048907 Bacteria 3154
410 Ga0496104_0324267 3300048907 Unclassified 1453
411 Ga0496105_0042391 3300048908 Bacteria 3752
412 Ga0496105_0052765 3300048908 Bacteria 3358
413 Ga0496106_0002667 3300048909 Bacteria 13285
414 Ga0496106_0116483 3300048909 Bacteria 2084
415 Ga0496107_0012424 3300048910 Bacteria 5945
416 Ga0496108_0020345 3300048911 Bacteria 5455
417 Ga0496108_0040868 3300048911 Bacteria 3869
418 Ga0496108_0155327 3300048911 Unclassified 1976
419 Ga0496109_0018202 3300048912 Bacteria 6168
420 Ga0496109_0138845 3300048912 Unclassified 2272
421 Ga0496109_0327116 3300048912 Bacteria 1447
422 Ga0496110_0227792 3300048913 Bacteria 1695
423 Ga0496110_0239006 3300048913 Bacteria 1653
424 Ga0496111_0061602 3300048914 Bacteria 2720
425 Ga0496111_0108479 3300048914 Unclassified 2044
426 Ga0496112_0022705 3300048915 Bacteria 5985
427 Ga0496112_0042275 3300048915 Bacteria 4458
428 Ga0496112_0065981 3300048915 Bacteria 3572
429 Ga0496112_0196531 3300048915 Bacteria 1977
430 Ga0496112_0235870 3300048915 Unclassified 1783
431 Ga0496113_0003243 3300048916 Bacteria 9707
432 Ga0496114_0019670 3300048917 Bacteria 5472
433 Ga0496114_0058697 3300048917 Bacteria 3213
434 Ga0496114_0067633 3300048917 Bacteria 2997
435 Ga0496115_0002621 3300048918 Bacteria 12908
436 Ga0496115_0009055 3300048918 Bacteria 7385
437 Ga0496115_0020928 3300048918 Bacteria 5048
438 Ga0496115_0029671 3300048918 Bacteria 4297
439 Ga0496115_0156750 3300048918 Bacteria 1881
440 Ga0501080_0017996 3300049742 Bacteria 6542
441 nmdc:mga07m45_96698_c1 3300050496 Bacteria 1694
442 nmdc:mga05p37_100237_c1 3300050507 Unclassified 3567
443 nmdc:mga08y16_156199_c1 3300050511 Bacteria 2370
444 nmdc:mga08y16_159624_c1 3300050511 Bacteria 2342
445 nmdc:mga08y16_170133_c1 3300050511 Bacteria 2263
446 nmdc:mga0n895_146911_c1 3300050512 Bacteria 2387
447 nmdc:mga0n895_218972_c1 3300050512 Unclassified 1933
448 nmdc:mga0n895_335613_c1 3300050512 Bacteria 1531
449 Ga0495655_0012841 3300053083 Bacteria 1717
450 Ga0495595_0041939 3300053084 Bacteria 2096
451 Ga0207690_10056988
452 SwRhRL2b_contig_181512
453 SwRhRL2b_contig_778618
454 CNXas_1000153
455 JGI24035J26624_1000844
456 JGI25406J46586_10040971
457 JGI25405J52794_10001479
458 JGI25405J52794_10005671
459 Ga0065704_10006724
460 Ga0065704_10012572
461 Ga0065712_10011629
462 Ga0065715_10004824
463 Ga0065715_10015554
464 Ga0065715_10108426
465 Ga0065715_10152559
466 Ga0065707_10003448
467 Ga0070658_10001569
468 Ga0070676_10003758
469 Ga0070676_10023566
470 Ga0070676_10027046
471 Ga0070676_10036225
472 Ga0070683_100006293
473 Ga0070683_100049246
474 Ga0070690_100036774
475 Ga0070690_100042064
476 Ga0070670_100009411
477 Ga0070670_100040133
478 Ga0070666_10007184
479 Ga0070666_10018273
480 Ga0070666_10024600
481 Ga0070666_10126952
482 Ga0068868_100018732
483 Ga0068868_100048580
484 Ga0068868_100078705
485 Ga0068868_100153674
486 Ga0070689_100002552
487 Ga0070689_100022760
488 Ga0070689_100022775
489 Ga0070689_100158624
490 Ga0070687_100049642
491 Ga0070661_100061124
492 Ga0070668_100002703
493 Ga0070668_100040235
494 Ga0070668_100061043
495 Ga0070668_100071899
496 Ga0070669_100023285
497 Ga0070669_100121575
498 Ga0070669_100142491
499 Ga0070675_100001913
500 Ga0070675_100002819
501 Ga0070675_100060769
502 Ga0070675_100062817
503 Ga0070675_100132794
504 Ga0070675_100158280
505 Ga0070671_100004671
506 Ga0070671_100008681
507 Ga0070671_100025816
508 Ga0070671_100052801
509 Ga0070671_100083975
510 Ga0070671_100154729
511 Ga0070671_100207718
512 Ga0070674_100006832
513 Ga0070673_100036756
514 Ga0070673_100053150
515 Ga0070673_100114081
516 Ga0070673_100161222
517 Ga0070688_100007151
518 Ga0070688_100056219
519 Ga0070659_100082636
520 Ga0070667_100004019
521 Ga0070667_100070903
522 Ga0070667_100087678
523 Ga0070703_10019440
524 Ga0070714_100294017
525 Ga0070713_100037656
526 Ga0070713_100204591
527 Ga0070710_10062971
528 Ga0070711_100004847
529 Ga0070705_100012163
530 Ga0070705_100040358
531 Ga0070700_100005506
532 Ga0070708_100004119
533 Ga0070708_100010678
534 Ga0070708_100026057
535 Ga0070708_100037667
536 Ga0070708_100101766
537 Ga0070663_100045081
538 Ga0070678_100131820
539 Ga0070678_100145631
540 Ga0070662_100001230
541 Ga0070662_100012776
542 Ga0070662_100107167
543 Ga0070681_10141395
544 Ga0068867_100025474
545 Ga0070685_10032790
546 Ga0070706_100000012
547 Ga0070706_100008143
548 Ga0070706_100008837
549 Ga0070706_100029983
550 Ga0070706_100179949
551 Ga0070707_100002059
552 Ga0070707_100005403
553 Ga0070707_100011888
554 Ga0070707_100027841
555 Ga0070707_100052450
556 Ga0070707_100060684
557 Ga0070707_100103684
558 Ga0070707_100131175
559 Ga0070707_100174905
560 Ga0070707_100199757
561 Ga0070698_100004384
562 Ga0070699_100014817
563 Ga0070699_100037368
564 Ga0070684_100001480
565 Ga0070684_100047836
566 Ga0070684_100272537
567 Ga0070697_100004210
568 Ga0070697_100004427
569 Ga0070697_100010187
570 Ga0070697_100010757
571 Ga0070697_100011816
572 Ga0070697_100024842
573 Ga0070697_100036997
574 Ga0070697_100068297
575 Ga0070697_100122774
576 Ga0070672_100019338
577 Ga0070672_100054912
578 Ga0070686_100105768
579 Ga0070695_100114667
580 Ga0070696_100096772
581 Ga0070693_100030003
582 Ga0070665_100015262
583 Ga0070665_100067916
584 Ga0070665_100110761
585 Ga0070665_100177574
586 Ga0068855_100034130
587 Ga0070664_100039630
588 Ga0068856_100129242
589 Ga0068858_100075516
590 Ga0068858_100088554
591 Ga0068860_100007487
592 Ga0068860_100011303
593 Ga0068860_100143430
594 Ga0068862_100043630
595 Ga0081455_10001583
596 Ga0081455_10005310
597 Ga0081455_10006228
598 Ga0081455_10028340
599 Ga0081455_10034490
600 Ga0081455_10054596
601 Ga0081540_1000016
602 Ga0081540_1016917
603 Ga0081540_1023814
604 Ga0081540_1025514
605 Ga0081539_10000710
606 Ga0081539_10043104
607 Ga0081539_10115781
608 Ga0070717_10046888
609 Ga0070717_10063167
610 Ga0070717_10220027
611 Ga0070717_10224417
612 Ga0070716_100016992
613 Ga0070716_100074440
614 Ga0070716_100108509
615 Ga0070712_100007631
616 Ga0070712_100144344
617 Ga0070712_100196086
618 Ga0097621_100060230
619 Ga0097621_100140731
620 Ga0068871_100013101
621 Ga0068871_100016688
622 Ga0068871_100027873
623 Ga0068871_100144018
624 Ga0075434_100139987
625 Ga0075434_100172981
626 Ga0068865_100009064
627 Ga0075435_100221710
628 Ga0099795_10019179
629 Ga0105240_10133143
630 Ga0111539_10073974
631 Ga0111539_10178433
632 Ga0111539_10315080
633 Ga0105245_10004487
634 Ga0105245_10034033
635 Ga0105245_10090017
636 Ga0105245_10256887
637 Ga0105247_10062722
638 Ga0114129_10045022
639 Ga0114129_10247047
640 Ga0105242_10002735
641 Ga0105237_10032038
642 Ga0105249_10002668
643 Ga0105249_10024095
644 Ga0105239_10021662
645 Ga0105239_10118377
646 Ga0105239_10132247
647 Ga0105239_10174769
648 Ga0105239_10200641
649 Ga0157373_10119592
650 Ga0157371_10162683
651 Ga0157374_10019691
652 Ga0157374_10020298
653 Ga0157374_10056753
654 Ga0157374_10254724
655 Ga0157374_10458748
656 Ga0157378_10013724
657 Ga0157378_10016050
658 Ga0157378_10022345
659 Ga0157378_10029988
660 Ga0157378_10032338
661 Ga0157378_10048257
662 Ga0157378_10048623
663 Ga0157378_10074512
664 Ga0163162_10007087
665 Ga0163162_10009271
666 Ga0163162_10031726
667 Ga0163162_10128076
668 Ga0163162_10138599
669 Ga0163162_10339376
670 Ga0157372_10013476
671 Ga0157372_10037824
672 Ga0157372_10272475
673 Ga0157372_10351578
674 Ga0157375_10003300
675 Ga0157375_10025020
676 Ga0157375_10106434
677 Ga0157375_10107244
678 Ga0157377_10006181
679 Ga0157377_10035037
680 Ga0157376_10010930
681 Ga0157376_10068009
682 Ga0157376_10322740
683 Ga0213876_10006458
684 Ga0213876_10009458
685 Ga0213876_10025740
686 Ga0207666_1003249
687 Ga0209050_1000485
688 Ga0207697_10000238
689 Ga0207697_10000633
690 Ga0207697_10008312
691 Ga0207697_10013166
692 Ga0207697_10014191
693 Ga0207697_10053087
694 Ga0207688_10000429
695 Ga0207688_10002365
696 Ga0207680_10025051
697 Ga0207647_10009012
698 Ga0207685_10021848
699 Ga0207699_10054179
700 Ga0207645_10001920
701 Ga0207645_10002430
702 Ga0207645_10002801
703 Ga0207645_10009870
704 Ga0207645_10135309
705 Ga0207684_10000028
706 Ga0207684_10003057
707 Ga0207684_10013551
708 Ga0207684_10033158
709 Ga0207684_10038636
710 Ga0207671_10041812
711 Ga0207693_10000433
712 Ga0207693_10006226
713 Ga0207693_10076069
714 Ga0207693_10114031
715 Ga0207663_10051086
716 Ga0207663_10177698
717 Ga0207660_10030572
718 Ga0207662_10000531
719 Ga0207657_10007481
720 Ga0207649_10195940
721 Ga0207652_10155176
722 Ga0207646_10002142
723 Ga0207646_10006655
724 Ga0207646_10020596
725 Ga0207646_10040889
726 Ga0207646_10078691
727 Ga0207646_10093230
728 Ga0207646_10096189
729 Ga0207646_10112594
730 Ga0207646_10179040
731 Ga0207681_10010340
732 Ga0207681_10019769
733 Ga0207681_10074972
734 Ga0207681_10111216
735 Ga0207659_10011937
736 Ga0207659_10034096
737 Ga0207659_10098782
738 Ga0207687_10202534
739 Ga0207700_10007425
740 Ga0207664_10083507
741 Ga0207644_10042094
742 Ga0207644_10106218
743 Ga0207644_10166558
744 Ga0207706_10002639
745 Ga0207706_10006891
746 Ga0207706_10015605
747 Ga0207706_10023482
748 Ga0207706_10170864
749 Ga0207706_10172287
750 Ga0207686_10116817
751 Ga0207670_10016925
752 Ga0207670_10067839
753 Ga0207670_10070157
754 Ga0207665_10010103
755 Ga0207665_10038898
756 Ga0207665_10097566
757 Ga0207665_10148089
758 Ga0207691_10000306
759 Ga0207691_10000861
760 Ga0207691_10080350
761 Ga0207691_10136985
762 Ga0207689_10218227
763 Ga0207661_10092820
764 Ga0207661_10174233
765 Ga0207679_10139615
766 Ga0207679_10261794
767 Ga0207667_10016188
768 Ga0207667_10243073
769 Ga0207712_10026703
770 Ga0207712_10034283
771 Ga0207640_10296219
772 Ga0207658_10083819
773 Ga0207658_10145708
774 Ga0207677_10050290
775 Ga0207677_10057848
776 Ga0207703_10125835
777 Ga0207678_10003665
778 Ga0207641_10150904
779 Ga0207648_10051905
780 Ga0207648_10150414
781 Ga0207683_10011983
782 Ga0207683_10013132
783 Ga0207683_10015753
784 Ga0209971_1018590
785 Ga0268266_10112771
786 Ga0268265_10034880
787 Ga0268265_10058735
788 Ga0268265_10125804
789 Ga0268264_10056452
790 Ga0268264_10119531
791 Ga0373943_0012890
792 Ga0373943_0048415
793 Ga0373943_0073064
794 Ga0373955_0021396
795 Ga0373955_0044832
796 Ga0373931_0076362
797 Ga0373927_0095599
798 Ga0373947_0036821
799 Ga0373937_0032376
800 Ga0373925_0063066
801 Ga0395900_0002016
802 Ga0395900_0040192
803 Ga0395900_0338070
804 Ga0395898_0101756
805 Ga0395905_0005024
806 Ga0395905_0119073
807 Ga0395905_0365086
808 Ga0436364_1331903
809 Ga0395901_0003034
810 Ga0395901_0058616
811 Ga0395901_0169629
812 Ga0395901_0392415
813 Ga0436365_0213459
814 Ga0436365_0786173
815 Ga0436365_1394048
816 Ga0436365_1505403
817 Ga0436363_1059786
818 Ga0451851_0763916
819 Ga0439458_0025812
820 Ga0451577_0037525
821 Ga0451576_0004806
822 Ga0495651_0017490
823 Ga0495580_0118173
824 Ga0495580_0154751
825 Ga0495580_0176978
826 Ga0495582_0119926
827 Ga0495605_0084761
828 Ga0495664_0094218
829 Ga0495643_0000815
830 Ga0495642_0052578
831 Ga0495652_0065680
832 Ga0495652_0081220
833 Ga0495586_0050576
834 Ga0495587_0081772
835 Ga0495598_0008594
836 Ga0495634_0091992
837 Ga0495599_0004467
838 Ga0495623_0103571
839 Ga0495646_0014278
840 Ga0495658_0034303
841 Ga0495669_0012268
842 Ga0495669_0050526
843 Ga0495674_0031926
844 Ga0495674_0122382
845 Ga0495675_0013090
846 Ga0495681_0078051
847 Ga0495684_0030903
848 Ga0495602_0126249
849 Ga0496100_0014555
850 Ga0496100_0140118
851 Ga0496101_0001941
852 Ga0496101_0170651
853 Ga0496101_0323661
854 Ga0496102_0093674
855 Ga0496102_0119186
856 Ga0496102_0176523
857 Ga0496103_0077917
858 Ga0496104_0006204
859 Ga0496104_0078099
860 Ga0496104_0324267
861 Ga0496105_0042391
862 Ga0496105_0052765
863 Ga0496106_0002667
864 Ga0496106_0116483
865 Ga0496107_0012424
866 Ga0496108_0020345
867 Ga0496108_0040868
868 Ga0496108_0155327
869 Ga0496109_0018202
870 Ga0496109_0138845
871 Ga0496109_0327116
872 Ga0496110_0227792
873 Ga0496110_0239006
874 Ga0496111_0061602
875 Ga0496111_0108479
876 Ga0496112_0022705
877 Ga0496112_0042275
878 Ga0496112_0065981
879 Ga0496112_0196531
880 Ga0496112_0235870
881 Ga0496113_0003243
882 Ga0496114_0019670
883 Ga0496114_0058697
884 Ga0496114_0067633
885 Ga0496115_0002621
886 Ga0496115_0009055
887 Ga0496115_0020928
888 Ga0496115_0029671
889 Ga0496115_0156750
890 Ga0501080_0017996
891 nmdc:mga07m45_96698_c1
892 nmdc:mga05p37_100237_c1
893 nmdc:mga08y16_156199_c1
894 nmdc:mga08y16_159624_c1
895 nmdc:mga08y16_170133_c1
896 nmdc:mga0n895_146911_c1
897 nmdc:mga0n895_218972_c1
898 nmdc:mga0n895_335613_c1
899 Ga0495655_0012841
900 Ga0495595_0041939

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

221

301

0.92

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

77

376

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1c0i-assembly1.cif.gz_A crystal structure of d-amino acid oxidase in complex with two anthranylate molecules 0.9847 147 177
4b3h-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis fatty acid beta- oxidation complex 0.9609 146 178
7d9i-assembly1.cif.gz_A spdh spermidine dehydrogenase d282a mutant 0.9478 1 41
3fg2-assembly1.cif.gz_P crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris 0.9449 4 373
7d9j-assembly1.cif.gz_A spdh spermidine dehydrogenase y443a mutant 0.9442 1 41
ID Description Score Start End Superfamily
af_P9WFZ3_1_135_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9738 148 179 3.40.50.720
af_A0A0R0JZ96_141_231_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.965 121 206 3.50.50.60
af_Q4DII7_126_432_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9624 5 40 3.50.50.60
2bc1B02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9544 123 239 3.50.50.60
4emjA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.954 121 238 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A2V5UUP7-F1-model_v4 FAD/NAD(P)-binding domain-containing protein 0.9807 1 322 GO:0005737
GO:0016651
AF-A0A2V6JXK0-F1-model_v4 FAD/NAD(P)-binding domain-containing protein 0.9748 259 393 GO:0005737
GO:0016651
AF-A0A2V6JXK0-F1-model_v4 FAD/NAD(P)-binding domain-containing protein 0.9678 259 393 GO:0005737
GO:0016651
AF-A0A845IZ47-F1-model_v4 deleted 0.9555 4 390
AF-A0A2E0LK78-F1-model_v4 Pyridine nucleotide-disulfide oxidoreductase 0.9523 4 390 GO:0005737
GO:0016651

Map