F446596

General Info

Members Datasets Scaffolds Average Seq Length
450 234 900 429

Family's Representative Sequence

Representative Sequence 3300025915|Ga0207693_10097327|Ga0207693_100973272
Length 443
Sequence MTYCLSLLRDEGPLMDKRKFLFVSLSSLIGDIAWQVLKEGHDVRYYIEAEKERDIADGFVPKSSNWEKDATEWADIVVFDDTLGQGAKAQALRTSGKPVIGGTPYTDNLEDDRSFGQEELKKAGVTIIPYQDFDSFDPAIEFVKKNPDRYVIKPSGEAQNVKRRLFVGEEEDGQDVIGMLEAYKKAFSEEIKVFQLQRRVNGVEVAVGGFFNGKKFITPININFEHKKLFPGEVGPPTGEMGTAMFWSEPNALFNRTLLKMEPKLAEEGYVGYIDVNCIVNNNGIYPLEFTSRFGYPTISIQQEGILTPISDLFWELANGLDPKWRTRSGFQIGVRIVVPPFPFDDEETFNSFSKNAAIIFKRPMNEGIHIEDVKQVNGQWFVAGTSGVVLIVIGTGQTMKQTQAQVYSRIKNVLIPNMYYRTDIGDRWVEDSDKLHNWGYLR

Samples

Sample ID Description Type Environment
1 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
164 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
165 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 3.33
Rhizosphere 96.22
Stem 0
Stem Tuber 0
Unclassified 5.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207693_10097327 3300025915 Bacteria 2307
2 Ga0065715_10126265 3300005293 Bacteria 2112
3 Ga0065715_10159311 3300005293 Bacteria 1596
4 Ga0070670_100001851 3300005331 Bacteria 17223
5 Ga0068869_100036462 3300005334 Bacteria 3492
6 Ga0068869_100212486 3300005334 Bacteria 1530
7 Ga0070666_10005702 3300005335 Archaea 7640
8 Ga0070680_100123231 3300005336 Bacteria 2165
9 Ga0070660_100155895 3300005339 Bacteria 1838
10 Ga0070689_100001173 3300005340 Bacteria 16583
11 Ga0070689_100062167 3300005340 Bacteria 2905
12 Ga0070691_10081365 3300005341 Archaea 1586
13 Ga0070661_100127245 3300005344 Archaea 1912
14 Ga0070668_100125022 3300005347 Bacteria 2059
15 Ga0070669_100017671 3300005353 Bacteria 5088
16 Ga0070669_100039288 3300005353 Bacteria 3438
17 Ga0070669_100057614 3300005353 Archaea 2851
18 Ga0070675_100002575 3300005354 Bacteria 13589
19 Ga0070675_100005245 3300005354 Bacteria 9890
20 Ga0070675_100015063 3300005354 Bacteria 6107
21 Ga0070675_100031446 3300005354 Bacteria 4291
22 Ga0070674_100009285 3300005356 Bacteria 5888
23 Ga0070673_100017113 3300005364 Bacteria 5145
24 Ga0070673_100059790 3300005364 Archaea 3017
25 Ga0070688_100001023 3300005365 Bacteria 14019
26 Ga0070688_100004834 3300005365 Bacteria 7045
27 Ga0070659_100001236 3300005366 Bacteria 18545
28 Ga0070667_100010878 3300005367 Archaea 7524
29 Ga0070709_10012564 3300005434 Bacteria 4742
30 Ga0070713_100001716 3300005436 Bacteria 14101
31 Ga0070710_10041932 3300005437 Bacteria 2528
32 Ga0070701_10070305 3300005438 Bacteria 1870
33 Ga0070711_100015368 3300005439 Bacteria 4845
34 Ga0070705_100011953 3300005440 Bacteria 4397
35 Ga0070705_100012578 3300005440 Bacteria 4306
36 Ga0070705_100100411 3300005440 Archaea 1826
37 Ga0070700_100002974 3300005441 Bacteria 8697
38 Ga0070694_100072160 3300005444 Bacteria 2381
39 Ga0070694_100197027 3300005444 Archaea 1499
40 Ga0070708_100008796 3300005445 Bacteria 8121
41 Ga0070708_100051109 3300005445 Bacteria 3661
42 Ga0070663_100008302 3300005455 Bacteria 6380
43 Ga0070663_100023410 3300005455 Bacteria 4140
44 Ga0070678_100027426 3300005456 Archaea 3867
45 Ga0070662_100000778 3300005457 Bacteria 19662
46 Ga0070662_100011020 3300005457 Archaea 5954
47 Ga0070662_100074189 3300005457 Bacteria 2516
48 Ga0068867_100000933 3300005459 Bacteria 19900
49 Ga0068867_100001868 3300005459 Bacteria 14629
50 Ga0068867_100044296 3300005459 Archaea 3260
51 Ga0070685_10026671 3300005466 Bacteria 3186
52 Ga0070706_100002841 3300005467 Bacteria 17294
53 Ga0070706_100016081 3300005467 Bacteria 6910
54 Ga0070707_100060724 3300005468 Bacteria 3625
55 Ga0070707_100074863 3300005468 Bacteria 3265
56 Ga0070698_100000678 3300005471 Bacteria 36352
57 Ga0070698_100002065 3300005471 Bacteria 22307
58 Ga0070698_100005790 3300005471 Bacteria 13519
59 Ga0070698_100066615 3300005471 Archaea 3624
60 Ga0070698_100266322 3300005471 Bacteria 1646
61 Ga0070699_100000081 3300005518 Bacteria 92126
62 Ga0070699_100070733 3300005518 Archaea 3034
63 Ga0070684_100000426 3300005535 Bacteria 28892
64 Ga0070697_100005328 3300005536 Bacteria 9886
65 Ga0070697_100008376 3300005536 Bacteria 8069
66 Ga0070697_100015770 3300005536 Bacteria 5934
67 Ga0070697_100046802 3300005536 Bacteria 3506
68 Ga0070672_100060361 3300005543 Archaea 2986
69 Ga0070686_100020620 3300005544 Archaea 3903
70 Ga0070695_100004439 3300005545 Bacteria 8238
71 Ga0070696_100019021 3300005546 Bacteria 4650
72 Ga0070693_100013937 3300005547 Bacteria 4106
73 Ga0070665_100000462 3300005548 Bacteria 59040
74 Ga0070665_100034172 3300005548 Bacteria 5113
75 Ga0070704_100006259 3300005549 Bacteria 7004
76 Ga0070704_100093268 3300005549 Bacteria 2249
77 Ga0070704_100123469 3300005549 Bacteria 1994
78 Ga0068855_100135324 3300005563 Bacteria 2812
79 Ga0068857_100068420 3300005577 Bacteria 3160
80 Ga0068854_100001425 3300005578 Bacteria 14456
81 Ga0068856_100003238 3300005614 Bacteria 16575
82 Ga0070702_100009852 3300005615 Bacteria 4690
83 Ga0068859_100001976 3300005617 Bacteria 20932
84 Ga0068859_100030676 3300005617 Bacteria 5395
85 Ga0068859_100045521 3300005617 Bacteria 4408
86 Ga0068859_100130580 3300005617 Bacteria 2583
87 Ga0068859_100305607 3300005617 Archaea 1684
88 Ga0068864_100019858 3300005618 Bacteria 5619
89 Ga0068864_100021899 3300005618 Bacteria 5358
90 Ga0068866_10003463 3300005718 Bacteria 6463
91 Ga0068861_100006210 3300005719 Bacteria 8130
92 Ga0068861_100111235 3300005719 Bacteria 2195
93 Ga0068870_10016322 3300005840 Bacteria 3544
94 Ga0068863_100013204 3300005841 Bacteria 7967
95 Ga0068863_100060070 3300005841 Bacteria 3595
96 Ga0068863_100107276 3300005841 Archaea 2657
97 Ga0068858_100006052 3300005842 Bacteria 11791
98 Ga0068858_100007846 3300005842 Archaea 10295
99 Ga0068858_100038245 3300005842 Bacteria 4451
100 Ga0068860_100002646 3300005843 Bacteria 18634
101 Ga0068860_100029139 3300005843 Bacteria 5310
102 Ga0068860_100169503 3300005843 Bacteria 2108
103 Ga0068862_100070858 3300005844 Bacteria 3010
104 Ga0081455_10011986 3300005937 Bacteria 8677
105 Ga0081455_10026068 3300005937 Bacteria 5386
106 Ga0081455_10088752 3300005937 Unclassified 2511
107 Ga0081540_1000215 3300005983 Bacteria 61058
108 Ga0070716_100024804 3300006173 Unclassified 3194
109 Ga0070716_100099694 3300006173 Bacteria 1778
110 Ga0070716_100189300 3300006173 Unclassified 1358
111 Ga0070712_100016031 3300006175 Bacteria 4834
112 Ga0070712_100100148 3300006175 Bacteria 2140
113 Ga0097621_100034524 3300006237 Archaea 4035
114 Ga0097621_100037368 3300006237 Bacteria 3890
115 Ga0097621_100039460 3300006237 Archaea 3792
116 Ga0097621_100064611 3300006237 Bacteria 3010
117 Ga0068871_100046577 3300006358 Bacteria 3493
118 Ga0068871_100050836 3300006358 Bacteria 3354
119 Ga0068871_100228959 3300006358 Archaea 1613
120 Ga0075428_100025296 3300006844 Bacteria 6570
121 Ga0075428_100121948 3300006844 Bacteria 2838
122 Ga0075430_100061189 3300006846 Bacteria 3164
123 Ga0075431_100002183 3300006847 Bacteria 18708
124 Ga0075431_100200185 3300006847 Archaea 2044
125 Ga0075433_10002902 3300006852 Bacteria 13138
126 Ga0075433_10003339 3300006852 Bacteria 12401
127 Ga0075433_10017281 3300006852 Bacteria 5970
128 Ga0075433_10018677 3300006852 Archaea 5765
129 Ga0075434_100001756 3300006871 Bacteria 18633
130 Ga0075434_100002026 3300006871 Bacteria 17597
131 Ga0075434_100021473 3300006871 Bacteria 6274
132 Ga0075434_100036339 3300006871 Bacteria 4873
133 Ga0075434_100043985 3300006871 Bacteria 4430
134 Ga0075434_100104161 3300006871 Archaea 2847
135 Ga0075429_100049030 3300006880 Bacteria 3672
136 Ga0068865_100002170 3300006881 Bacteria 11558
137 Ga0068865_100002655 3300006881 Bacteria 10623
138 Ga0068865_100020182 3300006881 Archaea 4321
139 Ga0075436_100012313 3300006914 Bacteria 5861
140 Ga0075436_100062095 3300006914 Bacteria 2582
141 Ga0097620_100001976 3300006931 Bacteria 20932
142 Ga0097620_100030675 3300006931 Bacteria 5395
143 Ga0097620_100045521 3300006931 Bacteria 4408
144 Ga0097620_100130573 3300006931 Bacteria 2583
145 Ga0097620_100305608 3300006931 Archaea 1684
146 Ga0075435_100029630 3300007076 Bacteria 4297
147 Ga0075435_100046064 3300007076 Bacteria 3497
148 Ga0075435_100051518 3300007076 Archaea 3316
149 Ga0075435_100136204 3300007076 Bacteria 2057
150 Ga0099794_10003478 3300007265 Bacteria 6019
151 Ga0099794_10056089 3300007265 Bacteria 1905
152 Ga0105240_10155664 3300009093 Bacteria 2719
153 Ga0111539_10003426 3300009094 Bacteria 20887
154 Ga0111539_10015359 3300009094 Bacteria 9534
155 Ga0111539_10030817 3300009094 Bacteria 6520
156 Ga0105245_10127631 3300009098 Bacteria 2383
157 Ga0105247_10022127 3300009101 Archaea 3827
158 Ga0114129_10005668 3300009147 Bacteria 17679
159 Ga0114129_10062784 3300009147 Bacteria 5188
160 Ga0114129_10261841 3300009147 Bacteria 2317
161 Ga0114129_10449026 3300009147 Archaea 1691
162 Ga0105243_10041470 3300009148 Bacteria 3600
163 Ga0105242_10002228 3300009176 Bacteria 15295
164 Ga0105242_10027087 3300009176 Bacteria 4548
165 Ga0105248_10000711 3300009177 Bacteria 37685
166 Ga0105248_10002735 3300009177 Bacteria 19592
167 Ga0105248_10029004 3300009177 Bacteria 6169
168 Ga0105248_10261453 3300009177 Archaea 1948
169 Ga0105248_10295075 3300009177 Bacteria 1825
170 Ga0105249_10001372 3300009553 Bacteria 21285
171 Ga0105249_10006412 3300009553 Bacteria 10233
172 Ga0105239_10014769 3300010375 Bacteria 8661
173 Ga0105246_10018682 3300011119 Bacteria 4419
174 Ga0157373_10141988 3300013100 Bacteria 1689
175 Ga0157374_10018160 3300013296 Bacteria 6204
176 Ga0157374_10196277 3300013296 Bacteria 1975
177 Ga0157374_10357770 3300013296 Bacteria 1451
178 Ga0157378_10000101 3300013297 Bacteria 80972
179 Ga0157378_10033222 3300013297 Bacteria 4559
180 Ga0157378_10038459 3300013297 Bacteria 4241
181 Ga0157378_10060067 3300013297 Unclassified 3393
182 Ga0157378_10069780 3300013297 Bacteria 3153
183 Ga0157378_10117826 3300013297 Archaea 2443
184 Ga0157378_10121270 3300013297 Unclassified 2410
185 Ga0157378_10214155 3300013297 Archaea 1828
186 Ga0163162_10033134 3300013306 Bacteria 5132
187 Ga0163162_10213826 3300013306 Bacteria 2058
188 Ga0157372_10024269 3300013307 Bacteria 6584
189 Ga0157375_10000370 3300013308 Bacteria 40795
190 Ga0157375_10001670 3300013308 Bacteria 19081
191 Ga0157375_10003726 3300013308 Archaea 13230
192 Ga0157380_10012156 3300014326 Bacteria 6235
193 Ga0157377_10015327 3300014745 Bacteria 3918
194 Ga0157377_10038966 3300014745 Archaea 2627
195 Ga0157379_10001478 3300014968 Bacteria 19371
196 Ga0157379_10003222 3300014968 Bacteria 13831
197 Ga0157376_10000040 3300014969 Bacteria 121140
198 Ga0157376_10002857 3300014969 Bacteria 11825
199 Ga0157376_10118042 3300014969 Bacteria 2347
200 Ga0163161_10158585 3300017792 Bacteria 1724
201 Ga0228598_1004784 3300024227 Bacteria 2860
202 Ga0207697_10001692 3300025315 Bacteria 11883
203 Ga0207697_10011611 3300025315 Unclassified 3719
204 Ga0207642_10001749 3300025899 Bacteria 6705
205 Ga0207710_10008715 3300025900 Archaea 4275
206 Ga0207688_10077878 3300025901 Bacteria 1889
207 Ga0207680_10004279 3300025903 Archaea 6765
208 Ga0207680_10122926 3300025903 Unclassified 1700
209 Ga0207647_10000620 3300025904 Bacteria 27662
210 Ga0207685_10047574 3300025905 Archaea 1638
211 Ga0207699_10001369 3300025906 Bacteria 11611
212 Ga0207699_10023396 3300025906 Bacteria 3362
213 Ga0207645_10004201 3300025907 Bacteria 10698
214 Ga0207643_10011691 3300025908 Bacteria 4742
215 Ga0207643_10011902 3300025908 Bacteria 4696
216 Ga0207684_10007198 3300025910 Bacteria 10052
217 Ga0207684_10013239 3300025910 Archaea 7138
218 Ga0207654_10019795 3300025911 Archaea 3558
219 Ga0207693_10103004 3300025915 Unclassified 2238
220 Ga0207693_10103199 3300025915 Unclassified 2236
221 Ga0207693_10153888 3300025915 Unclassified 1809
222 Ga0207663_10037892 3300025916 Bacteria 2910
223 Ga0207663_10093133 3300025916 Bacteria 2005
224 Ga0207657_10033562 3300025919 Bacteria 4625
225 Ga0207646_10088515 3300025922 Bacteria 2771
226 Ga0207681_10024097 3300025923 Bacteria 3901
227 Ga0207681_10073432 3300025923 Bacteria 2392
228 Ga0207659_10005651 3300025926 Bacteria 7606
229 Ga0207700_10018756 3300025928 Bacteria 4658
230 Ga0207700_10092747 3300025928 Bacteria 2388
231 Ga0207700_10100522 3300025928 Bacteria 2305
232 Ga0207706_10000022 3300025933 Bacteria 154806
233 Ga0207706_10025537 3300025933 Archaea 5292
234 Ga0207706_10181029 3300025933 Bacteria 1851
235 Ga0207686_10000087 3300025934 Bacteria 76920
236 Ga0207670_10000514 3300025936 Bacteria 21331
237 Ga0207670_10013093 3300025936 Bacteria 4880
238 Ga0207669_10001350 3300025937 Bacteria 10442
239 Ga0207669_10032632 3300025937 Bacteria 2927
240 Ga0207704_10004623 3300025938 Bacteria 6309
241 Ga0207704_10013308 3300025938 Archaea 4114
242 Ga0207665_10001886 3300025939 Bacteria 14134
243 Ga0207665_10008899 3300025939 Bacteria 6593
244 Ga0207665_10024046 3300025939 Bacteria 4015
245 Ga0207665_10069589 3300025939 Archaea 2400
246 Ga0207665_10142992 3300025939 Unclassified 1708
247 Ga0207691_10048757 3300025940 Bacteria 3881
248 Ga0207691_10142764 3300025940 Archaea 2109
249 Ga0207711_10001090 3300025941 Bacteria 25890
250 Ga0207711_10001867 3300025941 Bacteria 19200
251 Ga0207689_10009220 3300025942 Bacteria 8535
252 Ga0207689_10009897 3300025942 Bacteria 8221
253 Ga0207689_10099326 3300025942 Archaea 2391
254 Ga0207689_10107242 3300025942 Archaea 2296
255 Ga0207661_10212222 3300025944 Archaea 1707
256 Ga0207679_10099753 3300025945 Archaea 2268
257 Ga0207651_10012742 3300025960 Bacteria 4775
258 Ga0207651_10127864 3300025960 Archaea 1939
259 Ga0207712_10004743 3300025961 Bacteria 8597
260 Ga0207712_10008821 3300025961 Bacteria 6375
261 Ga0207712_10015535 3300025961 Bacteria 4915
262 Ga0207712_10038211 3300025961 Bacteria 3281
263 Ga0207640_10001069 3300025981 Bacteria 15183
264 Ga0207658_10007545 3300025986 Bacteria 7409
265 Ga0207658_10035395 3300025986 Bacteria 3576
266 Ga0207677_10140198 3300026023 Archaea 1850
267 Ga0207703_10002412 3300026035 Bacteria 16241
268 Ga0207703_10008004 3300026035 Archaea 8353
269 Ga0207703_10010061 3300026035 Bacteria 7415
270 Ga0207678_10007512 3300026067 Bacteria 9636
271 Ga0207678_10037685 3300026067 Archaea 4205
272 Ga0207708_10001549 3300026075 Bacteria 17159
273 Ga0207708_10012123 3300026075 Bacteria 6427
274 Ga0207708_10049598 3300026075 Bacteria 3197
275 Ga0207708_10052298 3300026075 Bacteria 3111
276 Ga0207708_10119447 3300026075 Bacteria 2053
277 Ga0207708_10130569 3300026075 Bacteria 1964
278 Ga0207702_10007674 3300026078 Bacteria 9172
279 Ga0207641_10005716 3300026088 Bacteria 10569
280 Ga0207641_10076228 3300026088 Unclassified 2898
281 Ga0207641_10105654 3300026088 Archaea 2487
282 Ga0207641_10207351 3300026088 Unclassified 1811
283 Ga0207648_10000016 3300026089 Bacteria 149027
284 Ga0207648_10002758 3300026089 Bacteria 18666
285 Ga0207648_10053600 3300026089 Archaea 3525
286 Ga0207676_10016036 3300026095 Bacteria 5421
287 Ga0207676_10032538 3300026095 Bacteria 3931
288 Ga0207674_10022180 3300026116 Bacteria 6825
289 Ga0207674_10123923 3300026116 Bacteria 2550
290 Ga0207675_100006503 3300026118 Bacteria 11057
291 Ga0207675_100025897 3300026118 Bacteria 5457
292 Ga0207675_100129863 3300026118 Bacteria 2389
293 Ga0207683_10004170 3300026121 Bacteria 12510
294 Ga0207683_10044588 3300026121 Archaea 3877
295 Ga0207683_10078734 3300026121 Bacteria 2921
296 Ga0209588_1000590 3300027671 Bacteria 9234
297 Ga0209588_1000620 3300027671 Archaea 8982
298 Ga0207428_10096104 3300027907 Archaea 2294
299 Ga0207428_10151664 3300027907 Unclassified 1764
300 Ga0265354_1000108 3300028016 Bacteria 14355
301 Ga0268266_10000645 3300028379 Bacteria 47339
302 Ga0268266_10056819 3300028379 Archaea 3366
303 Ga0268266_10124842 3300028379 Archaea 2295
304 Ga0268265_10089713 3300028380 Bacteria 2453
305 Ga0268265_10148164 3300028380 Bacteria 1975
306 Ga0268264_10009431 3300028381 Archaea 8084
307 Ga0268264_10016458 3300028381 Bacteria 6055
308 Ga0268264_10075663 3300028381 Bacteria 2863
309 Ga0268264_10083426 3300028381 Bacteria 2738
310 Ga0268264_10272008 3300028381 Unclassified 1583
311 Ga0307515_10021586 3300028794 Bacteria 11404
312 Ga0265338_10146174 3300028800 Unclassified 1844
313 Ga0265325_10089389 3300031241 Unclassified 1521
314 Ga0265331_10005277 3300031250 Bacteria 7822
315 Ga0265316_10002167 3300031344 Bacteria 20639
316 Ga0307408_100044676 3300031548 Archaea 3159
317 Ga0307405_10136109 3300031731 Archaea 1706
318 Ga0373934_0001085 3300035086 Bacteria 9855
319 Ga0373945_0017023 3300035116 Bacteria 2460
320 Ga0373954_0000171 3300035118 Bacteria 23300
321 Ga0373956_0063157 3300035119 Bacteria 1679
322 Ga0373933_0005749 3300035724 Bacteria 6744
323 Ga0373937_0000386 3300036401 Bacteria 41051
324 Ga0373937_0116503 3300036401 Archaea 2488
325 Ga0373937_0122023 3300036401 Archaea 2429
326 Ga0439441_001482 3300042001 Archaea 3083
327 Ga0439455_0008710 3300042012 Bacteria 2181
328 Ga0439435_0000141 3300042436 Bacteria 9708
329 Ga0451577_0026114 3300042876 Bacteria 5291
330 Ga0453683_0010070 3300044673 Archaea 6283
331 Ga0453683_0016138 3300044673 Bacteria 4826
332 Ga0453683_0160176 3300044673 Archaea 1424
333 Ga0453684_0110617 3300044712 Bacteria 3339
334 Ga0451576_0006518 3300045051 Bacteria 14284
335 Ga0451576_0010446 3300045051 Bacteria 10646
336 Ga0451576_0034221 3300045051 Bacteria 5397
337 Ga0451576_0105088 3300045051 Bacteria 2937
338 Ga0495603_0061534 3300046455 Bacteria 2217
339 Ga0495629_0060742 3300046459 Bacteria 2641
340 Ga0495653_0132226 3300046463 Bacteria 1765
341 Ga0495580_0000493 3300046472 Bacteria 33013
342 Ga0495580_0005301 3300046472 Bacteria 10698
343 Ga0495580_0075579 3300046472 Archaea 2350
344 Ga0495582_0008454 3300046473 Bacteria 5680
345 Ga0495582_0018991 3300046473 Bacteria 3761
346 Ga0495639_0004254 3300046475 Bacteria 6142
347 Ga0495664_0041979 3300046477 Bacteria 2708
348 Ga0495664_0050702 3300046477 Bacteria 2465
349 Ga0495630_0038562 3300046517 Bacteria 3574
350 Ga0495666_0006499 3300046526 Bacteria 5887
351 Ga0495640_0035439 3300046533 Archaea 3532
352 Ga0495645_0105507 3300046543 Bacteria 1999
353 Ga0495622_0034050 3300046557 Archaea 2377
354 Ga0495667_0101123 3300046559 Bacteria 1865
355 Ga0495634_0027028 3300046642 Bacteria 3997
356 Ga0495634_0108996 3300046642 Unclassified 1782
357 Ga0495623_0026192 3300046679 Unclassified 3755
358 Ga0495669_0005142 3300046684 Bacteria 5441
359 Ga0495669_0050119 3300046684 Bacteria 1872
360 Ga0495613_0069061 3300046689 Bacteria 2577
361 Ga0495613_0113858 3300046689 Bacteria 1947
362 Ga0495604_0003085 3300047317 Bacteria 13325
363 Ga0495636_0039276 3300047318 Bacteria 1960
364 Ga0495674_0131212 3300047319 Bacteria 2111
365 Ga0495672_0001847 3300047320 Bacteria 20192
366 Ga0495680_0129436 3300047322 Bacteria 1856
367 Ga0495602_0062909 3300048088 Unclassified 3218
368 Ga0496100_0085011 3300048903 Bacteria 2146
369 Ga0496100_0199324 3300048903 Unclassified 1458
370 Ga0496102_0001943 3300048905 Bacteria 17814
371 Ga0496102_0042671 3300048905 Bacteria 4111
372 Ga0496102_0196505 3300048905 Bacteria 1901
373 Ga0496103_0004019 3300048906 Bacteria 8934
374 Ga0496104_0049159 3300048907 Bacteria 3977
375 Ga0496104_0089375 3300048907 Bacteria 2943
376 Ga0496106_0002650 3300048909 Bacteria 13319
377 Ga0496107_0006987 3300048910 Archaea 7775
378 Ga0496110_0009246 3300048913 Bacteria 7964
379 Ga0496113_0017298 3300048916 Archaea 5001
380 Ga0496114_0024827 3300048917 Bacteria 4893
381 Ga0496114_0049801 3300048917 Bacteria 3486
382 Ga0496115_0076901 3300048918 Bacteria 2713
383 Ga0501036_0025071 3300049572 Bacteria 5029
384 Ga0501038_0147510 3300049574 Archaea 1920
385 Ga0501039_0044620 3300049575 Archaea 3425
386 Ga0501039_0248356 3300049575 Archaea 1399
387 Ga0501040_0009746 3300049576 Archaea 6271
388 Ga0501040_0011247 3300049576 Bacteria 5858
389 Ga0501040_0051559 3300049576 Bacteria 2815
390 Ga0501041_0129507 3300049577 Archaea 1572
391 Ga0501042_0105983 3300049578 Archaea 2023
392 Ga0501042_0158433 3300049578 Bacteria 1633
393 Ga0501043_0066396 3300049579 Archaea 2833
394 Ga0501048_0023464 3300049582 Archaea 4507
395 Ga0501048_0052787 3300049582 Archaea 2893
396 Ga0501071_0008487 3300049587 Bacteria 6795
397 Ga0501071_0012502 3300049587 Bacteria 5759
398 Ga0501072_0016458 3300049588 Archaea 5678
399 Ga0501074_0035230 3300049590 Bacteria 3626
400 Ga0501075_0001550 3300049591 Bacteria 14990
401 Ga0501075_0061572 3300049591 Archaea 2828
402 Ga0501075_0102926 3300049591 Archaea 2169
403 Ga0501075_0206205 3300049591 Archaea 1499
404 Ga0501076_0000815 3300049592 Bacteria 20212
405 Ga0501076_0014446 3300049592 Archaea 5948
406 Ga0501076_0070253 3300049592 Archaea 2799
407 Ga0501080_0147611 3300049742 Archaea 2174
408 Ga0501081_0029170 3300049743 Bacteria 3727
409 Ga0501035_0057339 3300049822 Archaea 3473
410 Ga0501045_0042420 3300049824 Archaea 3311
411 Ga0501045_0252945 3300049824 Archaea 1311
412 nmdc:mga05p37_11434_c1 3300050507 Bacteria 10568
413 nmdc:mga05p37_11508_c1 3300050507 Bacteria 10538
414 nmdc:mga05p37_137453_c2 3300050507 Bacteria 2180
415 nmdc:mga05p37_14782_c1 3300050507 Bacteria 9375
416 nmdc:mga05p37_177096_c1 3300050507 Unclassified 2597
417 nmdc:mga05p37_190393_c1 3300050507 Unclassified 2491
418 nmdc:mga09592_17284_c1 3300050508 Bacteria 5908
419 nmdc:mga0qj67_132882_c1 3300050509 Bacteria 2016
420 nmdc:mga0qj67_7948_c1 3300050509 Bacteria 7838
421 nmdc:mga06r32_12117_c1 3300050510 Bacteria 7777
422 nmdc:mga08y16_135642_c1 3300050511 Bacteria 2558
423 nmdc:mga08y16_162255_c1 3300050511 Archaea 2322
424 nmdc:mga08y16_20222_c1 3300050511 Bacteria 7028
425 nmdc:mga08y16_242693_c1 3300050511 Bacteria 1862
426 nmdc:mga08y16_87170_c1 3300050511 Bacteria 3253
427 nmdc:mga0n895_1851_c1 3300050512 Bacteria 16145
428 nmdc:mga0n895_26915_c1 3300050512 Bacteria 5456
429 nmdc:mga0n895_34680_c1 3300050512 Bacteria 4859
430 nmdc:mga0n895_41334_c1 3300050512 Archaea 4481
431 nmdc:mga0n895_4770_c1 3300050512 Bacteria 11210
432 nmdc:mga0n895_727_c1 3300050512 Bacteria 23166
433 nmdc:mga0n895_76142_c1 3300050512 Unclassified 3337
434 nmdc:mga0rr50_43793_c1 3300050513 Bacteria 3278
435 nmdc:mga0rr50_5604_c1 3300050513 Bacteria 7513
436 nmdc:mga0a205_137825_c1 3300050515 Archaea 1663
437 nmdc:mga0a205_15945_c1 3300050515 Bacteria 7030
438 nmdc:mga0a205_166191_c1 3300050515 Bacteria 2102
439 nmdc:mga0a205_5516_c1 3300050515 Bacteria 11395
440 nmdc:mga0a205_7000_c1 3300050515 Bacteria 10190
441 Ga0495601_0026689 3300053077 Bacteria 3568
442 Ga0495595_0094057 3300053084 Bacteria 1441
443 Ga0495619_0026632 3300053085 Archaea 3721
444 Ga0495619_0086003 3300053085 Bacteria 2125
445 Ga0500622_0045948 3300053156 Unclassified 2259
446 Ga0501084_0075792 3300054114 Bacteria 2818
447 Ga0501082_0012501 3300060353 Bacteria 7292
448 Ga0501082_0035554 3300060353 Archaea 4294
449 Ga0501082_0224430 3300060353 Bacteria 1635
450 Ga0530510_0108606 3300061734 Bacteria 2031
451 Ga0207693_10097327
452 Ga0065715_10126265
453 Ga0065715_10159311
454 Ga0070670_100001851
455 Ga0068869_100036462
456 Ga0068869_100212486
457 Ga0070666_10005702
458 Ga0070680_100123231
459 Ga0070660_100155895
460 Ga0070689_100001173
461 Ga0070689_100062167
462 Ga0070691_10081365
463 Ga0070661_100127245
464 Ga0070668_100125022
465 Ga0070669_100017671
466 Ga0070669_100039288
467 Ga0070669_100057614
468 Ga0070675_100002575
469 Ga0070675_100005245
470 Ga0070675_100015063
471 Ga0070675_100031446
472 Ga0070674_100009285
473 Ga0070673_100017113
474 Ga0070673_100059790
475 Ga0070688_100001023
476 Ga0070688_100004834
477 Ga0070659_100001236
478 Ga0070667_100010878
479 Ga0070709_10012564
480 Ga0070713_100001716
481 Ga0070710_10041932
482 Ga0070701_10070305
483 Ga0070711_100015368
484 Ga0070705_100011953
485 Ga0070705_100012578
486 Ga0070705_100100411
487 Ga0070700_100002974
488 Ga0070694_100072160
489 Ga0070694_100197027
490 Ga0070708_100008796
491 Ga0070708_100051109
492 Ga0070663_100008302
493 Ga0070663_100023410
494 Ga0070678_100027426
495 Ga0070662_100000778
496 Ga0070662_100011020
497 Ga0070662_100074189
498 Ga0068867_100000933
499 Ga0068867_100001868
500 Ga0068867_100044296
501 Ga0070685_10026671
502 Ga0070706_100002841
503 Ga0070706_100016081
504 Ga0070707_100060724
505 Ga0070707_100074863
506 Ga0070698_100000678
507 Ga0070698_100002065
508 Ga0070698_100005790
509 Ga0070698_100066615
510 Ga0070698_100266322
511 Ga0070699_100000081
512 Ga0070699_100070733
513 Ga0070684_100000426
514 Ga0070697_100005328
515 Ga0070697_100008376
516 Ga0070697_100015770
517 Ga0070697_100046802
518 Ga0070672_100060361
519 Ga0070686_100020620
520 Ga0070695_100004439
521 Ga0070696_100019021
522 Ga0070693_100013937
523 Ga0070665_100000462
524 Ga0070665_100034172
525 Ga0070704_100006259
526 Ga0070704_100093268
527 Ga0070704_100123469
528 Ga0068855_100135324
529 Ga0068857_100068420
530 Ga0068854_100001425
531 Ga0068856_100003238
532 Ga0070702_100009852
533 Ga0068859_100001976
534 Ga0068859_100030676
535 Ga0068859_100045521
536 Ga0068859_100130580
537 Ga0068859_100305607
538 Ga0068864_100019858
539 Ga0068864_100021899
540 Ga0068866_10003463
541 Ga0068861_100006210
542 Ga0068861_100111235
543 Ga0068870_10016322
544 Ga0068863_100013204
545 Ga0068863_100060070
546 Ga0068863_100107276
547 Ga0068858_100006052
548 Ga0068858_100007846
549 Ga0068858_100038245
550 Ga0068860_100002646
551 Ga0068860_100029139
552 Ga0068860_100169503
553 Ga0068862_100070858
554 Ga0081455_10011986
555 Ga0081455_10026068
556 Ga0081455_10088752
557 Ga0081540_1000215
558 Ga0070716_100024804
559 Ga0070716_100099694
560 Ga0070716_100189300
561 Ga0070712_100016031
562 Ga0070712_100100148
563 Ga0097621_100034524
564 Ga0097621_100037368
565 Ga0097621_100039460
566 Ga0097621_100064611
567 Ga0068871_100046577
568 Ga0068871_100050836
569 Ga0068871_100228959
570 Ga0075428_100025296
571 Ga0075428_100121948
572 Ga0075430_100061189
573 Ga0075431_100002183
574 Ga0075431_100200185
575 Ga0075433_10002902
576 Ga0075433_10003339
577 Ga0075433_10017281
578 Ga0075433_10018677
579 Ga0075434_100001756
580 Ga0075434_100002026
581 Ga0075434_100021473
582 Ga0075434_100036339
583 Ga0075434_100043985
584 Ga0075434_100104161
585 Ga0075429_100049030
586 Ga0068865_100002170
587 Ga0068865_100002655
588 Ga0068865_100020182
589 Ga0075436_100012313
590 Ga0075436_100062095
591 Ga0097620_100001976
592 Ga0097620_100030675
593 Ga0097620_100045521
594 Ga0097620_100130573
595 Ga0097620_100305608
596 Ga0075435_100029630
597 Ga0075435_100046064
598 Ga0075435_100051518
599 Ga0075435_100136204
600 Ga0099794_10003478
601 Ga0099794_10056089
602 Ga0105240_10155664
603 Ga0111539_10003426
604 Ga0111539_10015359
605 Ga0111539_10030817
606 Ga0105245_10127631
607 Ga0105247_10022127
608 Ga0114129_10005668
609 Ga0114129_10062784
610 Ga0114129_10261841
611 Ga0114129_10449026
612 Ga0105243_10041470
613 Ga0105242_10002228
614 Ga0105242_10027087
615 Ga0105248_10000711
616 Ga0105248_10002735
617 Ga0105248_10029004
618 Ga0105248_10261453
619 Ga0105248_10295075
620 Ga0105249_10001372
621 Ga0105249_10006412
622 Ga0105239_10014769
623 Ga0105246_10018682
624 Ga0157373_10141988
625 Ga0157374_10018160
626 Ga0157374_10196277
627 Ga0157374_10357770
628 Ga0157378_10000101
629 Ga0157378_10033222
630 Ga0157378_10038459
631 Ga0157378_10060067
632 Ga0157378_10069780
633 Ga0157378_10117826
634 Ga0157378_10121270
635 Ga0157378_10214155
636 Ga0163162_10033134
637 Ga0163162_10213826
638 Ga0157372_10024269
639 Ga0157375_10000370
640 Ga0157375_10001670
641 Ga0157375_10003726
642 Ga0157380_10012156
643 Ga0157377_10015327
644 Ga0157377_10038966
645 Ga0157379_10001478
646 Ga0157379_10003222
647 Ga0157376_10000040
648 Ga0157376_10002857
649 Ga0157376_10118042
650 Ga0163161_10158585
651 Ga0228598_1004784
652 Ga0207697_10001692
653 Ga0207697_10011611
654 Ga0207642_10001749
655 Ga0207710_10008715
656 Ga0207688_10077878
657 Ga0207680_10004279
658 Ga0207680_10122926
659 Ga0207647_10000620
660 Ga0207685_10047574
661 Ga0207699_10001369
662 Ga0207699_10023396
663 Ga0207645_10004201
664 Ga0207643_10011691
665 Ga0207643_10011902
666 Ga0207684_10007198
667 Ga0207684_10013239
668 Ga0207654_10019795
669 Ga0207693_10103004
670 Ga0207693_10103199
671 Ga0207693_10153888
672 Ga0207663_10037892
673 Ga0207663_10093133
674 Ga0207657_10033562
675 Ga0207646_10088515
676 Ga0207681_10024097
677 Ga0207681_10073432
678 Ga0207659_10005651
679 Ga0207700_10018756
680 Ga0207700_10092747
681 Ga0207700_10100522
682 Ga0207706_10000022
683 Ga0207706_10025537
684 Ga0207706_10181029
685 Ga0207686_10000087
686 Ga0207670_10000514
687 Ga0207670_10013093
688 Ga0207669_10001350
689 Ga0207669_10032632
690 Ga0207704_10004623
691 Ga0207704_10013308
692 Ga0207665_10001886
693 Ga0207665_10008899
694 Ga0207665_10024046
695 Ga0207665_10069589
696 Ga0207665_10142992
697 Ga0207691_10048757
698 Ga0207691_10142764
699 Ga0207711_10001090
700 Ga0207711_10001867
701 Ga0207689_10009220
702 Ga0207689_10009897
703 Ga0207689_10099326
704 Ga0207689_10107242
705 Ga0207661_10212222
706 Ga0207679_10099753
707 Ga0207651_10012742
708 Ga0207651_10127864
709 Ga0207712_10004743
710 Ga0207712_10008821
711 Ga0207712_10015535
712 Ga0207712_10038211
713 Ga0207640_10001069
714 Ga0207658_10007545
715 Ga0207658_10035395
716 Ga0207677_10140198
717 Ga0207703_10002412
718 Ga0207703_10008004
719 Ga0207703_10010061
720 Ga0207678_10007512
721 Ga0207678_10037685
722 Ga0207708_10001549
723 Ga0207708_10012123
724 Ga0207708_10049598
725 Ga0207708_10052298
726 Ga0207708_10119447
727 Ga0207708_10130569
728 Ga0207702_10007674
729 Ga0207641_10005716
730 Ga0207641_10076228
731 Ga0207641_10105654
732 Ga0207641_10207351
733 Ga0207648_10000016
734 Ga0207648_10002758
735 Ga0207648_10053600
736 Ga0207676_10016036
737 Ga0207676_10032538
738 Ga0207674_10022180
739 Ga0207674_10123923
740 Ga0207675_100006503
741 Ga0207675_100025897
742 Ga0207675_100129863
743 Ga0207683_10004170
744 Ga0207683_10044588
745 Ga0207683_10078734
746 Ga0209588_1000590
747 Ga0209588_1000620
748 Ga0207428_10096104
749 Ga0207428_10151664
750 Ga0265354_1000108
751 Ga0268266_10000645
752 Ga0268266_10056819
753 Ga0268266_10124842
754 Ga0268265_10089713
755 Ga0268265_10148164
756 Ga0268264_10009431
757 Ga0268264_10016458
758 Ga0268264_10075663
759 Ga0268264_10083426
760 Ga0268264_10272008
761 Ga0307515_10021586
762 Ga0265338_10146174
763 Ga0265325_10089389
764 Ga0265331_10005277
765 Ga0265316_10002167
766 Ga0307408_100044676
767 Ga0307405_10136109
768 Ga0373934_0001085
769 Ga0373945_0017023
770 Ga0373954_0000171
771 Ga0373956_0063157
772 Ga0373933_0005749
773 Ga0373937_0000386
774 Ga0373937_0116503
775 Ga0373937_0122023
776 Ga0439441_001482
777 Ga0439455_0008710
778 Ga0439435_0000141
779 Ga0451577_0026114
780 Ga0453683_0010070
781 Ga0453683_0016138
782 Ga0453683_0160176
783 Ga0453684_0110617
784 Ga0451576_0006518
785 Ga0451576_0010446
786 Ga0451576_0034221
787 Ga0451576_0105088
788 Ga0495603_0061534
789 Ga0495629_0060742
790 Ga0495653_0132226
791 Ga0495580_0000493
792 Ga0495580_0005301
793 Ga0495580_0075579
794 Ga0495582_0008454
795 Ga0495582_0018991
796 Ga0495639_0004254
797 Ga0495664_0041979
798 Ga0495664_0050702
799 Ga0495630_0038562
800 Ga0495666_0006499
801 Ga0495640_0035439
802 Ga0495645_0105507
803 Ga0495622_0034050
804 Ga0495667_0101123
805 Ga0495634_0027028
806 Ga0495634_0108996
807 Ga0495623_0026192
808 Ga0495669_0005142
809 Ga0495669_0050119
810 Ga0495613_0069061
811 Ga0495613_0113858
812 Ga0495604_0003085
813 Ga0495636_0039276
814 Ga0495674_0131212
815 Ga0495672_0001847
816 Ga0495680_0129436
817 Ga0495602_0062909
818 Ga0496100_0085011
819 Ga0496100_0199324
820 Ga0496102_0001943
821 Ga0496102_0042671
822 Ga0496102_0196505
823 Ga0496103_0004019
824 Ga0496104_0049159
825 Ga0496104_0089375
826 Ga0496106_0002650
827 Ga0496107_0006987
828 Ga0496110_0009246
829 Ga0496113_0017298
830 Ga0496114_0024827
831 Ga0496114_0049801
832 Ga0496115_0076901
833 Ga0501036_0025071
834 Ga0501038_0147510
835 Ga0501039_0044620
836 Ga0501039_0248356
837 Ga0501040_0009746
838 Ga0501040_0011247
839 Ga0501040_0051559
840 Ga0501041_0129507
841 Ga0501042_0105983
842 Ga0501042_0158433
843 Ga0501043_0066396
844 Ga0501048_0023464
845 Ga0501048_0052787
846 Ga0501071_0008487
847 Ga0501071_0012502
848 Ga0501072_0016458
849 Ga0501074_0035230
850 Ga0501075_0001550
851 Ga0501075_0061572
852 Ga0501075_0102926
853 Ga0501075_0206205
854 Ga0501076_0000815
855 Ga0501076_0014446
856 Ga0501076_0070253
857 Ga0501080_0147611
858 Ga0501081_0029170
859 Ga0501035_0057339
860 Ga0501045_0042420
861 Ga0501045_0252945
862 nmdc:mga05p37_11434_c1
863 nmdc:mga05p37_11508_c1
864 nmdc:mga05p37_137453_c2
865 nmdc:mga05p37_14782_c1
866 nmdc:mga05p37_177096_c1
867 nmdc:mga05p37_190393_c1
868 nmdc:mga09592_17284_c1
869 nmdc:mga0qj67_132882_c1
870 nmdc:mga0qj67_7948_c1
871 nmdc:mga06r32_12117_c1
872 nmdc:mga08y16_135642_c1
873 nmdc:mga08y16_162255_c1
874 nmdc:mga08y16_20222_c1
875 nmdc:mga08y16_242693_c1
876 nmdc:mga08y16_87170_c1
877 nmdc:mga0n895_1851_c1
878 nmdc:mga0n895_26915_c1
879 nmdc:mga0n895_34680_c1
880 nmdc:mga0n895_41334_c1
881 nmdc:mga0n895_4770_c1
882 nmdc:mga0n895_727_c1
883 nmdc:mga0n895_76142_c1
884 nmdc:mga0rr50_43793_c1
885 nmdc:mga0rr50_5604_c1
886 nmdc:mga0a205_137825_c1
887 nmdc:mga0a205_15945_c1
888 nmdc:mga0a205_166191_c1
889 nmdc:mga0a205_5516_c1
890 nmdc:mga0a205_7000_c1
891 Ga0495601_0026689
892 Ga0495595_0094057
893 Ga0495619_0026632
894 Ga0495619_0086003
895 Ga0500622_0045948
896 Ga0501084_0075792
897 Ga0501082_0012501
898 Ga0501082_0035554
899 Ga0501082_0224430
900 Ga0530510_0108606

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01071

GARS_A

Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain

111

299

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j36-assembly2.cif.gz_B cocrystal structure of kynurenine 3-monooxygenase in complex with upf 648 inhibitor(kmo-394upf) 0.8483 5 34
1f8s-assembly1.cif.gz_B crystal structure of l-amino acid oxidase from calloselasma rhodostoma, complexed with three molecules of o-aminobenzoate. 0.8435 3 38
4gut-assembly1.cif.gz_A crystal structure of lsd2-npac 0.8305 6 38
3all-assembly1.cif.gz_A crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase, mutant y270a 0.7996 4 40
4h2p-assembly1.cif.gz_A tetrameric form of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase (mhpco) 0.7963 3 38
ID Description Score Start End Superfamily
af_P9WHM9_327_413_3.90.600.10 Alpha Beta;Alpha-Beta Complex;Glycinamide Ribonucleotide Synthetase; Chain A, domain 4;Phosphoribosylglycinamide synthetase, C-terminal domain 0.8948 319 413 3.90.600.10
af_Q2FZI5_324_415_3.90.600.10 Alpha Beta;Alpha-Beta Complex;Glycinamide Ribonucleotide Synthetase; Chain A, domain 4;Phosphoribosylglycinamide synthetase, C-terminal domain 0.8803 321 418 3.90.600.10
5vevB04 Alpha Beta;Alpha-Beta Complex;Glycinamide Ribonucleotide Synthetase; Chain A, domain 4;Phosphoribosylglycinamide synthetase, C-terminal domain 0.8769 319 416 3.90.600.10
af_P9WHM9_327_413_3.90.600.10 Alpha Beta;Alpha-Beta Complex;Glycinamide Ribonucleotide Synthetase; Chain A, domain 4;Phosphoribosylglycinamide synthetase, C-terminal domain 0.8672 319 413 3.90.600.10
af_A0A1D6PS54_2_340_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8515 6 37 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A349H7T1-F1-model_v4 Phosphoribosylamine--glycine ligase 0.9852 4 88 GO:0016874
AF-A0A842PYY4-F1-model_v4 deleted 0.9703 7 387
AF-A0A7T5UUB9-F1-model_v4 Glycinamide ribonucleotide synthetase (Phosphoribosylglycinamide synthetase) 0.9692 7 429 GO:0000166
GO:0004637
GO:0006164
GO:0009113
AF-A0A6B0SVA9-F1-model_v4 phosphoribosylamine--glycine ligase (EC 6.3.4.13) (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase) 0.9673 5 431 GO:0004637
GO:0005524
GO:0006189
GO:0009113
GO:0046872
AF-A0A2G1X0K4-F1-model_v4 Phosphoribosylamine--glycine ligase 0.9673 4 380 GO:0004637
GO:0005524
GO:0009113
GO:0046872

Map