F446558
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 450 | 265 | 442 | 249 |
Family's Representative Sequence
| Representative Sequence | 3300006028|Ga0070717_10031143|Ga0070717_100311432 |
| Length | 282 |
| Sequence | MAGLVPAIHVLLTREQDVDARHKAGHDAERARMNKELTGKVAIVTGAGRNIGRAIALTLAEAGASILINARSNRTEAEAVAREIEAIGGRALVHIGDVADPKAVQVMADAAALGFSRIDILINNAALRREKPFAEMDYAEWREILDVTLDGAFHCTKACFPALRKSGSGTIVNIGGLSAHTGAKNRAHVVTAKAGIVGFTRALAHDLADDGITVNCVVPGLIGTPRPKDKPQPAHHLTHQTITGERGKPEDVAAAVRFLCSPGARYITGQAIHANGGAYLGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 2 | 2791355199 | |||
| 3 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 4 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 5 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 6 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 47 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 48 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 49 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 51 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 56 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 84 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 130 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 131 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 132 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 133 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 135 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 136 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 137 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 138 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 139 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 140 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 141 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 142 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 143 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 144 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 145 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 146 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 147 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 148 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 149 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 150 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 151 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 152 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 153 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 154 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 155 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 156 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 158 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 159 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 160 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 161 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 162 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 164 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 166 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 167 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 168 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 169 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 170 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 171 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 172 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 173 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 174 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 175 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 225 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 226 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 227 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 228 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 229 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 232 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 233 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 234 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 235 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 236 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 237 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 238 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 239 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 240 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 241 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 242 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 243 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 246 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 247 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 248 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 253 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 256 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 257 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 258 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 259 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 260 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 261 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 262 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 263 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 264 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 265 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.77 |
| Metatranscriptomes | 0.67 |
| Isolates | 1.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.56 |
| Nodule | 1.11 |
| Rhizoplane | 8.67 |
| Rhizosphere | 76.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100017704 | 3300005329 | Bacteria | 6296 |
| 2 | Ga0070683_100072240 | 3300005329 | Bacteria | 3220 |
| 3 | Ga0070683_100227728 | 3300005329 | Bacteria | 1772 |
| 4 | Ga0068869_100013710 | 3300005334 | Bacteria | 5400 |
| 5 | Ga0070680_100018051 | 3300005336 | Bacteria | 5572 |
| 6 | Ga0070680_100074865 | 3300005336 | Bacteria | 2787 |
| 7 | Ga0070680_100434561 | 3300005336 | Bacteria | 1120 |
| 8 | Ga0070682_100028536 | 3300005337 | Bacteria | 3357 |
| 9 | Ga0068868_100656413 | 3300005338 | Bacteria | 934 |
| 10 | Ga0070689_100060435 | 3300005340 | Bacteria | 2946 |
| 11 | Ga0070661_100210927 | 3300005344 | Bacteria | 1487 |
| 12 | Ga0070671_100050017 | 3300005355 | Bacteria | 3477 |
| 13 | Ga0070667_100642319 | 3300005367 | Bacteria | 979 |
| 14 | Ga0070709_10000656 | 3300005434 | Bacteria | 19693 |
| 15 | Ga0070709_10026466 | 3300005434 | Bacteria | 3438 |
| 16 | Ga0070709_10037540 | 3300005434 | Bacteria | 2959 |
| 17 | Ga0070713_100037254 | 3300005436 | Bacteria | 3932 |
| 18 | Ga0070713_100057938 | 3300005436 | Bacteria | 3228 |
| 19 | Ga0070713_100258406 | 3300005436 | Bacteria | 1591 |
| 20 | Ga0070713_100400361 | 3300005436 | Bacteria | 1282 |
| 21 | Ga0070711_100015425 | 3300005439 | Bacteria | 4836 |
| 22 | Ga0070711_100032536 | 3300005439 | Bacteria | 3467 |
| 23 | Ga0070711_100375956 | 3300005439 | Bacteria | 1148 |
| 24 | Ga0070700_100114163 | 3300005441 | Bacteria | 1800 |
| 25 | Ga0070663_100218055 | 3300005455 | Bacteria | 1497 |
| 26 | Ga0070663_100251993 | 3300005455 | Bacteria | 1397 |
| 27 | Ga0070678_100031273 | 3300005456 | Bacteria | 3669 |
| 28 | Ga0070681_10129509 | 3300005458 | Bacteria | 2455 |
| 29 | Ga0068867_100243368 | 3300005459 | Bacteria | 1460 |
| 30 | Ga0070706_100631380 | 3300005467 | Bacteria | 995 |
| 31 | Ga0070707_100135140 | 3300005468 | Bacteria | 2399 |
| 32 | Ga0070698_100019717 | 3300005471 | Bacteria | 7074 |
| 33 | Ga0070699_100186561 | 3300005518 | Bacteria | 1841 |
| 34 | Ga0070679_100367456 | 3300005530 | Bacteria | 1386 |
| 35 | Ga0070679_100374980 | 3300005530 | Bacteria | 1369 |
| 36 | Ga0070684_100006660 | 3300005535 | Bacteria | 8954 |
| 37 | Ga0070684_100018450 | 3300005535 | Bacteria | 5747 |
| 38 | Ga0070684_100964724 | 3300005535 | Bacteria | 800 |
| 39 | Ga0068853_100144845 | 3300005539 | Bacteria | 2134 |
| 40 | Ga0068853_100168772 | 3300005539 | Bacteria | 1979 |
| 41 | Ga0070693_100246305 | 3300005547 | Bacteria | 1183 |
| 42 | Ga0070693_100354794 | 3300005547 | Bacteria | 1005 |
| 43 | Ga0070665_100076424 | 3300005548 | Bacteria | 3355 |
| 44 | Ga0070665_100087646 | 3300005548 | Bacteria | 3118 |
| 45 | Ga0070665_100091094 | 3300005548 | Bacteria | 3055 |
| 46 | Ga0070665_100530945 | 3300005548 | Bacteria | 1188 |
| 47 | Ga0068855_100028344 | 3300005563 | Bacteria | 6698 |
| 48 | Ga0068855_100092318 | 3300005563 | Bacteria | 3491 |
| 49 | Ga0068855_100138673 | 3300005563 | Bacteria | 2774 |
| 50 | Ga0068855_100380113 | 3300005563 | Bacteria | 1551 |
| 51 | Ga0068855_100693903 | 3300005563 | Bacteria | 1090 |
| 52 | Ga0070664_100193695 | 3300005564 | Bacteria | 1812 |
| 53 | Ga0070664_100321966 | 3300005564 | Bacteria | 1401 |
| 54 | Ga0068857_100109416 | 3300005577 | Bacteria | 2483 |
| 55 | Ga0068854_100047834 | 3300005578 | Bacteria | 3049 |
| 56 | Ga0068854_100857443 | 3300005578 | Bacteria | 796 |
| 57 | Ga0068856_100000066 | 3300005614 | Bacteria | 98376 |
| 58 | Ga0068856_100233157 | 3300005614 | Bacteria | 1856 |
| 59 | Ga0068852_100150373 | 3300005616 | Bacteria | 2165 |
| 60 | Ga0068852_100189606 | 3300005616 | Bacteria | 1939 |
| 61 | Ga0068859_100240230 | 3300005617 | Bacteria | 1900 |
| 62 | Ga0068866_10222858 | 3300005718 | Bacteria | 1139 |
| 63 | Ga0068861_100182326 | 3300005719 | Bacteria | 1749 |
| 64 | Ga0068863_100208246 | 3300005841 | Bacteria | 1882 |
| 65 | Ga0068858_100047608 | 3300005842 | Bacteria | 3974 |
| 66 | Ga0068858_100194716 | 3300005842 | Bacteria | 1915 |
| 67 | Ga0068858_100240386 | 3300005842 | Bacteria | 1718 |
| 68 | Ga0068860_100001582 | 3300005843 | Bacteria | 24502 |
| 69 | Ga0068862_100758566 | 3300005844 | Bacteria | 945 |
| 70 | Ga0081455_10007625 | 3300005937 | Bacteria | 11370 |
| 71 | Ga0081455_10074849 | 3300005937 | Bacteria | 2795 |
| 72 | Ga0081455_10108320 | 3300005937 | Bacteria | 2213 |
| 73 | Ga0081540_1006482 | 3300005983 | Bacteria | 8514 |
| 74 | Ga0081539_10001290 | 3300005985 | Bacteria | 44006 |
| 75 | Ga0081539_10034725 | 3300005985 | Bacteria | 3043 |
| 76 | Ga0070717_10031143 | 3300006028 | Bacteria | 4290 |
| 77 | Ga0075368_10080683 | 3300006042 | Bacteria | 1323 |
| 78 | Ga0075363_100115326 | 3300006048 | Bacteria | 1495 |
| 79 | Ga0075364_10015406 | 3300006051 | Bacteria | 4741 |
| 80 | Ga0075364_10324667 | 3300006051 | Unclassified | 1048 |
| 81 | Ga0070716_100108620 | 3300006173 | Bacteria | 1715 |
| 82 | Ga0070712_100027903 | 3300006175 | Bacteria | 3772 |
| 83 | Ga0075367_10104181 | 3300006178 | Bacteria | 1737 |
| 84 | Ga0075367_10151934 | 3300006178 | Bacteria | 1437 |
| 85 | Ga0075367_10197783 | 3300006178 | Bacteria | 1255 |
| 86 | Ga0075366_10083882 | 3300006195 | Bacteria | 1905 |
| 87 | Ga0097621_100080504 | 3300006237 | Bacteria | 2710 |
| 88 | Ga0097621_100421784 | 3300006237 | Bacteria | 1198 |
| 89 | Ga0075434_100658225 | 3300006871 | Bacteria | 1065 |
| 90 | Ga0097620_100240241 | 3300006931 | Bacteria | 1900 |
| 91 | Ga0105250_10132738 | 3300009092 | Bacteria | 1028 |
| 92 | Ga0105240_10007301 | 3300009093 | Bacteria | 16084 |
| 93 | Ga0105240_10183631 | 3300009093 | Bacteria | 2466 |
| 94 | Ga0105240_10426543 | 3300009093 | Bacteria | 1489 |
| 95 | Ga0105245_10024948 | 3300009098 | Bacteria | 5254 |
| 96 | Ga0105245_10452357 | 3300009098 | Bacteria | 1293 |
| 97 | Ga0105247_10086181 | 3300009101 | Bacteria | 1987 |
| 98 | Ga0105241_10040412 | 3300009174 | Bacteria | 3521 |
| 99 | Ga0105241_10113536 | 3300009174 | Bacteria | 2172 |
| 100 | Ga0105248_10016328 | 3300009177 | Bacteria | 8171 |
| 101 | Ga0105248_10907446 | 3300009177 | Bacteria | 995 |
| 102 | Ga0105237_10185710 | 3300009545 | Bacteria | 2079 |
| 103 | Ga0105238_10068463 | 3300009551 | Bacteria | 3551 |
| 104 | Ga0105238_10507186 | 3300009551 | Bacteria | 1208 |
| 105 | Ga0105249_10736552 | 3300009553 | Bacteria | 1047 |
| 106 | Ga0099796_10067328 | 3300010159 | Bacteria | 1284 |
| 107 | Ga0105239_10028484 | 3300010375 | Bacteria | 6142 |
| 108 | Ga0105239_10075888 | 3300010375 | Bacteria | 3696 |
| 109 | Ga0105239_10361523 | 3300010375 | Bacteria | 1639 |
| 110 | Ga0105246_10026658 | 3300011119 | Bacteria | 3779 |
| 111 | Ga0105246_10029723 | 3300011119 | Bacteria | 3601 |
| 112 | Ga0157370_10034724 | 3300013104 | Bacteria | 4907 |
| 113 | Ga0157369_10004338 | 3300013105 | Bacteria | 16741 |
| 114 | Ga0157369_10025007 | 3300013105 | Bacteria | 6633 |
| 115 | Ga0157369_10126326 | 3300013105 | Bacteria | 2711 |
| 116 | Ga0157369_10311113 | 3300013105 | Bacteria | 1638 |
| 117 | Ga0157369_10490392 | 3300013105 | Bacteria | 1271 |
| 118 | Ga0163162_10175114 | 3300013306 | Bacteria | 2271 |
| 119 | Ga0163162_10298846 | 3300013306 | Bacteria | 1742 |
| 120 | Ga0163162_10499531 | 3300013306 | Bacteria | 1347 |
| 121 | Ga0163162_10708220 | 3300013306 | Bacteria | 1128 |
| 122 | Ga0163162_10863306 | 3300013306 | Bacteria | 1020 |
| 123 | Ga0157372_10064318 | 3300013307 | Bacteria | 4116 |
| 124 | Ga0157372_10269600 | 3300013307 | Bacteria | 1978 |
| 125 | Ga0157375_10113678 | 3300013308 | Bacteria | 2808 |
| 126 | Ga0157375_10440379 | 3300013308 | Bacteria | 1469 |
| 127 | Ga0163163_10099524 | 3300014325 | Bacteria | 2929 |
| 128 | Ga0163163_10119813 | 3300014325 | Bacteria | 2665 |
| 129 | Ga0163163_10363770 | 3300014325 | Bacteria | 1503 |
| 130 | Ga0157380_10184744 | 3300014326 | Bacteria | 1835 |
| 131 | Ga0157379_10841015 | 3300014968 | Bacteria | 868 |
| 132 | Ga0157376_10239027 | 3300014969 | Bacteria | 1691 |
| 133 | Ga0157376_10533737 | 3300014969 | Bacteria | 1158 |
| 134 | Ga0197907_10667738 | 3300020069 | Bacteria | 1375 |
| 135 | Ga0206356_11294997 | 3300020070 | Bacteria | 925 |
| 136 | Ga0213876_10004813 | 3300021384 | Bacteria | 7491 |
| 137 | Ga0209758_1013291 | 3300025297 | Bacteria | 4506 |
| 138 | Ga0207696_1064117 | 3300025711 | Bacteria | 1029 |
| 139 | Ga0207688_10229107 | 3300025901 | Bacteria | 1121 |
| 140 | Ga0207647_10066711 | 3300025904 | Bacteria | 2181 |
| 141 | Ga0207699_10004205 | 3300025906 | Bacteria | 6888 |
| 142 | Ga0207699_10033189 | 3300025906 | Bacteria | 2916 |
| 143 | Ga0207699_10038737 | 3300025906 | Bacteria | 2734 |
| 144 | Ga0207643_10278448 | 3300025908 | Bacteria | 1037 |
| 145 | Ga0207705_10222000 | 3300025909 | Bacteria | 1436 |
| 146 | Ga0207705_10356611 | 3300025909 | Bacteria | 1127 |
| 147 | Ga0207684_10384362 | 3300025910 | Bacteria | 1207 |
| 148 | Ga0207654_10018086 | 3300025911 | Bacteria | 3695 |
| 149 | Ga0207654_10073648 | 3300025911 | Bacteria | 2036 |
| 150 | Ga0207707_10019838 | 3300025912 | Bacteria | 5868 |
| 151 | Ga0207707_10041569 | 3300025912 | Bacteria | 4014 |
| 152 | Ga0207707_10068350 | 3300025912 | Bacteria | 3095 |
| 153 | Ga0207707_10358755 | 3300025912 | Bacteria | 1255 |
| 154 | Ga0207695_10008320 | 3300025913 | Bacteria | 13001 |
| 155 | Ga0207695_10357522 | 3300025913 | Bacteria | 1347 |
| 156 | Ga0207671_10054890 | 3300025914 | Bacteria | 2951 |
| 157 | Ga0207671_10075321 | 3300025914 | Bacteria | 2524 |
| 158 | Ga0207671_10510624 | 3300025914 | Bacteria | 958 |
| 159 | Ga0207693_10007680 | 3300025915 | Bacteria | 8858 |
| 160 | Ga0207693_10052813 | 3300025915 | Bacteria | 3188 |
| 161 | Ga0207693_10138319 | 3300025915 | Bacteria | 1915 |
| 162 | Ga0207663_10001394 | 3300025916 | Bacteria | 11216 |
| 163 | Ga0207663_10028682 | 3300025916 | Bacteria | 3261 |
| 164 | Ga0207663_10032477 | 3300025916 | Bacteria | 3099 |
| 165 | Ga0207663_10052103 | 3300025916 | Bacteria | 2551 |
| 166 | Ga0207660_10028670 | 3300025917 | Bacteria | 3809 |
| 167 | Ga0207660_10101014 | 3300025917 | Bacteria | 2154 |
| 168 | Ga0207649_10160598 | 3300025920 | Bacteria | 1557 |
| 169 | Ga0207652_10015328 | 3300025921 | Bacteria | 6224 |
| 170 | Ga0207652_10063844 | 3300025921 | Bacteria | 3185 |
| 171 | Ga0207652_10312105 | 3300025921 | Bacteria | 1419 |
| 172 | Ga0207694_10276315 | 3300025924 | Bacteria | 1379 |
| 173 | Ga0207700_10088173 | 3300025928 | Bacteria | 2442 |
| 174 | Ga0207700_10208068 | 3300025928 | Bacteria | 1652 |
| 175 | Ga0207700_10210866 | 3300025928 | Bacteria | 1642 |
| 176 | Ga0207664_10103546 | 3300025929 | Bacteria | 2355 |
| 177 | Ga0207664_10549141 | 3300025929 | Bacteria | 1036 |
| 178 | Ga0207690_10162193 | 3300025932 | Bacteria | 1667 |
| 179 | Ga0207709_10080289 | 3300025935 | Bacteria | 2100 |
| 180 | Ga0207669_10093036 | 3300025937 | Bacteria | 1969 |
| 181 | Ga0207704_10626071 | 3300025938 | Bacteria | 884 |
| 182 | Ga0207665_10011500 | 3300025939 | Bacteria | 5814 |
| 183 | Ga0207665_10079606 | 3300025939 | Bacteria | 2252 |
| 184 | Ga0207665_10097119 | 3300025939 | Bacteria | 2050 |
| 185 | Ga0207711_10035426 | 3300025941 | Bacteria | 4230 |
| 186 | Ga0207711_10061683 | 3300025941 | Bacteria | 3233 |
| 187 | Ga0207711_10096005 | 3300025941 | Bacteria | 2615 |
| 188 | Ga0207689_10023974 | 3300025942 | Bacteria | 5119 |
| 189 | Ga0207661_10001465 | 3300025944 | Bacteria | 15950 |
| 190 | Ga0207661_10009855 | 3300025944 | Bacteria | 6863 |
| 191 | Ga0207661_10366441 | 3300025944 | Bacteria | 1302 |
| 192 | Ga0207679_10360257 | 3300025945 | Bacteria | 1270 |
| 193 | Ga0207679_10367004 | 3300025945 | Bacteria | 1259 |
| 194 | Ga0207667_10019496 | 3300025949 | Bacteria | 7568 |
| 195 | Ga0207667_10043499 | 3300025949 | Bacteria | 4766 |
| 196 | Ga0207667_10166219 | 3300025949 | Bacteria | 2268 |
| 197 | Ga0207667_10181419 | 3300025949 | Bacteria | 2162 |
| 198 | Ga0207667_10239986 | 3300025949 | Bacteria | 1855 |
| 199 | Ga0207667_10666908 | 3300025949 | Bacteria | 1044 |
| 200 | Ga0207651_10163488 | 3300025960 | Bacteria | 1748 |
| 201 | Ga0207668_10025704 | 3300025972 | Bacteria | 3813 |
| 202 | Ga0207668_10240451 | 3300025972 | Bacteria | 1464 |
| 203 | Ga0207640_10065470 | 3300025981 | Bacteria | 2425 |
| 204 | Ga0207677_10011829 | 3300026023 | Bacteria | 4992 |
| 205 | Ga0207703_10090391 | 3300026035 | Bacteria | 2573 |
| 206 | Ga0207703_10170023 | 3300026035 | Bacteria | 1916 |
| 207 | Ga0207639_10229540 | 3300026041 | Bacteria | 1608 |
| 208 | Ga0207639_10620392 | 3300026041 | Bacteria | 998 |
| 209 | Ga0207678_10095924 | 3300026067 | Bacteria | 2534 |
| 210 | Ga0207678_10263657 | 3300026067 | Bacteria | 1477 |
| 211 | Ga0207678_10619311 | 3300026067 | Bacteria | 950 |
| 212 | Ga0207702_10000044 | 3300026078 | Bacteria | 149419 |
| 213 | Ga0207702_10484960 | 3300026078 | Bacteria | 1203 |
| 214 | Ga0207641_10264292 | 3300026088 | Bacteria | 1612 |
| 215 | Ga0207676_10140885 | 3300026095 | Bacteria | 2064 |
| 216 | Ga0207676_10208656 | 3300026095 | Bacteria | 1732 |
| 217 | Ga0207676_10498704 | 3300026095 | Bacteria | 1156 |
| 218 | Ga0207674_10499548 | 3300026116 | Bacteria | 1175 |
| 219 | Ga0207675_100359519 | 3300026118 | Bacteria | 1428 |
| 220 | Ga0207683_10035128 | 3300026121 | Bacteria | 4360 |
| 221 | Ga0268266_10046149 | 3300028379 | Bacteria | 3730 |
| 222 | Ga0268266_10050503 | 3300028379 | Bacteria | 3568 |
| 223 | Ga0268266_10186220 | 3300028379 | Bacteria | 1893 |
| 224 | Ga0268266_10228854 | 3300028379 | Bacteria | 1712 |
| 225 | Ga0268264_10000020 | 3300028381 | Bacteria | 483593 |
| 226 | Ga0268264_10228891 | 3300028381 | Bacteria | 1716 |
| 227 | Ga0307517_10000154 | 3300028786 | Bacteria | 109811 |
| 228 | Ga0307515_10036737 | 3300028794 | Bacteria | 7911 |
| 229 | Ga0307511_10186279 | 3300030521 | Bacteria | 1107 |
| 230 | Ga0265330_10061320 | 3300031235 | Bacteria | 1636 |
| 231 | Ga0265332_10047772 | 3300031238 | Bacteria | 1842 |
| 232 | Ga0265340_10082669 | 3300031247 | Bacteria | 1510 |
| 233 | Ga0265331_10060441 | 3300031250 | Bacteria | 1790 |
| 234 | Ga0265316_10075616 | 3300031344 | Bacteria | 2590 |
| 235 | Ga0265316_10393497 | 3300031344 | Bacteria | 999 |
| 236 | Ga0307509_10023576 | 3300031507 | Bacteria | 6904 |
| 237 | Ga0307509_10168081 | 3300031507 | Bacteria | 2077 |
| 238 | Ga0307508_10000058 | 3300031616 | Bacteria | 125293 |
| 239 | Ga0307508_10212401 | 3300031616 | Bacteria | 1535 |
| 240 | Ga0307508_10305212 | 3300031616 | Bacteria | 1184 |
| 241 | Ga0307508_10460471 | 3300031616 | Bacteria | 865 |
| 242 | Ga0265314_10038869 | 3300031711 | Bacteria | 3434 |
| 243 | Ga0265314_10111845 | 3300031711 | Bacteria | 1734 |
| 244 | Ga0265342_10051298 | 3300031712 | Bacteria | 2462 |
| 245 | Ga0307516_10007782 | 3300031730 | Bacteria | 12239 |
| 246 | Ga0307516_10008726 | 3300031730 | Bacteria | 11400 |
| 247 | Ga0307516_10067440 | 3300031730 | Bacteria | 3448 |
| 248 | Ga0307516_10188216 | 3300031730 | Bacteria | 1792 |
| 249 | Ga0307516_10319903 | 3300031730 | Bacteria | 1222 |
| 250 | Ga0307405_10406119 | 3300031731 | Bacteria | 1068 |
| 251 | Ga0307510_10072655 | 3300033180 | Bacteria | 3416 |
| 252 | Ga0307510_10245848 | 3300033180 | Bacteria | 1280 |
| 253 | Ga0307510_10275773 | 3300033180 | Bacteria | 1155 |
| 254 | Ga0373930_0002341 | 3300034816 | Bacteria | 2925 |
| 255 | Ga0373926_0013206 | 3300035083 | Bacteria | 2799 |
| 256 | Ga0373934_0055237 | 3300035086 | Bacteria | 1578 |
| 257 | Ga0373934_0076916 | 3300035086 | Bacteria | 1339 |
| 258 | Ga0373923_0061352 | 3300035111 | Bacteria | 1598 |
| 259 | Ga0373932_0016942 | 3300035112 | Bacteria | 1864 |
| 260 | Ga0373936_0035500 | 3300035113 | Bacteria | 1985 |
| 261 | Ga0373941_0059000 | 3300035115 | Bacteria | 1243 |
| 262 | Ga0373945_0155197 | 3300035116 | Bacteria | 930 |
| 263 | Ga0373953_0047064 | 3300035117 | Bacteria | 1734 |
| 264 | Ga0373953_0055072 | 3300035117 | Bacteria | 1614 |
| 265 | Ga0373954_0028301 | 3300035118 | Bacteria | 2576 |
| 266 | Ga0373954_0047695 | 3300035118 | Bacteria | 2005 |
| 267 | Ga0373957_0039832 | 3300035120 | Bacteria | 1764 |
| 268 | Ga0373957_0122260 | 3300035120 | Bacteria | 1054 |
| 269 | Ga0373955_0007865 | 3300035172 | Bacteria | 4918 |
| 270 | Ga0373942_0078443 | 3300035207 | Bacteria | 976 |
| 271 | Ga0373931_0007186 | 3300035691 | Bacteria | 5239 |
| 272 | Ga0373935_0149943 | 3300035692 | Bacteria | 1582 |
| 273 | Ga0373935_0328345 | 3300035692 | Bacteria | 1087 |
| 274 | Ga0373927_0016529 | 3300035695 | Bacteria | 4866 |
| 275 | Ga0373927_0020797 | 3300035695 | Bacteria | 4301 |
| 276 | Ga0373927_0028531 | 3300035695 | Bacteria | 3641 |
| 277 | Ga0373933_0095995 | 3300035724 | Bacteria | 1834 |
| 278 | Ga0373933_0206407 | 3300035724 | Bacteria | 1258 |
| 279 | Ga0373933_0324662 | 3300035724 | Bacteria | 998 |
| 280 | Ga0373947_0023737 | 3300035725 | Bacteria | 3569 |
| 281 | Ga0373937_0198526 | 3300036401 | Bacteria | 1886 |
| 282 | Ga0373937_0388262 | 3300036401 | Bacteria | 1324 |
| 283 | Ga0373937_0551833 | 3300036401 | Bacteria | 1094 |
| 284 | Ga0372808_001404 | 3300036459 | Bacteria | 2489 |
| 285 | Ga0373925_0019916 | 3300037068 | Bacteria | 4881 |
| 286 | Ga0373925_0033510 | 3300037068 | Bacteria | 3785 |
| 287 | Ga0373925_0670843 | 3300037068 | Bacteria | 854 |
| 288 | Ga0395900_0026123 | 3300037418 | Bacteria | 5979 |
| 289 | Ga0395898_0330053 | 3300037466 | Bacteria | 1454 |
| 290 | Ga0395901_0090872 | 3300038443 | Bacteria | 3196 |
| 291 | Ga0436365_0135853 | 3300039437 | Bacteria | 5722 |
| 292 | Ga0436365_0220203 | 3300039437 | Bacteria | 19855 |
| 293 | Ga0436360_0436674 | 3300039438 | Bacteria | 1270 |
| 294 | Ga0436363_0322966 | 3300039450 | Bacteria | 2539 |
| 295 | Ga0436362_0754627 | 3300039453 | Bacteria | 2892 |
| 296 | Ga0451802_0112925 | 3300041460 | Bacteria | 1146 |
| 297 | Ga0466963_0048484 | 3300044694 | Bacteria | 2807 |
| 298 | Ga0466959_0149198 | 3300045049 | Bacteria | 1649 |
| 299 | Ga0495592_0046391 | 3300046454 | Bacteria | 3239 |
| 300 | Ga0495603_0010109 | 3300046455 | Bacteria | 5712 |
| 301 | Ga0495603_0022058 | 3300046455 | Bacteria | 3856 |
| 302 | Ga0495590_0121312 | 3300046457 | Bacteria | 937 |
| 303 | Ga0495629_0023858 | 3300046459 | Bacteria | 4357 |
| 304 | Ga0495629_0027496 | 3300046459 | Bacteria | 4038 |
| 305 | Ga0495629_0124599 | 3300046459 | Bacteria | 1795 |
| 306 | Ga0495641_0020021 | 3300046461 | Bacteria | 3406 |
| 307 | Ga0495653_0213981 | 3300046463 | Bacteria | 1300 |
| 308 | Ga0495580_0017778 | 3300046472 | Bacteria | 5305 |
| 309 | Ga0495662_0073159 | 3300046476 | Bacteria | 1662 |
| 310 | Ga0495662_0167389 | 3300046476 | Bacteria | 1083 |
| 311 | Ga0495664_0045132 | 3300046477 | Bacteria | 2613 |
| 312 | Ga0495664_0141626 | 3300046477 | Bacteria | 1458 |
| 313 | Ga0495607_0036558 | 3300046501 | Bacteria | 2957 |
| 314 | Ga0495583_0025401 | 3300046506 | Bacteria | 2960 |
| 315 | Ga0495606_0002021 | 3300046507 | Bacteria | 24909 |
| 316 | Ga0495608_0016544 | 3300046511 | Bacteria | 5103 |
| 317 | Ga0495616_0146390 | 3300046513 | Bacteria | 1071 |
| 318 | Ga0495628_0029001 | 3300046516 | Bacteria | 4492 |
| 319 | Ga0495631_0021074 | 3300046518 | Bacteria | 3037 |
| 320 | Ga0495632_0025587 | 3300046519 | Bacteria | 3119 |
| 321 | Ga0495643_0152587 | 3300046522 | Bacteria | 1143 |
| 322 | Ga0495652_0356397 | 3300046529 | Bacteria | 1046 |
| 323 | Ga0495652_0380248 | 3300046529 | Bacteria | 1004 |
| 324 | Ga0495640_0065295 | 3300046533 | Bacteria | 2457 |
| 325 | Ga0495640_0091758 | 3300046533 | Bacteria | 2004 |
| 326 | Ga0495645_0003561 | 3300046543 | Bacteria | 10546 |
| 327 | Ga0495645_0143771 | 3300046543 | Bacteria | 1662 |
| 328 | Ga0495645_0379922 | 3300046543 | Bacteria | 904 |
| 329 | Ga0495622_0073498 | 3300046557 | Bacteria | 1577 |
| 330 | Ga0495667_0110446 | 3300046559 | Bacteria | 1776 |
| 331 | Ga0495656_0010761 | 3300046615 | Bacteria | 3336 |
| 332 | Ga0495634_0031212 | 3300046642 | Bacteria | 3671 |
| 333 | Ga0495634_0294408 | 3300046642 | Bacteria | 983 |
| 334 | Ga0495625_0038784 | 3300046660 | Bacteria | 3483 |
| 335 | Ga0495625_0140576 | 3300046660 | Bacteria | 1629 |
| 336 | Ga0495635_0262222 | 3300046663 | Bacteria | 1163 |
| 337 | Ga0495659_0020696 | 3300046664 | Bacteria | 2212 |
| 338 | Ga0495661_0041983 | 3300046665 | Bacteria | 2824 |
| 339 | Ga0495657_0245803 | 3300046675 | Bacteria | 1078 |
| 340 | Ga0495599_0056761 | 3300046678 | Bacteria | 2451 |
| 341 | Ga0495599_0067903 | 3300046678 | Bacteria | 2226 |
| 342 | Ga0495599_0074692 | 3300046678 | Bacteria | 2116 |
| 343 | Ga0495646_0047859 | 3300046680 | Bacteria | 2601 |
| 344 | Ga0495646_0055337 | 3300046680 | Bacteria | 2383 |
| 345 | Ga0495647_0032540 | 3300046681 | Bacteria | 1944 |
| 346 | Ga0495658_0114857 | 3300046683 | Bacteria | 1622 |
| 347 | Ga0495669_0124770 | 3300046684 | Bacteria | 1209 |
| 348 | Ga0495624_0154825 | 3300046690 | Bacteria | 1401 |
| 349 | Ga0495670_0088005 | 3300046691 | Bacteria | 1587 |
| 350 | Ga0495600_0257235 | 3300046809 | Bacteria | 1109 |
| 351 | Ga0495581_0013922 | 3300047315 | Bacteria | 4665 |
| 352 | Ga0495581_0149330 | 3300047315 | Bacteria | 1364 |
| 353 | Ga0495581_0151763 | 3300047315 | Bacteria | 1353 |
| 354 | Ga0495604_0137864 | 3300047317 | Bacteria | 1746 |
| 355 | Ga0495604_0284952 | 3300047317 | Bacteria | 1115 |
| 356 | Ga0495674_0062697 | 3300047319 | Bacteria | 3236 |
| 357 | Ga0495674_0068177 | 3300047319 | Bacteria | 3079 |
| 358 | Ga0495683_0036005 | 3300047323 | Bacteria | 2514 |
| 359 | Ga0495675_0021540 | 3300047444 | Bacteria | 4105 |
| 360 | Ga0495675_0087015 | 3300047444 | Bacteria | 1963 |
| 361 | Ga0495677_0033687 | 3300047445 | Bacteria | 1867 |
| 362 | Ga0495673_0013160 | 3300047469 | Bacteria | 4356 |
| 363 | Ga0495593_0044491 | 3300047673 | Bacteria | 2374 |
| 364 | Ga0495593_0225221 | 3300047673 | Bacteria | 941 |
| 365 | Ga0495602_0162737 | 3300048088 | Bacteria | 1740 |
| 366 | Ga0496100_0033288 | 3300048903 | Bacteria | 3224 |
| 367 | Ga0496100_0640844 | 3300048903 | Bacteria | 827 |
| 368 | Ga0496101_0011026 | 3300048904 | Bacteria | 5986 |
| 369 | Ga0496102_0023554 | 3300048905 | Bacteria | 5471 |
| 370 | Ga0496102_0102803 | 3300048905 | Bacteria | 2657 |
| 371 | Ga0496102_0704891 | 3300048905 | Bacteria | 932 |
| 372 | Ga0496104_0055614 | 3300048907 | Bacteria | 3742 |
| 373 | Ga0496104_0145925 | 3300048907 | Bacteria | 2272 |
| 374 | Ga0496104_0291686 | 3300048907 | Bacteria | 1544 |
| 375 | Ga0496105_0018871 | 3300048908 | Bacteria | 5554 |
| 376 | Ga0496105_0295565 | 3300048908 | Bacteria | 1303 |
| 377 | Ga0496106_0019033 | 3300048909 | Bacteria | 5090 |
| 378 | Ga0496106_0027689 | 3300048909 | Bacteria | 4222 |
| 379 | Ga0496107_0006065 | 3300048910 | Bacteria | 8296 |
| 380 | Ga0496107_0223004 | 3300048910 | Bacteria | 1402 |
| 381 | Ga0496107_0301569 | 3300048910 | Bacteria | 1192 |
| 382 | Ga0496108_0083747 | 3300048911 | Bacteria | 2706 |
| 383 | Ga0496108_0176029 | 3300048911 | Bacteria | 1852 |
| 384 | Ga0496108_0202399 | 3300048911 | Bacteria | 1723 |
| 385 | Ga0496109_0024212 | 3300048912 | Bacteria | 5395 |
| 386 | Ga0496109_0070335 | 3300048912 | Bacteria | 3211 |
| 387 | Ga0496109_0238269 | 3300048912 | Bacteria | 1712 |
| 388 | Ga0496109_0619550 | 3300048912 | Bacteria | 1019 |
| 389 | Ga0496110_0029809 | 3300048913 | Bacteria | 4700 |
| 390 | Ga0496110_0037649 | 3300048913 | Bacteria | 4205 |
| 391 | Ga0496111_0029598 | 3300048914 | Bacteria | 3890 |
| 392 | Ga0496111_0339467 | 3300048914 | Bacteria | 1112 |
| 393 | Ga0496112_0022578 | 3300048915 | Bacteria | 5997 |
| 394 | Ga0496112_0025979 | 3300048915 | Bacteria | 5628 |
| 395 | Ga0496112_0028286 | 3300048915 | Bacteria | 5410 |
| 396 | Ga0496112_0057555 | 3300048915 | Bacteria | 3827 |
| 397 | Ga0496112_0634344 | 3300048915 | Bacteria | 999 |
| 398 | Ga0496113_0024832 | 3300048916 | Bacteria | 4265 |
| 399 | Ga0496114_0021110 | 3300048917 | Bacteria | 5294 |
| 400 | Ga0496115_0008011 | 3300048918 | Bacteria | 7796 |
| 401 | Ga0496115_0083306 | 3300048918 | Bacteria | 2607 |
| 402 | Ga0496115_0086663 | 3300048918 | Bacteria | 2555 |
| 403 | Ga0496115_0229190 | 3300048918 | Bacteria | 1532 |
| 404 | Ga0496117_0063903 | 3300048920 | Bacteria | 2513 |
| 405 | Ga0496118_0075911 | 3300048921 | Bacteria | 2393 |
| 406 | Ga0496121_0013310 | 3300048924 | Bacteria | 8856 |
| 407 | Ga0496121_0072127 | 3300048924 | Bacteria | 2773 |
| 408 | Ga0496121_0148254 | 3300048924 | Bacteria | 1730 |
| 409 | Ga0496121_0229000 | 3300048924 | Bacteria | 1303 |
| 410 | Ga0496121_0274971 | 3300048924 | Bacteria | 1155 |
| 411 | Ga0496124_0010980 | 3300048927 | Bacteria | 9104 |
| 412 | Ga0496125_0225369 | 3300048928 | Bacteria | 1204 |
| 413 | Ga0496126_0063831 | 3300048929 | Bacteria | 3300 |
| 414 | Ga0496126_0266313 | 3300048929 | Bacteria | 1423 |
| 415 | Ga0496126_0357016 | 3300048929 | Bacteria | 1194 |
| 416 | Ga0496126_0619805 | 3300048929 | Bacteria | 850 |
| 417 | Ga0501067_0128479 | 3300049583 | Bacteria | 1410 |
| 418 | Ga0501069_0219373 | 3300049585 | Bacteria | 1105 |
| 419 | nmdc:mga03n38_184004_c1 | 3300050490 | Bacteria | 1072 |
| 420 | nmdc:mga00v17_187424_c1 | 3300050491 | Bacteria | 1335 |
| 421 | nmdc:mga06z11_173608_c1 | 3300050494 | Bacteria | 1239 |
| 422 | nmdc:mga0n895_255982_c1 | 3300050512 | Bacteria | 1776 |
| 423 | nmdc:mga0rr50_607051_c1 | 3300050513 | Bacteria | 933 |
| 424 | Ga0495601_0365103 | 3300053077 | Bacteria | 938 |
| 425 | Ga0495612_0025063 | 3300053078 | Bacteria | 2395 |
| 426 | Ga0495612_0077235 | 3300053078 | Bacteria | 1395 |
| 427 | Ga0500635_0001632 | 3300053080 | Bacteria | 5409 |
| 428 | Ga0495595_0015365 | 3300053084 | Bacteria | 3265 |
| 429 | Ga0495595_0027024 | 3300053084 | Bacteria | 2554 |
| 430 | Ga0495619_0248149 | 3300053085 | Bacteria | 1233 |
| 431 | Ga0500566_0057021 | 3300053094 | Bacteria | 2219 |
| 432 | Ga0500554_039001 | 3300053102 | Bacteria | 1448 |
| 433 | Ga0500595_000467 | 3300053119 | Bacteria | 25049 |
| 434 | Ga0500595_012155 | 3300053119 | Bacteria | 3337 |
| 435 | Ga0500590_027613 | 3300053148 | Bacteria | 2944 |
| 436 | Ga0500603_000396 | 3300053150 | Bacteria | 11416 |
| 437 | Ga0500622_0080620 | 3300053156 | Bacteria | 1630 |
| 438 | Ga0500636_0030549 | 3300053177 | Bacteria | 3187 |
| 439 | Ga0500637_0001547 | 3300053178 | Bacteria | 9816 |
| 440 | Ga0500637_0002752 | 3300053178 | Bacteria | 7889 |
| 441 | Ga0500637_0202191 | 3300053178 | Bacteria | 1130 |
| 442 | Ga0500661_000043 | 3300055283 | Bacteria | 19291 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025916 | Ga0207663_10001394 | Ga0207663_100013942 | 225 |
| 2 | 3300025929 | Ga0207664_10549141 | Ga0207664_105491411 | 225 |
| 3 | 3300014325 | Ga0163163_10363770 | Ga0163163_103637702 | 227 |
| 4 | 3300005614 | Ga0068856_100000066 | Ga0068856_10000006663 | 232 |
| 5 | 3300026078 | Ga0207702_10000044 | Ga0207702_1000004452 | 232 |
| 6 | 3300048918 | Ga0496115_0086663 | Ga0496115_0086663_1403_2158 | 233 |
| 7 | 3300013105 | Ga0157369_10311113 | Ga0157369_103111132 | 234 |
| 8 | 3300031507 | Ga0307509_10023576 | Ga0307509_100235766 | 234 |
| 9 | 3300031616 | Ga0307508_10305212 | Ga0307508_103052121 | 234 |
| 10 | 3300053178 | Ga0500637_0202191 | Ga0500637_0202191_78_827 | 234 |
| 11 | 3300025939 | Ga0207665_10079606 | Ga0207665_100796062 | 235 |
| 12 | 3300030521 | Ga0307511_10186279 | Ga0307511_101862791 | 235 |
| 13 | 3300005436 | Ga0070713_100400361 | Ga0070713_1004003611 | 237 |
| 14 | 3300033180 | Ga0307510_10072655 | Ga0307510_100726552 | 237 |
| 15 | 3300046455 | Ga0495603_0010109 | Ga0495603_0010109_1858_2616 | 237 |
| 16 | 3300046455 | Ga0495603_0022058 | Ga0495603_0022058_2035_2793 | 237 |
| 17 | 3300048920 | Ga0496117_0063903 | Ga0496117_0063903_1615_2364 | 237 |
| 18 | 3300048921 | Ga0496118_0075911 | Ga0496118_0075911_1525_2274 | 237 |
| 19 | 3300048924 | Ga0496121_0274971 | Ga0496121_0274971_284_1033 | 237 |
| 20 | 3300048927 | Ga0496124_0010980 | Ga0496124_0010980_5203_5952 | 237 |
| 21 | 3300053080 | Ga0500635_0001632 | Ga0500635_0001632_2578_3336 | 237 |
| 22 | 3300053102 | Ga0500554_039001 | Ga0500554_039001_17_775 | 237 |
| 23 | 3300053150 | Ga0500603_000396 | Ga0500603_000396_9031_9789 | 237 |
| 24 | 3300053178 | Ga0500637_0002752 | Ga0500637_0002752_1918_2676 | 237 |
| 25 | iso_pu_bacteria | 2904479285 | 2904482982 | 237 |
| 26 | 3300047315 | Ga0495581_0151763 | Ga0495581_0151763_581_1333 | 238 |
| 27 | 3300048915 | Ga0496112_0634344 | Ga0496112_0634344_82_846 | 239 |
| 28 | 3300031616 | Ga0307508_10000058 | Ga0307508_1000005870 | 240 |
| 29 | 3300046507 | Ga0495606_0002021 | Ga0495606_0002021_223_978 | 240 |
| 30 | 3300005434 | Ga0070709_10037540 | Ga0070709_100375402 | 242 |
| 31 | 3300025906 | Ga0207699_10033189 | Ga0207699_100331892 | 242 |
| 32 | 3300005843 | Ga0068860_100001582 | Ga0068860_10000158212 | 243 |
| 33 | 3300028381 | Ga0268264_10000020 | Ga0268264_1000002092 | 243 |
| 34 | 3300037068 | Ga0373925_0033510 | Ga0373925_0033510_1346_2098 | 243 |
| 35 | 3300009092 | Ga0105250_10132738 | Ga0105250_101327381 | 244 |
| 36 | 3300021384 | Ga0213876_10004813 | Ga0213876_100048133 | 244 |
| 37 | 3300025711 | Ga0207696_1064117 | Ga0207696_10641171 | 244 |
| 38 | 3300035086 | Ga0373934_0055237 | Ga0373934_0055237_27_785 | 244 |
| 39 | 3300035117 | Ga0373953_0055072 | Ga0373953_0055072_778_1536 | 244 |
| 40 | 3300035118 | Ga0373954_0028301 | Ga0373954_0028301_1544_2302 | 244 |
| 41 | 3300035692 | Ga0373935_0149943 | Ga0373935_0149943_455_1213 | 244 |
| 42 | 3300035724 | Ga0373933_0095995 | Ga0373933_0095995_140_898 | 244 |
| 43 | 3300036401 | Ga0373937_0551833 | Ga0373937_0551833_201_959 | 244 |
| 44 | 3300039437 | Ga0436365_0220203 | Ga0436365_0220203_7330_8085 | 244 |
| 45 | 3300039450 | Ga0436363_0322966 | Ga0436363_0322966_536_1291 | 244 |
| 46 | 3300039453 | Ga0436362_0754627 | Ga0436362_0754627_1435_2190 | 244 |
| 47 | 3300046459 | Ga0495629_0124599 | Ga0495629_0124599_258_1016 | 244 |
| 48 | 3300046463 | Ga0495653_0213981 | Ga0495653_0213981_342_1100 | 244 |
| 49 | 3300046476 | Ga0495662_0167389 | Ga0495662_0167389_60_818 | 244 |
| 50 | 3300046511 | Ga0495608_0016544 | Ga0495608_0016544_2801_3559 | 244 |
| 51 | 3300046529 | Ga0495652_0356397 | Ga0495652_0356397_253_1011 | 244 |
| 52 | 3300046559 | Ga0495667_0110446 | Ga0495667_0110446_32_790 | 244 |
| 53 | 3300046675 | Ga0495657_0245803 | Ga0495657_0245803_78_836 | 244 |
| 54 | 3300046678 | Ga0495599_0067903 | Ga0495599_0067903_523_1281 | 244 |
| 55 | 3300047317 | Ga0495604_0137864 | Ga0495604_0137864_747_1505 | 244 |
| 56 | 3300047673 | Ga0495593_0225221 | Ga0495593_0225221_48_806 | 244 |
| 57 | 3300048088 | Ga0495602_0162737 | Ga0495602_0162737_782_1540 | 244 |
| 58 | 3300053078 | Ga0495612_0077235 | Ga0495612_0077235_18_776 | 244 |
| 59 | 3300053084 | Ga0495595_0015365 | Ga0495595_0015365_2288_3046 | 244 |
| 60 | iso_pu_bacteria | 8006994254 | 8006994486 | 244 |
| 61 | iso_pu_bacteria | 2513237101 | 2513693602 | 246 |
| 62 | iso_pu_bacteria | 2791355199 | 2793081420 | 246 |
| 63 | iso_pu_bacteria | 2874604998 | 2874611463 | 246 |
| 64 | iso_pu_bacteria | 2889033259 | 2889042200 | 246 |
| 65 | iso_pu_bacteria | 2922361189 | 2922362930 | 246 |
| 66 | iso_pu_bacteria | 8006964411 | 8006970180 | 246 |
| 67 | 3300025939 | Ga0207665_10097119 | Ga0207665_100971191 | 247 |
| 68 | 3300048907 | Ga0496104_0145925 | Ga0496104_0145925_1024_1767 | 247 |
| 69 | 3300005329 | Ga0070683_100227728 | Ga0070683_1002277282 | 248 |
| 70 | 3300005842 | Ga0068858_100240386 | Ga0068858_1002403862 | 248 |
| 71 | 3300013308 | Ga0157375_10440379 | Ga0157375_104403792 | 248 |
| 72 | 3300014969 | Ga0157376_10533737 | Ga0157376_105337371 | 248 |
| 73 | 3300025944 | Ga0207661_10366441 | Ga0207661_103664412 | 248 |
| 74 | 3300048905 | Ga0496102_0023554 | Ga0496102_0023554_3885_4631 | 248 |
| 75 | 3300048911 | Ga0496108_0083747 | Ga0496108_0083747_1457_2203 | 248 |
| 76 | 3300048912 | Ga0496109_0024212 | Ga0496109_0024212_139_885 | 248 |
| 77 | 3300048913 | Ga0496110_0037649 | Ga0496110_0037649_1774_2520 | 248 |
| 78 | 3300048914 | Ga0496111_0339467 | Ga0496111_0339467_191_937 | 248 |
| 79 | 3300048915 | Ga0496112_0022578 | Ga0496112_0022578_298_1044 | 248 |
| 80 | 3300048918 | Ga0496115_0083306 | Ga0496115_0083306_121_867 | 248 |
| 81 | 3300005535 | Ga0070684_100964724 | Ga0070684_1009647241 | 249 |
| 82 | 3300005578 | Ga0068854_100857443 | Ga0068854_1008574431 | 249 |
| 83 | 3300010375 | Ga0105239_10361523 | Ga0105239_103615232 | 249 |
| 84 | 3300013306 | Ga0163162_10863306 | Ga0163162_108633061 | 249 |
| 85 | 3300013308 | Ga0157375_10113678 | Ga0157375_101136782 | 249 |
| 86 | 3300014325 | Ga0163163_10099524 | Ga0163163_100995244 | 249 |
| 87 | 3300026067 | Ga0207678_10619311 | Ga0207678_106193111 | 249 |
| 88 | 3300031507 | Ga0307509_10168081 | Ga0307509_101680811 | 249 |
| 89 | 3300031730 | Ga0307516_10067440 | Ga0307516_100674402 | 249 |
| 90 | 3300031730 | Ga0307516_10188216 | Ga0307516_101882162 | 249 |
| 91 | 3300031730 | Ga0307516_10319903 | Ga0307516_103199032 | 249 |
| 92 | 3300047317 | Ga0495604_0284952 | Ga0495604_0284952_245_994 | 249 |
| 93 | 3300048903 | Ga0496100_0640844 | Ga0496100_0640844_68_817 | 249 |
| 94 | 3300048908 | Ga0496105_0295565 | Ga0496105_0295565_171_920 | 249 |
| 95 | 3300048915 | Ga0496112_0057555 | Ga0496112_0057555_2583_3332 | 249 |
| 96 | 3300053148 | Ga0500590_027613 | Ga0500590_027613_1607_2356 | 249 |
| 97 | 3300005329 | Ga0070683_100017704 | Ga0070683_1000177043 | 250 |
| 98 | 3300005329 | Ga0070683_100072240 | Ga0070683_1000722403 | 250 |
| 99 | 3300005334 | Ga0068869_100013710 | Ga0068869_1000137103 | 250 |
| 100 | 3300005336 | Ga0070680_100018051 | Ga0070680_1000180511 | 250 |
| 101 | 3300005336 | Ga0070680_100074865 | Ga0070680_1000748652 | 250 |
| 102 | 3300005336 | Ga0070680_100434561 | Ga0070680_1004345612 | 250 |
| 103 | 3300005337 | Ga0070682_100028536 | Ga0070682_1000285362 | 250 |
| 104 | 3300005338 | Ga0068868_100656413 | Ga0068868_1006564131 | 250 |
| 105 | 3300005340 | Ga0070689_100060435 | Ga0070689_1000604351 | 250 |
| 106 | 3300005344 | Ga0070661_100210927 | Ga0070661_1002109272 | 250 |
| 107 | 3300005355 | Ga0070671_100050017 | Ga0070671_1000500172 | 250 |
| 108 | 3300005367 | Ga0070667_100642319 | Ga0070667_1006423191 | 250 |
| 109 | 3300005434 | Ga0070709_10000656 | Ga0070709_1000065613 | 250 |
| 110 | 3300005434 | Ga0070709_10026466 | Ga0070709_100264662 | 250 |
| 111 | 3300005436 | Ga0070713_100037254 | Ga0070713_1000372542 | 250 |
| 112 | 3300005436 | Ga0070713_100057938 | Ga0070713_1000579382 | 250 |
| 113 | 3300005436 | Ga0070713_100258406 | Ga0070713_1002584062 | 250 |
| 114 | 3300005439 | Ga0070711_100015425 | Ga0070711_1000154252 | 250 |
| 115 | 3300005439 | Ga0070711_100032536 | Ga0070711_1000325362 | 250 |
| 116 | 3300005439 | Ga0070711_100375956 | Ga0070711_1003759561 | 250 |
| 117 | 3300005441 | Ga0070700_100114163 | Ga0070700_1001141632 | 250 |
| 118 | 3300005455 | Ga0070663_100218055 | Ga0070663_1002180552 | 250 |
| 119 | 3300005455 | Ga0070663_100251993 | Ga0070663_1002519932 | 250 |
| 120 | 3300005456 | Ga0070678_100031273 | Ga0070678_1000312732 | 250 |
| 121 | 3300005458 | Ga0070681_10129509 | Ga0070681_101295092 | 250 |
| 122 | 3300005459 | Ga0068867_100243368 | Ga0068867_1002433682 | 250 |
| 123 | 3300005467 | Ga0070706_100631380 | Ga0070706_1006313802 | 250 |
| 124 | 3300005468 | Ga0070707_100135140 | Ga0070707_1001351401 | 250 |
| 125 | 3300005471 | Ga0070698_100019717 | Ga0070698_1000197176 | 250 |
| 126 | 3300005518 | Ga0070699_100186561 | Ga0070699_1001865612 | 250 |
| 127 | 3300005530 | Ga0070679_100367456 | Ga0070679_1003674561 | 250 |
| 128 | 3300005530 | Ga0070679_100374980 | Ga0070679_1003749802 | 250 |
| 129 | 3300005535 | Ga0070684_100006660 | Ga0070684_1000066604 | 250 |
| 130 | 3300005535 | Ga0070684_100018450 | Ga0070684_1000184506 | 250 |
| 131 | 3300005539 | Ga0068853_100144845 | Ga0068853_1001448451 | 250 |
| 132 | 3300005539 | Ga0068853_100168772 | Ga0068853_1001687722 | 250 |
| 133 | 3300005547 | Ga0070693_100246305 | Ga0070693_1002463052 | 250 |
| 134 | 3300005547 | Ga0070693_100354794 | Ga0070693_1003547941 | 250 |
| 135 | 3300005548 | Ga0070665_100076424 | Ga0070665_1000764242 | 250 |
| 136 | 3300005548 | Ga0070665_100087646 | Ga0070665_1000876462 | 250 |
| 137 | 3300005548 | Ga0070665_100091094 | Ga0070665_1000910942 | 250 |
| 138 | 3300005548 | Ga0070665_100530945 | Ga0070665_1005309452 | 250 |
| 139 | 3300005563 | Ga0068855_100028344 | Ga0068855_1000283446 | 250 |
| 140 | 3300005563 | Ga0068855_100092318 | Ga0068855_1000923183 | 250 |
| 141 | 3300005563 | Ga0068855_100138673 | Ga0068855_1001386732 | 250 |
| 142 | 3300005563 | Ga0068855_100380113 | Ga0068855_1003801132 | 250 |
| 143 | 3300005563 | Ga0068855_100693903 | Ga0068855_1006939031 | 250 |
| 144 | 3300005564 | Ga0070664_100193695 | Ga0070664_1001936952 | 250 |
| 145 | 3300005564 | Ga0070664_100321966 | Ga0070664_1003219662 | 250 |
| 146 | 3300005577 | Ga0068857_100109416 | Ga0068857_1001094162 | 250 |
| 147 | 3300005578 | Ga0068854_100047834 | Ga0068854_1000478342 | 250 |
| 148 | 3300005614 | Ga0068856_100233157 | Ga0068856_1002331572 | 250 |
| 149 | 3300005616 | Ga0068852_100150373 | Ga0068852_1001503732 | 250 |
| 150 | 3300005616 | Ga0068852_100189606 | Ga0068852_1001896062 | 250 |
| 151 | 3300005617 | Ga0068859_100240230 | Ga0068859_1002402302 | 250 |
| 152 | 3300005718 | Ga0068866_10222858 | Ga0068866_102228582 | 250 |
| 153 | 3300005719 | Ga0068861_100182326 | Ga0068861_1001823262 | 250 |
| 154 | 3300005841 | Ga0068863_100208246 | Ga0068863_1002082462 | 250 |
| 155 | 3300005842 | Ga0068858_100047608 | Ga0068858_1000476082 | 250 |
| 156 | 3300005842 | Ga0068858_100194716 | Ga0068858_1001947162 | 250 |
| 157 | 3300005844 | Ga0068862_100758566 | Ga0068862_1007585661 | 250 |
| 158 | 3300005937 | Ga0081455_10007625 | Ga0081455_100076252 | 250 |
| 159 | 3300005937 | Ga0081455_10074849 | Ga0081455_100748492 | 250 |
| 160 | 3300005937 | Ga0081455_10108320 | Ga0081455_101083202 | 250 |
| 161 | 3300005983 | Ga0081540_1006482 | Ga0081540_10064824 | 250 |
| 162 | 3300005985 | Ga0081539_10001290 | Ga0081539_1000129045 | 250 |
| 163 | 3300005985 | Ga0081539_10034725 | Ga0081539_100347252 | 250 |
| 164 | 3300006028 | Ga0070717_10031143 | Ga0070717_100311432 | 250 |
| 165 | 3300006042 | Ga0075368_10080683 | Ga0075368_100806832 | 250 |
| 166 | 3300006048 | Ga0075363_100115326 | Ga0075363_1001153262 | 250 |
| 167 | 3300006051 | Ga0075364_10015406 | Ga0075364_100154062 | 250 |
| 168 | 3300006051 | Ga0075364_10324667 | Ga0075364_103246672 | 250 |
| 169 | 3300006173 | Ga0070716_100108620 | Ga0070716_1001086202 | 250 |
| 170 | 3300006175 | Ga0070712_100027903 | Ga0070712_1000279032 | 250 |
| 171 | 3300006178 | Ga0075367_10104181 | Ga0075367_101041812 | 250 |
| 172 | 3300006178 | Ga0075367_10151934 | Ga0075367_101519341 | 250 |
| 173 | 3300006178 | Ga0075367_10197783 | Ga0075367_101977832 | 250 |
| 174 | 3300006195 | Ga0075366_10083882 | Ga0075366_100838822 | 250 |
| 175 | 3300006237 | Ga0097621_100080504 | Ga0097621_1000805042 | 250 |
| 176 | 3300006237 | Ga0097621_100421784 | Ga0097621_1004217842 | 250 |
| 177 | 3300006871 | Ga0075434_100658225 | Ga0075434_1006582252 | 250 |
| 178 | 3300006931 | Ga0097620_100240241 | Ga0097620_1002402412 | 250 |
| 179 | 3300009093 | Ga0105240_10007301 | Ga0105240_100073015 | 250 |
| 180 | 3300009093 | Ga0105240_10183631 | Ga0105240_101836312 | 250 |
| 181 | 3300009093 | Ga0105240_10426543 | Ga0105240_104265432 | 250 |
| 182 | 3300009098 | Ga0105245_10024948 | Ga0105245_100249484 | 250 |
| 183 | 3300009098 | Ga0105245_10452357 | Ga0105245_104523571 | 250 |
| 184 | 3300009101 | Ga0105247_10086181 | Ga0105247_100861812 | 250 |
| 185 | 3300009174 | Ga0105241_10040412 | Ga0105241_100404122 | 250 |
| 186 | 3300009174 | Ga0105241_10113536 | Ga0105241_101135362 | 250 |
| 187 | 3300009177 | Ga0105248_10016328 | Ga0105248_100163286 | 250 |
| 188 | 3300009177 | Ga0105248_10907446 | Ga0105248_109074462 | 250 |
| 189 | 3300009545 | Ga0105237_10185710 | Ga0105237_101857102 | 250 |
| 190 | 3300009551 | Ga0105238_10068463 | Ga0105238_100684633 | 250 |
| 191 | 3300009551 | Ga0105238_10507186 | Ga0105238_105071861 | 250 |
| 192 | 3300009553 | Ga0105249_10736552 | Ga0105249_107365522 | 250 |
| 193 | 3300010159 | Ga0099796_10067328 | Ga0099796_100673282 | 250 |
| 194 | 3300010375 | Ga0105239_10028484 | Ga0105239_100284846 | 250 |
| 195 | 3300010375 | Ga0105239_10075888 | Ga0105239_100758882 | 250 |
| 196 | 3300011119 | Ga0105246_10026658 | Ga0105246_100266584 | 250 |
| 197 | 3300011119 | Ga0105246_10029723 | Ga0105246_100297232 | 250 |
| 198 | 3300013104 | Ga0157370_10034724 | Ga0157370_100347242 | 250 |
| 199 | 3300013105 | Ga0157369_10004338 | Ga0157369_1000433811 | 250 |
| 200 | 3300013105 | Ga0157369_10025007 | Ga0157369_100250074 | 250 |
| 201 | 3300013105 | Ga0157369_10126326 | Ga0157369_101263261 | 250 |
| 202 | 3300013105 | Ga0157369_10490392 | Ga0157369_104903922 | 250 |
| 203 | 3300013306 | Ga0163162_10175114 | Ga0163162_101751143 | 250 |
| 204 | 3300013306 | Ga0163162_10298846 | Ga0163162_102988462 | 250 |
| 205 | 3300013306 | Ga0163162_10499531 | Ga0163162_104995312 | 250 |
| 206 | 3300013306 | Ga0163162_10708220 | Ga0163162_107082202 | 250 |
| 207 | 3300013307 | Ga0157372_10064318 | Ga0157372_100643182 | 250 |
| 208 | 3300013307 | Ga0157372_10269600 | Ga0157372_102696002 | 250 |
| 209 | 3300014325 | Ga0163163_10119813 | Ga0163163_101198133 | 250 |
| 210 | 3300014326 | Ga0157380_10184744 | Ga0157380_101847442 | 250 |
| 211 | 3300014968 | Ga0157379_10841015 | Ga0157379_108410151 | 250 |
| 212 | 3300014969 | Ga0157376_10239027 | Ga0157376_102390271 | 250 |
| 213 | 3300020069 | Ga0197907_10667738 | Ga0197907_106677382 | 250 |
| 214 | 3300020070 | Ga0206356_11294997 | Ga0206356_112949971 | 250 |
| 215 | 3300025297 | Ga0209758_1013291 | Ga0209758_10132913 | 250 |
| 216 | 3300025901 | Ga0207688_10229107 | Ga0207688_102291072 | 250 |
| 217 | 3300025904 | Ga0207647_10066711 | Ga0207647_100667112 | 250 |
| 218 | 3300025906 | Ga0207699_10004205 | Ga0207699_100042052 | 250 |
| 219 | 3300025906 | Ga0207699_10038737 | Ga0207699_100387372 | 250 |
| 220 | 3300025908 | Ga0207643_10278448 | Ga0207643_102784481 | 250 |
| 221 | 3300025909 | Ga0207705_10222000 | Ga0207705_102220002 | 250 |
| 222 | 3300025909 | Ga0207705_10356611 | Ga0207705_103566111 | 250 |
| 223 | 3300025910 | Ga0207684_10384362 | Ga0207684_103843622 | 250 |
| 224 | 3300025911 | Ga0207654_10018086 | Ga0207654_100180863 | 250 |
| 225 | 3300025911 | Ga0207654_10073648 | Ga0207654_100736482 | 250 |
| 226 | 3300025912 | Ga0207707_10019838 | Ga0207707_100198383 | 250 |
| 227 | 3300025912 | Ga0207707_10041569 | Ga0207707_100415692 | 250 |
| 228 | 3300025912 | Ga0207707_10068350 | Ga0207707_100683503 | 250 |
| 229 | 3300025912 | Ga0207707_10358755 | Ga0207707_103587552 | 250 |
| 230 | 3300025913 | Ga0207695_10008320 | Ga0207695_100083205 | 250 |
| 231 | 3300025913 | Ga0207695_10357522 | Ga0207695_103575222 | 250 |
| 232 | 3300025914 | Ga0207671_10054890 | Ga0207671_100548902 | 250 |
| 233 | 3300025914 | Ga0207671_10075321 | Ga0207671_100753212 | 250 |
| 234 | 3300025914 | Ga0207671_10510624 | Ga0207671_105106242 | 250 |
| 235 | 3300025915 | Ga0207693_10007680 | Ga0207693_100076805 | 250 |
| 236 | 3300025915 | Ga0207693_10052813 | Ga0207693_100528132 | 250 |
| 237 | 3300025915 | Ga0207693_10138319 | Ga0207693_101383192 | 250 |
| 238 | 3300025916 | Ga0207663_10028682 | Ga0207663_100286823 | 250 |
| 239 | 3300025916 | Ga0207663_10032477 | Ga0207663_100324772 | 250 |
| 240 | 3300025916 | Ga0207663_10052103 | Ga0207663_100521032 | 250 |
| 241 | 3300025917 | Ga0207660_10028670 | Ga0207660_100286702 | 250 |
| 242 | 3300025917 | Ga0207660_10101014 | Ga0207660_101010141 | 250 |
| 243 | 3300025920 | Ga0207649_10160598 | Ga0207649_101605982 | 250 |
| 244 | 3300025921 | Ga0207652_10015328 | Ga0207652_100153284 | 250 |
| 245 | 3300025921 | Ga0207652_10063844 | Ga0207652_100638443 | 250 |
| 246 | 3300025921 | Ga0207652_10312105 | Ga0207652_103121052 | 250 |
| 247 | 3300025924 | Ga0207694_10276315 | Ga0207694_102763152 | 250 |
| 248 | 3300025928 | Ga0207700_10088173 | Ga0207700_100881732 | 250 |
| 249 | 3300025928 | Ga0207700_10208068 | Ga0207700_102080682 | 250 |
| 250 | 3300025928 | Ga0207700_10210866 | Ga0207700_102108662 | 250 |
| 251 | 3300025929 | Ga0207664_10103546 | Ga0207664_101035462 | 250 |
| 252 | 3300025932 | Ga0207690_10162193 | Ga0207690_101621932 | 250 |
| 253 | 3300025935 | Ga0207709_10080289 | Ga0207709_100802892 | 250 |
| 254 | 3300025937 | Ga0207669_10093036 | Ga0207669_100930362 | 250 |
| 255 | 3300025938 | Ga0207704_10626071 | Ga0207704_106260711 | 250 |
| 256 | 3300025939 | Ga0207665_10011500 | Ga0207665_100115004 | 250 |
| 257 | 3300025941 | Ga0207711_10035426 | Ga0207711_100354262 | 250 |
| 258 | 3300025941 | Ga0207711_10061683 | Ga0207711_100616833 | 250 |
| 259 | 3300025941 | Ga0207711_10096005 | Ga0207711_100960052 | 250 |
| 260 | 3300025942 | Ga0207689_10023974 | Ga0207689_100239742 | 250 |
| 261 | 3300025944 | Ga0207661_10001465 | Ga0207661_1000146514 | 250 |
| 262 | 3300025944 | Ga0207661_10009855 | Ga0207661_100098552 | 250 |
| 263 | 3300025945 | Ga0207679_10360257 | Ga0207679_103602572 | 250 |
| 264 | 3300025945 | Ga0207679_10367004 | Ga0207679_103670042 | 250 |
| 265 | 3300025949 | Ga0207667_10019496 | Ga0207667_100194965 | 250 |
| 266 | 3300025949 | Ga0207667_10043499 | Ga0207667_100434993 | 250 |
| 267 | 3300025949 | Ga0207667_10166219 | Ga0207667_101662192 | 250 |
| 268 | 3300025949 | Ga0207667_10181419 | Ga0207667_101814192 | 250 |
| 269 | 3300025949 | Ga0207667_10239986 | Ga0207667_102399862 | 250 |
| 270 | 3300025949 | Ga0207667_10666908 | Ga0207667_106669082 | 250 |
| 271 | 3300025960 | Ga0207651_10163488 | Ga0207651_101634882 | 250 |
| 272 | 3300025972 | Ga0207668_10025704 | Ga0207668_100257042 | 250 |
| 273 | 3300025972 | Ga0207668_10240451 | Ga0207668_102404512 | 250 |
| 274 | 3300025981 | Ga0207640_10065470 | Ga0207640_100654702 | 250 |
| 275 | 3300026023 | Ga0207677_10011829 | Ga0207677_100118292 | 250 |
| 276 | 3300026035 | Ga0207703_10090391 | Ga0207703_100903912 | 250 |
| 277 | 3300026035 | Ga0207703_10170023 | Ga0207703_101700232 | 250 |
| 278 | 3300026041 | Ga0207639_10229540 | Ga0207639_102295402 | 250 |
| 279 | 3300026041 | Ga0207639_10620392 | Ga0207639_106203922 | 250 |
| 280 | 3300026067 | Ga0207678_10095924 | Ga0207678_100959242 | 250 |
| 281 | 3300026067 | Ga0207678_10263657 | Ga0207678_102636572 | 250 |
| 282 | 3300026078 | Ga0207702_10484960 | Ga0207702_104849601 | 250 |
| 283 | 3300026088 | Ga0207641_10264292 | Ga0207641_102642922 | 250 |
| 284 | 3300026095 | Ga0207676_10140885 | Ga0207676_101408852 | 250 |
| 285 | 3300026095 | Ga0207676_10208656 | Ga0207676_102086562 | 250 |
| 286 | 3300026095 | Ga0207676_10498704 | Ga0207676_104987042 | 250 |
| 287 | 3300026116 | Ga0207674_10499548 | Ga0207674_104995483 | 250 |
| 288 | 3300026118 | Ga0207675_100359519 | Ga0207675_1003595192 | 250 |
| 289 | 3300026121 | Ga0207683_10035128 | Ga0207683_100351282 | 250 |
| 290 | 3300028379 | Ga0268266_10046149 | Ga0268266_100461493 | 250 |
| 291 | 3300028379 | Ga0268266_10050503 | Ga0268266_100505032 | 250 |
| 292 | 3300028379 | Ga0268266_10186220 | Ga0268266_101862202 | 250 |
| 293 | 3300028379 | Ga0268266_10228854 | Ga0268266_102288542 | 250 |
| 294 | 3300028381 | Ga0268264_10228891 | Ga0268264_102288911 | 250 |
| 295 | 3300028786 | Ga0307517_10000154 | Ga0307517_1000015499 | 250 |
| 296 | 3300028794 | Ga0307515_10036737 | Ga0307515_100367377 | 250 |
| 297 | 3300031235 | Ga0265330_10061320 | Ga0265330_100613202 | 250 |
| 298 | 3300031238 | Ga0265332_10047772 | Ga0265332_100477722 | 250 |
| 299 | 3300031247 | Ga0265340_10082669 | Ga0265340_100826692 | 250 |
| 300 | 3300031250 | Ga0265331_10060441 | Ga0265331_100604412 | 250 |
| 301 | 3300031344 | Ga0265316_10075616 | Ga0265316_100756162 | 250 |
| 302 | 3300031344 | Ga0265316_10393497 | Ga0265316_103934971 | 250 |
| 303 | 3300031616 | Ga0307508_10212401 | Ga0307508_102124012 | 250 |
| 304 | 3300031616 | Ga0307508_10460471 | Ga0307508_104604711 | 250 |
| 305 | 3300031711 | Ga0265314_10038869 | Ga0265314_100388692 | 250 |
| 306 | 3300031711 | Ga0265314_10111845 | Ga0265314_101118452 | 250 |
| 307 | 3300031712 | Ga0265342_10051298 | Ga0265342_100512982 | 250 |
| 308 | 3300031730 | Ga0307516_10007782 | Ga0307516_100077826 | 250 |
| 309 | 3300031730 | Ga0307516_10008726 | Ga0307516_100087262 | 250 |
| 310 | 3300031731 | Ga0307405_10406119 | Ga0307405_104061192 | 250 |
| 311 | 3300033180 | Ga0307510_10245848 | Ga0307510_102458482 | 250 |
| 312 | 3300033180 | Ga0307510_10275773 | Ga0307510_102757732 | 250 |
| 313 | 3300034816 | Ga0373930_0002341 | Ga0373930_0002341_1490_2242 | 250 |
| 314 | 3300035083 | Ga0373926_0013206 | Ga0373926_0013206_292_1044 | 250 |
| 315 | 3300035086 | Ga0373934_0076916 | Ga0373934_0076916_505_1257 | 250 |
| 316 | 3300035111 | Ga0373923_0061352 | Ga0373923_0061352_292_1050 | 250 |
| 317 | 3300035112 | Ga0373932_0016942 | Ga0373932_0016942_231_983 | 250 |
| 318 | 3300035113 | Ga0373936_0035500 | Ga0373936_0035500_161_913 | 250 |
| 319 | 3300035115 | Ga0373941_0059000 | Ga0373941_0059000_408_1160 | 250 |
| 320 | 3300035116 | Ga0373945_0155197 | Ga0373945_0155197_118_870 | 250 |
| 321 | 3300035117 | Ga0373953_0047064 | Ga0373953_0047064_866_1624 | 250 |
| 322 | 3300035118 | Ga0373954_0047695 | Ga0373954_0047695_1198_1956 | 250 |
| 323 | 3300035120 | Ga0373957_0039832 | Ga0373957_0039832_252_1004 | 250 |
| 324 | 3300035120 | Ga0373957_0122260 | Ga0373957_0122260_84_842 | 250 |
| 325 | 3300035172 | Ga0373955_0007865 | Ga0373955_0007865_3812_4564 | 250 |
| 326 | 3300035207 | Ga0373942_0078443 | Ga0373942_0078443_116_868 | 250 |
| 327 | 3300035691 | Ga0373931_0007186 | Ga0373931_0007186_861_1613 | 250 |
| 328 | 3300035692 | Ga0373935_0328345 | Ga0373935_0328345_310_1062 | 250 |
| 329 | 3300035695 | Ga0373927_0016529 | Ga0373927_0016529_13_765 | 250 |
| 330 | 3300035695 | Ga0373927_0020797 | Ga0373927_0020797_718_1476 | 250 |
| 331 | 3300035695 | Ga0373927_0028531 | Ga0373927_0028531_1930_2682 | 250 |
| 332 | 3300035724 | Ga0373933_0206407 | Ga0373933_0206407_330_1088 | 250 |
| 333 | 3300035724 | Ga0373933_0324662 | Ga0373933_0324662_227_979 | 250 |
| 334 | 3300035725 | Ga0373947_0023737 | Ga0373947_0023737_1688_2440 | 250 |
| 335 | 3300036401 | Ga0373937_0198526 | Ga0373937_0198526_87_839 | 250 |
| 336 | 3300036401 | Ga0373937_0388262 | Ga0373937_0388262_379_1137 | 250 |
| 337 | 3300036459 | Ga0372808_001404 | Ga0372808_001404_80_838 | 250 |
| 338 | 3300037068 | Ga0373925_0019916 | Ga0373925_0019916_1786_2541 | 250 |
| 339 | 3300037068 | Ga0373925_0670843 | Ga0373925_0670843_20_772 | 250 |
| 340 | 3300037418 | Ga0395900_0026123 | Ga0395900_0026123_3616_4368 | 250 |
| 341 | 3300037466 | Ga0395898_0330053 | Ga0395898_0330053_593_1345 | 250 |
| 342 | 3300038443 | Ga0395901_0090872 | Ga0395901_0090872_1905_2657 | 250 |
| 343 | 3300039437 | Ga0436365_0135853 | Ga0436365_0135853_2784_3536 | 250 |
| 344 | 3300039438 | Ga0436360_0436674 | Ga0436360_0436674_129_884 | 250 |
| 345 | 3300041460 | Ga0451802_0112925 | Ga0451802_0112925_89_841 | 250 |
| 346 | 3300044694 | Ga0466963_0048484 | Ga0466963_0048484_217_969 | 250 |
| 347 | 3300045049 | Ga0466959_0149198 | Ga0466959_0149198_704_1456 | 250 |
| 348 | 3300046454 | Ga0495592_0046391 | Ga0495592_0046391_473_1225 | 250 |
| 349 | 3300046457 | Ga0495590_0121312 | Ga0495590_0121312_29_781 | 250 |
| 350 | 3300046459 | Ga0495629_0023858 | Ga0495629_0023858_2507_3259 | 250 |
| 351 | 3300046459 | Ga0495629_0027496 | Ga0495629_0027496_1434_2192 | 250 |
| 352 | 3300046461 | Ga0495641_0020021 | Ga0495641_0020021_799_1557 | 250 |
| 353 | 3300046472 | Ga0495580_0017778 | Ga0495580_0017778_1415_2167 | 250 |
| 354 | 3300046476 | Ga0495662_0073159 | Ga0495662_0073159_720_1472 | 250 |
| 355 | 3300046477 | Ga0495664_0045132 | Ga0495664_0045132_76_828 | 250 |
| 356 | 3300046477 | Ga0495664_0141626 | Ga0495664_0141626_35_793 | 250 |
| 357 | 3300046501 | Ga0495607_0036558 | Ga0495607_0036558_2123_2875 | 250 |
| 358 | 3300046506 | Ga0495583_0025401 | Ga0495583_0025401_422_1174 | 250 |
| 359 | 3300046513 | Ga0495616_0146390 | Ga0495616_0146390_237_989 | 250 |
| 360 | 3300046516 | Ga0495628_0029001 | Ga0495628_0029001_616_1374 | 250 |
| 361 | 3300046518 | Ga0495631_0021074 | Ga0495631_0021074_1781_2533 | 250 |
| 362 | 3300046519 | Ga0495632_0025587 | Ga0495632_0025587_1192_1944 | 250 |
| 363 | 3300046522 | Ga0495643_0152587 | Ga0495643_0152587_247_999 | 250 |
| 364 | 3300046529 | Ga0495652_0380248 | Ga0495652_0380248_130_882 | 250 |
| 365 | 3300046533 | Ga0495640_0065295 | Ga0495640_0065295_1252_2004 | 250 |
| 366 | 3300046533 | Ga0495640_0091758 | Ga0495640_0091758_427_1185 | 250 |
| 367 | 3300046543 | Ga0495645_0003561 | Ga0495645_0003561_3682_4434 | 250 |
| 368 | 3300046543 | Ga0495645_0143771 | Ga0495645_0143771_33_791 | 250 |
| 369 | 3300046543 | Ga0495645_0379922 | Ga0495645_0379922_44_802 | 250 |
| 370 | 3300046557 | Ga0495622_0073498 | Ga0495622_0073498_657_1415 | 250 |
| 371 | 3300046615 | Ga0495656_0010761 | Ga0495656_0010761_1689_2441 | 250 |
| 372 | 3300046642 | Ga0495634_0031212 | Ga0495634_0031212_2494_3252 | 250 |
| 373 | 3300046642 | Ga0495634_0294408 | Ga0495634_0294408_85_843 | 250 |
| 374 | 3300046660 | Ga0495625_0038784 | Ga0495625_0038784_2282_3034 | 250 |
| 375 | 3300046660 | Ga0495625_0140576 | Ga0495625_0140576_692_1444 | 250 |
| 376 | 3300046663 | Ga0495635_0262222 | Ga0495635_0262222_227_979 | 250 |
| 377 | 3300046664 | Ga0495659_0020696 | Ga0495659_0020696_231_983 | 250 |
| 378 | 3300046665 | Ga0495661_0041983 | Ga0495661_0041983_1263_2015 | 250 |
| 379 | 3300046678 | Ga0495599_0056761 | Ga0495599_0056761_864_1622 | 250 |
| 380 | 3300046678 | Ga0495599_0074692 | Ga0495599_0074692_869_1627 | 250 |
| 381 | 3300046680 | Ga0495646_0047859 | Ga0495646_0047859_1515_2273 | 250 |
| 382 | 3300046680 | Ga0495646_0055337 | Ga0495646_0055337_954_1706 | 250 |
| 383 | 3300046681 | Ga0495647_0032540 | Ga0495647_0032540_380_1132 | 250 |
| 384 | 3300046683 | Ga0495658_0114857 | Ga0495658_0114857_597_1355 | 250 |
| 385 | 3300046684 | Ga0495669_0124770 | Ga0495669_0124770_223_975 | 250 |
| 386 | 3300046690 | Ga0495624_0154825 | Ga0495624_0154825_20_772 | 250 |
| 387 | 3300046691 | Ga0495670_0088005 | Ga0495670_0088005_605_1357 | 250 |
| 388 | 3300046809 | Ga0495600_0257235 | Ga0495600_0257235_124_882 | 250 |
| 389 | 3300047315 | Ga0495581_0013922 | Ga0495581_0013922_2353_3105 | 250 |
| 390 | 3300047315 | Ga0495581_0149330 | Ga0495581_0149330_443_1201 | 250 |
| 391 | 3300047319 | Ga0495674_0062697 | Ga0495674_0062697_1455_2213 | 250 |
| 392 | 3300047319 | Ga0495674_0068177 | Ga0495674_0068177_61_813 | 250 |
| 393 | 3300047323 | Ga0495683_0036005 | Ga0495683_0036005_1298_2050 | 250 |
| 394 | 3300047444 | Ga0495675_0021540 | Ga0495675_0021540_1164_1916 | 250 |
| 395 | 3300047444 | Ga0495675_0087015 | Ga0495675_0087015_177_935 | 250 |
| 396 | 3300047445 | Ga0495677_0033687 | Ga0495677_0033687_810_1562 | 250 |
| 397 | 3300047469 | Ga0495673_0013160 | Ga0495673_0013160_369_1127 | 250 |
| 398 | 3300047673 | Ga0495593_0044491 | Ga0495593_0044491_211_969 | 250 |
| 399 | 3300048903 | Ga0496100_0033288 | Ga0496100_0033288_1728_2480 | 250 |
| 400 | 3300048904 | Ga0496101_0011026 | Ga0496101_0011026_3731_4483 | 250 |
| 401 | 3300048905 | Ga0496102_0102803 | Ga0496102_0102803_1002_1757 | 250 |
| 402 | 3300048905 | Ga0496102_0704891 | Ga0496102_0704891_87_839 | 250 |
| 403 | 3300048907 | Ga0496104_0055614 | Ga0496104_0055614_84_836 | 250 |
| 404 | 3300048907 | Ga0496104_0291686 | Ga0496104_0291686_295_1047 | 250 |
| 405 | 3300048908 | Ga0496105_0018871 | Ga0496105_0018871_4408_5160 | 250 |
| 406 | 3300048909 | Ga0496106_0019033 | Ga0496106_0019033_1040_1792 | 250 |
| 407 | 3300048909 | Ga0496106_0027689 | Ga0496106_0027689_2243_2995 | 250 |
| 408 | 3300048910 | Ga0496107_0006065 | Ga0496107_0006065_1656_2408 | 250 |
| 409 | 3300048910 | Ga0496107_0223004 | Ga0496107_0223004_453_1205 | 250 |
| 410 | 3300048910 | Ga0496107_0301569 | Ga0496107_0301569_244_996 | 250 |
| 411 | 3300048911 | Ga0496108_0176029 | Ga0496108_0176029_286_1038 | 250 |
| 412 | 3300048911 | Ga0496108_0202399 | Ga0496108_0202399_521_1273 | 250 |
| 413 | 3300048912 | Ga0496109_0070335 | Ga0496109_0070335_1038_1790 | 250 |
| 414 | 3300048912 | Ga0496109_0238269 | Ga0496109_0238269_83_835 | 250 |
| 415 | 3300048912 | Ga0496109_0619550 | Ga0496109_0619550_43_795 | 250 |
| 416 | 3300048913 | Ga0496110_0029809 | Ga0496110_0029809_3457_4209 | 250 |
| 417 | 3300048914 | Ga0496111_0029598 | Ga0496111_0029598_2429_3181 | 250 |
| 418 | 3300048915 | Ga0496112_0025979 | Ga0496112_0025979_4800_5552 | 250 |
| 419 | 3300048915 | Ga0496112_0028286 | Ga0496112_0028286_1084_1836 | 250 |
| 420 | 3300048916 | Ga0496113_0024832 | Ga0496113_0024832_3437_4189 | 250 |
| 421 | 3300048917 | Ga0496114_0021110 | Ga0496114_0021110_3706_4458 | 250 |
| 422 | 3300048918 | Ga0496115_0008011 | Ga0496115_0008011_3904_4656 | 250 |
| 423 | 3300048918 | Ga0496115_0229190 | Ga0496115_0229190_342_1100 | 250 |
| 424 | 3300048924 | Ga0496121_0013310 | Ga0496121_0013310_4253_5005 | 250 |
| 425 | 3300048924 | Ga0496121_0072127 | Ga0496121_0072127_409_1161 | 250 |
| 426 | 3300048924 | Ga0496121_0148254 | Ga0496121_0148254_755_1507 | 250 |
| 427 | 3300048924 | Ga0496121_0229000 | Ga0496121_0229000_420_1172 | 250 |
| 428 | 3300048928 | Ga0496125_0225369 | Ga0496125_0225369_406_1158 | 250 |
| 429 | 3300048929 | Ga0496126_0063831 | Ga0496126_0063831_831_1583 | 250 |
| 430 | 3300048929 | Ga0496126_0266313 | Ga0496126_0266313_453_1205 | 250 |
| 431 | 3300048929 | Ga0496126_0357016 | Ga0496126_0357016_127_879 | 250 |
| 432 | 3300048929 | Ga0496126_0619805 | Ga0496126_0619805_19_771 | 250 |
| 433 | 3300049583 | Ga0501067_0128479 | Ga0501067_0128479_635_1387 | 250 |
| 434 | 3300049585 | Ga0501069_0219373 | Ga0501069_0219373_281_1033 | 250 |
| 435 | 3300050490 | nmdc:mga03n38_184004_c1 | nmdc:mga03n38_184004_c1_107_859 | 250 |
| 436 | 3300050491 | nmdc:mga00v17_187424_c1 | nmdc:mga00v17_187424_c1_50_802 | 250 |
| 437 | 3300050494 | nmdc:mga06z11_173608_c1 | nmdc:mga06z11_173608_c1_443_1195 | 250 |
| 438 | 3300050512 | nmdc:mga0n895_255982_c1 | nmdc:mga0n895_255982_c1_460_1212 | 250 |
| 439 | 3300050513 | nmdc:mga0rr50_607051_c1 | nmdc:mga0rr50_607051_c1_142_894 | 250 |
| 440 | 3300053077 | Ga0495601_0365103 | Ga0495601_0365103_46_798 | 250 |
| 441 | 3300053078 | Ga0495612_0025063 | Ga0495612_0025063_1542_2294 | 250 |
| 442 | 3300053084 | Ga0495595_0027024 | Ga0495595_0027024_750_1502 | 250 |
| 443 | 3300053085 | Ga0495619_0248149 | Ga0495619_0248149_399_1151 | 250 |
| 444 | 3300053094 | Ga0500566_0057021 | Ga0500566_0057021_962_1714 | 250 |
| 445 | 3300053119 | Ga0500595_000467 | Ga0500595_000467_5810_6562 | 250 |
| 446 | 3300053119 | Ga0500595_012155 | Ga0500595_012155_311_1063 | 250 |
| 447 | 3300053156 | Ga0500622_0080620 | Ga0500622_0080620_802_1554 | 250 |
| 448 | 3300053177 | Ga0500636_0030549 | Ga0500636_0030549_306_1064 | 250 |
| 449 | 3300053178 | Ga0500637_0001547 | Ga0500637_0001547_8740_9492 | 250 |
| 450 | 3300055283 | Ga0500661_000043 | Ga0500661_000043_1086_1838 | 250 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3edm-assembly1.cif.gz_D | crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens | 0.9455 | 4 | 245 |
| 2ehd-assembly1.cif.gz_A | crystal structure analysis of oxidoreductase | 0.9442 | 7 | 240 |
| 1gz6-assembly1.cif.gz_B | (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 | 0.9434 | 5 | 241 |
| 2ehd-assembly1.cif.gz_B | crystal structure analysis of oxidoreductase | 0.9395 | 7 | 241 |
| 3edm-assembly1.cif.gz_D | crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens | 0.9369 | 4 | 245 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6PKH6_18_219_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9604 | 5 | 186 | 3.40.50.720 |
| af_A0A0P0Y501_3_211_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9593 | 5 | 188 | 3.40.50.720 |
| af_A0A0P0X9U1_21_128_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9593 | 3 | 95 | 3.40.50.720 |
| af_Q54N15_5_159_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9552 | 65 | 181 | 3.40.50.720 |
| af_Q0JDN0_53_323_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9521 | 8 | 189 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C4SFP5-F1-model_v4 | SDR family oxidoreductase | 0.9772 | 5 | 187 |
GO:0016616
GO:0030497 |
| AF-X1KF86-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] reductase | 0.9752 | 4 | 188 |
GO:0016616
GO:0030497 |
| AF-A0A3N5NQ50-F1-model_v4 | SDR family oxidoreductase | 0.9731 | 1 | 188 |
GO:0006633
GO:0016616 GO:0048038 |
| AF-A0A7C4DJX8-F1-model_v4 | SDR family oxidoreductase | 0.9712 | 1 | 188 |
|
| AF-A0A384AZA9-F1-model_v4 | 3-ketoacyl-[acyl-carrier-protein] reductase beta subunit (Quinone reductase CBR4) | 0.971 | 7 | 184 |
GO:0006633
GO:0016616 GO:0048038 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar