F446558

General Info

Members Datasets Scaffolds Average Seq Length
450 265 442 249

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10031143|Ga0070717_100311432
Length 282
Sequence MAGLVPAIHVLLTREQDVDARHKAGHDAERARMNKELTGKVAIVTGAGRNIGRAIALTLAEAGASILINARSNRTEAEAVAREIEAIGGRALVHIGDVADPKAVQVMADAAALGFSRIDILINNAALRREKPFAEMDYAEWREILDVTLDGAFHCTKACFPALRKSGSGTIVNIGGLSAHTGAKNRAHVVTAKAGIVGFTRALAHDLADDGITVNCVVPGLIGTPRPKDKPQPAHHLTHQTITGERGKPEDVAAAVRFLCSPGARYITGQAIHANGGAYLGS

Samples

Sample ID Description Type Environment
1 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
2 2791355199
3 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
4 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
5 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
6 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
130 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
131 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
132 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
133 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
134 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
138 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
141 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
144 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
145 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
146 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
147 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
149 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
151 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
152 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
153 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
172 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
185 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
191 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
192 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
199 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
200 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
203 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
204 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
205 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
206 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
207 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
217 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
218 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
219 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
220 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
239 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
240 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
241 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
244 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
245 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
246 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
252 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
253 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
255 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
256 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
257 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
258 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
259 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
260 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
261 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
262 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
263 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
264 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
265 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.77
Metatranscriptomes 0.67
Isolates 1.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.56
Nodule 1.11
Rhizoplane 8.67
Rhizosphere 76.44
Stem 0
Stem Tuber 0
Unclassified 8.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100017704 3300005329 Bacteria 6296
2 Ga0070683_100072240 3300005329 Bacteria 3220
3 Ga0070683_100227728 3300005329 Bacteria 1772
4 Ga0068869_100013710 3300005334 Bacteria 5400
5 Ga0070680_100018051 3300005336 Bacteria 5572
6 Ga0070680_100074865 3300005336 Bacteria 2787
7 Ga0070680_100434561 3300005336 Bacteria 1120
8 Ga0070682_100028536 3300005337 Bacteria 3357
9 Ga0068868_100656413 3300005338 Bacteria 934
10 Ga0070689_100060435 3300005340 Bacteria 2946
11 Ga0070661_100210927 3300005344 Bacteria 1487
12 Ga0070671_100050017 3300005355 Bacteria 3477
13 Ga0070667_100642319 3300005367 Bacteria 979
14 Ga0070709_10000656 3300005434 Bacteria 19693
15 Ga0070709_10026466 3300005434 Bacteria 3438
16 Ga0070709_10037540 3300005434 Bacteria 2959
17 Ga0070713_100037254 3300005436 Bacteria 3932
18 Ga0070713_100057938 3300005436 Bacteria 3228
19 Ga0070713_100258406 3300005436 Bacteria 1591
20 Ga0070713_100400361 3300005436 Bacteria 1282
21 Ga0070711_100015425 3300005439 Bacteria 4836
22 Ga0070711_100032536 3300005439 Bacteria 3467
23 Ga0070711_100375956 3300005439 Bacteria 1148
24 Ga0070700_100114163 3300005441 Bacteria 1800
25 Ga0070663_100218055 3300005455 Bacteria 1497
26 Ga0070663_100251993 3300005455 Bacteria 1397
27 Ga0070678_100031273 3300005456 Bacteria 3669
28 Ga0070681_10129509 3300005458 Bacteria 2455
29 Ga0068867_100243368 3300005459 Bacteria 1460
30 Ga0070706_100631380 3300005467 Bacteria 995
31 Ga0070707_100135140 3300005468 Bacteria 2399
32 Ga0070698_100019717 3300005471 Bacteria 7074
33 Ga0070699_100186561 3300005518 Bacteria 1841
34 Ga0070679_100367456 3300005530 Bacteria 1386
35 Ga0070679_100374980 3300005530 Bacteria 1369
36 Ga0070684_100006660 3300005535 Bacteria 8954
37 Ga0070684_100018450 3300005535 Bacteria 5747
38 Ga0070684_100964724 3300005535 Bacteria 800
39 Ga0068853_100144845 3300005539 Bacteria 2134
40 Ga0068853_100168772 3300005539 Bacteria 1979
41 Ga0070693_100246305 3300005547 Bacteria 1183
42 Ga0070693_100354794 3300005547 Bacteria 1005
43 Ga0070665_100076424 3300005548 Bacteria 3355
44 Ga0070665_100087646 3300005548 Bacteria 3118
45 Ga0070665_100091094 3300005548 Bacteria 3055
46 Ga0070665_100530945 3300005548 Bacteria 1188
47 Ga0068855_100028344 3300005563 Bacteria 6698
48 Ga0068855_100092318 3300005563 Bacteria 3491
49 Ga0068855_100138673 3300005563 Bacteria 2774
50 Ga0068855_100380113 3300005563 Bacteria 1551
51 Ga0068855_100693903 3300005563 Bacteria 1090
52 Ga0070664_100193695 3300005564 Bacteria 1812
53 Ga0070664_100321966 3300005564 Bacteria 1401
54 Ga0068857_100109416 3300005577 Bacteria 2483
55 Ga0068854_100047834 3300005578 Bacteria 3049
56 Ga0068854_100857443 3300005578 Bacteria 796
57 Ga0068856_100000066 3300005614 Bacteria 98376
58 Ga0068856_100233157 3300005614 Bacteria 1856
59 Ga0068852_100150373 3300005616 Bacteria 2165
60 Ga0068852_100189606 3300005616 Bacteria 1939
61 Ga0068859_100240230 3300005617 Bacteria 1900
62 Ga0068866_10222858 3300005718 Bacteria 1139
63 Ga0068861_100182326 3300005719 Bacteria 1749
64 Ga0068863_100208246 3300005841 Bacteria 1882
65 Ga0068858_100047608 3300005842 Bacteria 3974
66 Ga0068858_100194716 3300005842 Bacteria 1915
67 Ga0068858_100240386 3300005842 Bacteria 1718
68 Ga0068860_100001582 3300005843 Bacteria 24502
69 Ga0068862_100758566 3300005844 Bacteria 945
70 Ga0081455_10007625 3300005937 Bacteria 11370
71 Ga0081455_10074849 3300005937 Bacteria 2795
72 Ga0081455_10108320 3300005937 Bacteria 2213
73 Ga0081540_1006482 3300005983 Bacteria 8514
74 Ga0081539_10001290 3300005985 Bacteria 44006
75 Ga0081539_10034725 3300005985 Bacteria 3043
76 Ga0070717_10031143 3300006028 Bacteria 4290
77 Ga0075368_10080683 3300006042 Bacteria 1323
78 Ga0075363_100115326 3300006048 Bacteria 1495
79 Ga0075364_10015406 3300006051 Bacteria 4741
80 Ga0075364_10324667 3300006051 Unclassified 1048
81 Ga0070716_100108620 3300006173 Bacteria 1715
82 Ga0070712_100027903 3300006175 Bacteria 3772
83 Ga0075367_10104181 3300006178 Bacteria 1737
84 Ga0075367_10151934 3300006178 Bacteria 1437
85 Ga0075367_10197783 3300006178 Bacteria 1255
86 Ga0075366_10083882 3300006195 Bacteria 1905
87 Ga0097621_100080504 3300006237 Bacteria 2710
88 Ga0097621_100421784 3300006237 Bacteria 1198
89 Ga0075434_100658225 3300006871 Bacteria 1065
90 Ga0097620_100240241 3300006931 Bacteria 1900
91 Ga0105250_10132738 3300009092 Bacteria 1028
92 Ga0105240_10007301 3300009093 Bacteria 16084
93 Ga0105240_10183631 3300009093 Bacteria 2466
94 Ga0105240_10426543 3300009093 Bacteria 1489
95 Ga0105245_10024948 3300009098 Bacteria 5254
96 Ga0105245_10452357 3300009098 Bacteria 1293
97 Ga0105247_10086181 3300009101 Bacteria 1987
98 Ga0105241_10040412 3300009174 Bacteria 3521
99 Ga0105241_10113536 3300009174 Bacteria 2172
100 Ga0105248_10016328 3300009177 Bacteria 8171
101 Ga0105248_10907446 3300009177 Bacteria 995
102 Ga0105237_10185710 3300009545 Bacteria 2079
103 Ga0105238_10068463 3300009551 Bacteria 3551
104 Ga0105238_10507186 3300009551 Bacteria 1208
105 Ga0105249_10736552 3300009553 Bacteria 1047
106 Ga0099796_10067328 3300010159 Bacteria 1284
107 Ga0105239_10028484 3300010375 Bacteria 6142
108 Ga0105239_10075888 3300010375 Bacteria 3696
109 Ga0105239_10361523 3300010375 Bacteria 1639
110 Ga0105246_10026658 3300011119 Bacteria 3779
111 Ga0105246_10029723 3300011119 Bacteria 3601
112 Ga0157370_10034724 3300013104 Bacteria 4907
113 Ga0157369_10004338 3300013105 Bacteria 16741
114 Ga0157369_10025007 3300013105 Bacteria 6633
115 Ga0157369_10126326 3300013105 Bacteria 2711
116 Ga0157369_10311113 3300013105 Bacteria 1638
117 Ga0157369_10490392 3300013105 Bacteria 1271
118 Ga0163162_10175114 3300013306 Bacteria 2271
119 Ga0163162_10298846 3300013306 Bacteria 1742
120 Ga0163162_10499531 3300013306 Bacteria 1347
121 Ga0163162_10708220 3300013306 Bacteria 1128
122 Ga0163162_10863306 3300013306 Bacteria 1020
123 Ga0157372_10064318 3300013307 Bacteria 4116
124 Ga0157372_10269600 3300013307 Bacteria 1978
125 Ga0157375_10113678 3300013308 Bacteria 2808
126 Ga0157375_10440379 3300013308 Bacteria 1469
127 Ga0163163_10099524 3300014325 Bacteria 2929
128 Ga0163163_10119813 3300014325 Bacteria 2665
129 Ga0163163_10363770 3300014325 Bacteria 1503
130 Ga0157380_10184744 3300014326 Bacteria 1835
131 Ga0157379_10841015 3300014968 Bacteria 868
132 Ga0157376_10239027 3300014969 Bacteria 1691
133 Ga0157376_10533737 3300014969 Bacteria 1158
134 Ga0197907_10667738 3300020069 Bacteria 1375
135 Ga0206356_11294997 3300020070 Bacteria 925
136 Ga0213876_10004813 3300021384 Bacteria 7491
137 Ga0209758_1013291 3300025297 Bacteria 4506
138 Ga0207696_1064117 3300025711 Bacteria 1029
139 Ga0207688_10229107 3300025901 Bacteria 1121
140 Ga0207647_10066711 3300025904 Bacteria 2181
141 Ga0207699_10004205 3300025906 Bacteria 6888
142 Ga0207699_10033189 3300025906 Bacteria 2916
143 Ga0207699_10038737 3300025906 Bacteria 2734
144 Ga0207643_10278448 3300025908 Bacteria 1037
145 Ga0207705_10222000 3300025909 Bacteria 1436
146 Ga0207705_10356611 3300025909 Bacteria 1127
147 Ga0207684_10384362 3300025910 Bacteria 1207
148 Ga0207654_10018086 3300025911 Bacteria 3695
149 Ga0207654_10073648 3300025911 Bacteria 2036
150 Ga0207707_10019838 3300025912 Bacteria 5868
151 Ga0207707_10041569 3300025912 Bacteria 4014
152 Ga0207707_10068350 3300025912 Bacteria 3095
153 Ga0207707_10358755 3300025912 Bacteria 1255
154 Ga0207695_10008320 3300025913 Bacteria 13001
155 Ga0207695_10357522 3300025913 Bacteria 1347
156 Ga0207671_10054890 3300025914 Bacteria 2951
157 Ga0207671_10075321 3300025914 Bacteria 2524
158 Ga0207671_10510624 3300025914 Bacteria 958
159 Ga0207693_10007680 3300025915 Bacteria 8858
160 Ga0207693_10052813 3300025915 Bacteria 3188
161 Ga0207693_10138319 3300025915 Bacteria 1915
162 Ga0207663_10001394 3300025916 Bacteria 11216
163 Ga0207663_10028682 3300025916 Bacteria 3261
164 Ga0207663_10032477 3300025916 Bacteria 3099
165 Ga0207663_10052103 3300025916 Bacteria 2551
166 Ga0207660_10028670 3300025917 Bacteria 3809
167 Ga0207660_10101014 3300025917 Bacteria 2154
168 Ga0207649_10160598 3300025920 Bacteria 1557
169 Ga0207652_10015328 3300025921 Bacteria 6224
170 Ga0207652_10063844 3300025921 Bacteria 3185
171 Ga0207652_10312105 3300025921 Bacteria 1419
172 Ga0207694_10276315 3300025924 Bacteria 1379
173 Ga0207700_10088173 3300025928 Bacteria 2442
174 Ga0207700_10208068 3300025928 Bacteria 1652
175 Ga0207700_10210866 3300025928 Bacteria 1642
176 Ga0207664_10103546 3300025929 Bacteria 2355
177 Ga0207664_10549141 3300025929 Bacteria 1036
178 Ga0207690_10162193 3300025932 Bacteria 1667
179 Ga0207709_10080289 3300025935 Bacteria 2100
180 Ga0207669_10093036 3300025937 Bacteria 1969
181 Ga0207704_10626071 3300025938 Bacteria 884
182 Ga0207665_10011500 3300025939 Bacteria 5814
183 Ga0207665_10079606 3300025939 Bacteria 2252
184 Ga0207665_10097119 3300025939 Bacteria 2050
185 Ga0207711_10035426 3300025941 Bacteria 4230
186 Ga0207711_10061683 3300025941 Bacteria 3233
187 Ga0207711_10096005 3300025941 Bacteria 2615
188 Ga0207689_10023974 3300025942 Bacteria 5119
189 Ga0207661_10001465 3300025944 Bacteria 15950
190 Ga0207661_10009855 3300025944 Bacteria 6863
191 Ga0207661_10366441 3300025944 Bacteria 1302
192 Ga0207679_10360257 3300025945 Bacteria 1270
193 Ga0207679_10367004 3300025945 Bacteria 1259
194 Ga0207667_10019496 3300025949 Bacteria 7568
195 Ga0207667_10043499 3300025949 Bacteria 4766
196 Ga0207667_10166219 3300025949 Bacteria 2268
197 Ga0207667_10181419 3300025949 Bacteria 2162
198 Ga0207667_10239986 3300025949 Bacteria 1855
199 Ga0207667_10666908 3300025949 Bacteria 1044
200 Ga0207651_10163488 3300025960 Bacteria 1748
201 Ga0207668_10025704 3300025972 Bacteria 3813
202 Ga0207668_10240451 3300025972 Bacteria 1464
203 Ga0207640_10065470 3300025981 Bacteria 2425
204 Ga0207677_10011829 3300026023 Bacteria 4992
205 Ga0207703_10090391 3300026035 Bacteria 2573
206 Ga0207703_10170023 3300026035 Bacteria 1916
207 Ga0207639_10229540 3300026041 Bacteria 1608
208 Ga0207639_10620392 3300026041 Bacteria 998
209 Ga0207678_10095924 3300026067 Bacteria 2534
210 Ga0207678_10263657 3300026067 Bacteria 1477
211 Ga0207678_10619311 3300026067 Bacteria 950
212 Ga0207702_10000044 3300026078 Bacteria 149419
213 Ga0207702_10484960 3300026078 Bacteria 1203
214 Ga0207641_10264292 3300026088 Bacteria 1612
215 Ga0207676_10140885 3300026095 Bacteria 2064
216 Ga0207676_10208656 3300026095 Bacteria 1732
217 Ga0207676_10498704 3300026095 Bacteria 1156
218 Ga0207674_10499548 3300026116 Bacteria 1175
219 Ga0207675_100359519 3300026118 Bacteria 1428
220 Ga0207683_10035128 3300026121 Bacteria 4360
221 Ga0268266_10046149 3300028379 Bacteria 3730
222 Ga0268266_10050503 3300028379 Bacteria 3568
223 Ga0268266_10186220 3300028379 Bacteria 1893
224 Ga0268266_10228854 3300028379 Bacteria 1712
225 Ga0268264_10000020 3300028381 Bacteria 483593
226 Ga0268264_10228891 3300028381 Bacteria 1716
227 Ga0307517_10000154 3300028786 Bacteria 109811
228 Ga0307515_10036737 3300028794 Bacteria 7911
229 Ga0307511_10186279 3300030521 Bacteria 1107
230 Ga0265330_10061320 3300031235 Bacteria 1636
231 Ga0265332_10047772 3300031238 Bacteria 1842
232 Ga0265340_10082669 3300031247 Bacteria 1510
233 Ga0265331_10060441 3300031250 Bacteria 1790
234 Ga0265316_10075616 3300031344 Bacteria 2590
235 Ga0265316_10393497 3300031344 Bacteria 999
236 Ga0307509_10023576 3300031507 Bacteria 6904
237 Ga0307509_10168081 3300031507 Bacteria 2077
238 Ga0307508_10000058 3300031616 Bacteria 125293
239 Ga0307508_10212401 3300031616 Bacteria 1535
240 Ga0307508_10305212 3300031616 Bacteria 1184
241 Ga0307508_10460471 3300031616 Bacteria 865
242 Ga0265314_10038869 3300031711 Bacteria 3434
243 Ga0265314_10111845 3300031711 Bacteria 1734
244 Ga0265342_10051298 3300031712 Bacteria 2462
245 Ga0307516_10007782 3300031730 Bacteria 12239
246 Ga0307516_10008726 3300031730 Bacteria 11400
247 Ga0307516_10067440 3300031730 Bacteria 3448
248 Ga0307516_10188216 3300031730 Bacteria 1792
249 Ga0307516_10319903 3300031730 Bacteria 1222
250 Ga0307405_10406119 3300031731 Bacteria 1068
251 Ga0307510_10072655 3300033180 Bacteria 3416
252 Ga0307510_10245848 3300033180 Bacteria 1280
253 Ga0307510_10275773 3300033180 Bacteria 1155
254 Ga0373930_0002341 3300034816 Bacteria 2925
255 Ga0373926_0013206 3300035083 Bacteria 2799
256 Ga0373934_0055237 3300035086 Bacteria 1578
257 Ga0373934_0076916 3300035086 Bacteria 1339
258 Ga0373923_0061352 3300035111 Bacteria 1598
259 Ga0373932_0016942 3300035112 Bacteria 1864
260 Ga0373936_0035500 3300035113 Bacteria 1985
261 Ga0373941_0059000 3300035115 Bacteria 1243
262 Ga0373945_0155197 3300035116 Bacteria 930
263 Ga0373953_0047064 3300035117 Bacteria 1734
264 Ga0373953_0055072 3300035117 Bacteria 1614
265 Ga0373954_0028301 3300035118 Bacteria 2576
266 Ga0373954_0047695 3300035118 Bacteria 2005
267 Ga0373957_0039832 3300035120 Bacteria 1764
268 Ga0373957_0122260 3300035120 Bacteria 1054
269 Ga0373955_0007865 3300035172 Bacteria 4918
270 Ga0373942_0078443 3300035207 Bacteria 976
271 Ga0373931_0007186 3300035691 Bacteria 5239
272 Ga0373935_0149943 3300035692 Bacteria 1582
273 Ga0373935_0328345 3300035692 Bacteria 1087
274 Ga0373927_0016529 3300035695 Bacteria 4866
275 Ga0373927_0020797 3300035695 Bacteria 4301
276 Ga0373927_0028531 3300035695 Bacteria 3641
277 Ga0373933_0095995 3300035724 Bacteria 1834
278 Ga0373933_0206407 3300035724 Bacteria 1258
279 Ga0373933_0324662 3300035724 Bacteria 998
280 Ga0373947_0023737 3300035725 Bacteria 3569
281 Ga0373937_0198526 3300036401 Bacteria 1886
282 Ga0373937_0388262 3300036401 Bacteria 1324
283 Ga0373937_0551833 3300036401 Bacteria 1094
284 Ga0372808_001404 3300036459 Bacteria 2489
285 Ga0373925_0019916 3300037068 Bacteria 4881
286 Ga0373925_0033510 3300037068 Bacteria 3785
287 Ga0373925_0670843 3300037068 Bacteria 854
288 Ga0395900_0026123 3300037418 Bacteria 5979
289 Ga0395898_0330053 3300037466 Bacteria 1454
290 Ga0395901_0090872 3300038443 Bacteria 3196
291 Ga0436365_0135853 3300039437 Bacteria 5722
292 Ga0436365_0220203 3300039437 Bacteria 19855
293 Ga0436360_0436674 3300039438 Bacteria 1270
294 Ga0436363_0322966 3300039450 Bacteria 2539
295 Ga0436362_0754627 3300039453 Bacteria 2892
296 Ga0451802_0112925 3300041460 Bacteria 1146
297 Ga0466963_0048484 3300044694 Bacteria 2807
298 Ga0466959_0149198 3300045049 Bacteria 1649
299 Ga0495592_0046391 3300046454 Bacteria 3239
300 Ga0495603_0010109 3300046455 Bacteria 5712
301 Ga0495603_0022058 3300046455 Bacteria 3856
302 Ga0495590_0121312 3300046457 Bacteria 937
303 Ga0495629_0023858 3300046459 Bacteria 4357
304 Ga0495629_0027496 3300046459 Bacteria 4038
305 Ga0495629_0124599 3300046459 Bacteria 1795
306 Ga0495641_0020021 3300046461 Bacteria 3406
307 Ga0495653_0213981 3300046463 Bacteria 1300
308 Ga0495580_0017778 3300046472 Bacteria 5305
309 Ga0495662_0073159 3300046476 Bacteria 1662
310 Ga0495662_0167389 3300046476 Bacteria 1083
311 Ga0495664_0045132 3300046477 Bacteria 2613
312 Ga0495664_0141626 3300046477 Bacteria 1458
313 Ga0495607_0036558 3300046501 Bacteria 2957
314 Ga0495583_0025401 3300046506 Bacteria 2960
315 Ga0495606_0002021 3300046507 Bacteria 24909
316 Ga0495608_0016544 3300046511 Bacteria 5103
317 Ga0495616_0146390 3300046513 Bacteria 1071
318 Ga0495628_0029001 3300046516 Bacteria 4492
319 Ga0495631_0021074 3300046518 Bacteria 3037
320 Ga0495632_0025587 3300046519 Bacteria 3119
321 Ga0495643_0152587 3300046522 Bacteria 1143
322 Ga0495652_0356397 3300046529 Bacteria 1046
323 Ga0495652_0380248 3300046529 Bacteria 1004
324 Ga0495640_0065295 3300046533 Bacteria 2457
325 Ga0495640_0091758 3300046533 Bacteria 2004
326 Ga0495645_0003561 3300046543 Bacteria 10546
327 Ga0495645_0143771 3300046543 Bacteria 1662
328 Ga0495645_0379922 3300046543 Bacteria 904
329 Ga0495622_0073498 3300046557 Bacteria 1577
330 Ga0495667_0110446 3300046559 Bacteria 1776
331 Ga0495656_0010761 3300046615 Bacteria 3336
332 Ga0495634_0031212 3300046642 Bacteria 3671
333 Ga0495634_0294408 3300046642 Bacteria 983
334 Ga0495625_0038784 3300046660 Bacteria 3483
335 Ga0495625_0140576 3300046660 Bacteria 1629
336 Ga0495635_0262222 3300046663 Bacteria 1163
337 Ga0495659_0020696 3300046664 Bacteria 2212
338 Ga0495661_0041983 3300046665 Bacteria 2824
339 Ga0495657_0245803 3300046675 Bacteria 1078
340 Ga0495599_0056761 3300046678 Bacteria 2451
341 Ga0495599_0067903 3300046678 Bacteria 2226
342 Ga0495599_0074692 3300046678 Bacteria 2116
343 Ga0495646_0047859 3300046680 Bacteria 2601
344 Ga0495646_0055337 3300046680 Bacteria 2383
345 Ga0495647_0032540 3300046681 Bacteria 1944
346 Ga0495658_0114857 3300046683 Bacteria 1622
347 Ga0495669_0124770 3300046684 Bacteria 1209
348 Ga0495624_0154825 3300046690 Bacteria 1401
349 Ga0495670_0088005 3300046691 Bacteria 1587
350 Ga0495600_0257235 3300046809 Bacteria 1109
351 Ga0495581_0013922 3300047315 Bacteria 4665
352 Ga0495581_0149330 3300047315 Bacteria 1364
353 Ga0495581_0151763 3300047315 Bacteria 1353
354 Ga0495604_0137864 3300047317 Bacteria 1746
355 Ga0495604_0284952 3300047317 Bacteria 1115
356 Ga0495674_0062697 3300047319 Bacteria 3236
357 Ga0495674_0068177 3300047319 Bacteria 3079
358 Ga0495683_0036005 3300047323 Bacteria 2514
359 Ga0495675_0021540 3300047444 Bacteria 4105
360 Ga0495675_0087015 3300047444 Bacteria 1963
361 Ga0495677_0033687 3300047445 Bacteria 1867
362 Ga0495673_0013160 3300047469 Bacteria 4356
363 Ga0495593_0044491 3300047673 Bacteria 2374
364 Ga0495593_0225221 3300047673 Bacteria 941
365 Ga0495602_0162737 3300048088 Bacteria 1740
366 Ga0496100_0033288 3300048903 Bacteria 3224
367 Ga0496100_0640844 3300048903 Bacteria 827
368 Ga0496101_0011026 3300048904 Bacteria 5986
369 Ga0496102_0023554 3300048905 Bacteria 5471
370 Ga0496102_0102803 3300048905 Bacteria 2657
371 Ga0496102_0704891 3300048905 Bacteria 932
372 Ga0496104_0055614 3300048907 Bacteria 3742
373 Ga0496104_0145925 3300048907 Bacteria 2272
374 Ga0496104_0291686 3300048907 Bacteria 1544
375 Ga0496105_0018871 3300048908 Bacteria 5554
376 Ga0496105_0295565 3300048908 Bacteria 1303
377 Ga0496106_0019033 3300048909 Bacteria 5090
378 Ga0496106_0027689 3300048909 Bacteria 4222
379 Ga0496107_0006065 3300048910 Bacteria 8296
380 Ga0496107_0223004 3300048910 Bacteria 1402
381 Ga0496107_0301569 3300048910 Bacteria 1192
382 Ga0496108_0083747 3300048911 Bacteria 2706
383 Ga0496108_0176029 3300048911 Bacteria 1852
384 Ga0496108_0202399 3300048911 Bacteria 1723
385 Ga0496109_0024212 3300048912 Bacteria 5395
386 Ga0496109_0070335 3300048912 Bacteria 3211
387 Ga0496109_0238269 3300048912 Bacteria 1712
388 Ga0496109_0619550 3300048912 Bacteria 1019
389 Ga0496110_0029809 3300048913 Bacteria 4700
390 Ga0496110_0037649 3300048913 Bacteria 4205
391 Ga0496111_0029598 3300048914 Bacteria 3890
392 Ga0496111_0339467 3300048914 Bacteria 1112
393 Ga0496112_0022578 3300048915 Bacteria 5997
394 Ga0496112_0025979 3300048915 Bacteria 5628
395 Ga0496112_0028286 3300048915 Bacteria 5410
396 Ga0496112_0057555 3300048915 Bacteria 3827
397 Ga0496112_0634344 3300048915 Bacteria 999
398 Ga0496113_0024832 3300048916 Bacteria 4265
399 Ga0496114_0021110 3300048917 Bacteria 5294
400 Ga0496115_0008011 3300048918 Bacteria 7796
401 Ga0496115_0083306 3300048918 Bacteria 2607
402 Ga0496115_0086663 3300048918 Bacteria 2555
403 Ga0496115_0229190 3300048918 Bacteria 1532
404 Ga0496117_0063903 3300048920 Bacteria 2513
405 Ga0496118_0075911 3300048921 Bacteria 2393
406 Ga0496121_0013310 3300048924 Bacteria 8856
407 Ga0496121_0072127 3300048924 Bacteria 2773
408 Ga0496121_0148254 3300048924 Bacteria 1730
409 Ga0496121_0229000 3300048924 Bacteria 1303
410 Ga0496121_0274971 3300048924 Bacteria 1155
411 Ga0496124_0010980 3300048927 Bacteria 9104
412 Ga0496125_0225369 3300048928 Bacteria 1204
413 Ga0496126_0063831 3300048929 Bacteria 3300
414 Ga0496126_0266313 3300048929 Bacteria 1423
415 Ga0496126_0357016 3300048929 Bacteria 1194
416 Ga0496126_0619805 3300048929 Bacteria 850
417 Ga0501067_0128479 3300049583 Bacteria 1410
418 Ga0501069_0219373 3300049585 Bacteria 1105
419 nmdc:mga03n38_184004_c1 3300050490 Bacteria 1072
420 nmdc:mga00v17_187424_c1 3300050491 Bacteria 1335
421 nmdc:mga06z11_173608_c1 3300050494 Bacteria 1239
422 nmdc:mga0n895_255982_c1 3300050512 Bacteria 1776
423 nmdc:mga0rr50_607051_c1 3300050513 Bacteria 933
424 Ga0495601_0365103 3300053077 Bacteria 938
425 Ga0495612_0025063 3300053078 Bacteria 2395
426 Ga0495612_0077235 3300053078 Bacteria 1395
427 Ga0500635_0001632 3300053080 Bacteria 5409
428 Ga0495595_0015365 3300053084 Bacteria 3265
429 Ga0495595_0027024 3300053084 Bacteria 2554
430 Ga0495619_0248149 3300053085 Bacteria 1233
431 Ga0500566_0057021 3300053094 Bacteria 2219
432 Ga0500554_039001 3300053102 Bacteria 1448
433 Ga0500595_000467 3300053119 Bacteria 25049
434 Ga0500595_012155 3300053119 Bacteria 3337
435 Ga0500590_027613 3300053148 Bacteria 2944
436 Ga0500603_000396 3300053150 Bacteria 11416
437 Ga0500622_0080620 3300053156 Bacteria 1630
438 Ga0500636_0030549 3300053177 Bacteria 3187
439 Ga0500637_0001547 3300053178 Bacteria 9816
440 Ga0500637_0002752 3300053178 Bacteria 7889
441 Ga0500637_0202191 3300053178 Bacteria 1130
442 Ga0500661_000043 3300055283 Bacteria 19291

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025916 Ga0207663_10001394 Ga0207663_100013942 225
2 3300025929 Ga0207664_10549141 Ga0207664_105491411 225
3 3300014325 Ga0163163_10363770 Ga0163163_103637702 227
4 3300005614 Ga0068856_100000066 Ga0068856_10000006663 232
5 3300026078 Ga0207702_10000044 Ga0207702_1000004452 232
6 3300048918 Ga0496115_0086663 Ga0496115_0086663_1403_2158 233
7 3300013105 Ga0157369_10311113 Ga0157369_103111132 234
8 3300031507 Ga0307509_10023576 Ga0307509_100235766 234
9 3300031616 Ga0307508_10305212 Ga0307508_103052121 234
10 3300053178 Ga0500637_0202191 Ga0500637_0202191_78_827 234
11 3300025939 Ga0207665_10079606 Ga0207665_100796062 235
12 3300030521 Ga0307511_10186279 Ga0307511_101862791 235
13 3300005436 Ga0070713_100400361 Ga0070713_1004003611 237
14 3300033180 Ga0307510_10072655 Ga0307510_100726552 237
15 3300046455 Ga0495603_0010109 Ga0495603_0010109_1858_2616 237
16 3300046455 Ga0495603_0022058 Ga0495603_0022058_2035_2793 237
17 3300048920 Ga0496117_0063903 Ga0496117_0063903_1615_2364 237
18 3300048921 Ga0496118_0075911 Ga0496118_0075911_1525_2274 237
19 3300048924 Ga0496121_0274971 Ga0496121_0274971_284_1033 237
20 3300048927 Ga0496124_0010980 Ga0496124_0010980_5203_5952 237
21 3300053080 Ga0500635_0001632 Ga0500635_0001632_2578_3336 237
22 3300053102 Ga0500554_039001 Ga0500554_039001_17_775 237
23 3300053150 Ga0500603_000396 Ga0500603_000396_9031_9789 237
24 3300053178 Ga0500637_0002752 Ga0500637_0002752_1918_2676 237
25 iso_pu_bacteria 2904479285 2904482982 237
26 3300047315 Ga0495581_0151763 Ga0495581_0151763_581_1333 238
27 3300048915 Ga0496112_0634344 Ga0496112_0634344_82_846 239
28 3300031616 Ga0307508_10000058 Ga0307508_1000005870 240
29 3300046507 Ga0495606_0002021 Ga0495606_0002021_223_978 240
30 3300005434 Ga0070709_10037540 Ga0070709_100375402 242
31 3300025906 Ga0207699_10033189 Ga0207699_100331892 242
32 3300005843 Ga0068860_100001582 Ga0068860_10000158212 243
33 3300028381 Ga0268264_10000020 Ga0268264_1000002092 243
34 3300037068 Ga0373925_0033510 Ga0373925_0033510_1346_2098 243
35 3300009092 Ga0105250_10132738 Ga0105250_101327381 244
36 3300021384 Ga0213876_10004813 Ga0213876_100048133 244
37 3300025711 Ga0207696_1064117 Ga0207696_10641171 244
38 3300035086 Ga0373934_0055237 Ga0373934_0055237_27_785 244
39 3300035117 Ga0373953_0055072 Ga0373953_0055072_778_1536 244
40 3300035118 Ga0373954_0028301 Ga0373954_0028301_1544_2302 244
41 3300035692 Ga0373935_0149943 Ga0373935_0149943_455_1213 244
42 3300035724 Ga0373933_0095995 Ga0373933_0095995_140_898 244
43 3300036401 Ga0373937_0551833 Ga0373937_0551833_201_959 244
44 3300039437 Ga0436365_0220203 Ga0436365_0220203_7330_8085 244
45 3300039450 Ga0436363_0322966 Ga0436363_0322966_536_1291 244
46 3300039453 Ga0436362_0754627 Ga0436362_0754627_1435_2190 244
47 3300046459 Ga0495629_0124599 Ga0495629_0124599_258_1016 244
48 3300046463 Ga0495653_0213981 Ga0495653_0213981_342_1100 244
49 3300046476 Ga0495662_0167389 Ga0495662_0167389_60_818 244
50 3300046511 Ga0495608_0016544 Ga0495608_0016544_2801_3559 244
51 3300046529 Ga0495652_0356397 Ga0495652_0356397_253_1011 244
52 3300046559 Ga0495667_0110446 Ga0495667_0110446_32_790 244
53 3300046675 Ga0495657_0245803 Ga0495657_0245803_78_836 244
54 3300046678 Ga0495599_0067903 Ga0495599_0067903_523_1281 244
55 3300047317 Ga0495604_0137864 Ga0495604_0137864_747_1505 244
56 3300047673 Ga0495593_0225221 Ga0495593_0225221_48_806 244
57 3300048088 Ga0495602_0162737 Ga0495602_0162737_782_1540 244
58 3300053078 Ga0495612_0077235 Ga0495612_0077235_18_776 244
59 3300053084 Ga0495595_0015365 Ga0495595_0015365_2288_3046 244
60 iso_pu_bacteria 8006994254 8006994486 244
61 iso_pu_bacteria 2513237101 2513693602 246
62 iso_pu_bacteria 2791355199 2793081420 246
63 iso_pu_bacteria 2874604998 2874611463 246
64 iso_pu_bacteria 2889033259 2889042200 246
65 iso_pu_bacteria 2922361189 2922362930 246
66 iso_pu_bacteria 8006964411 8006970180 246
67 3300025939 Ga0207665_10097119 Ga0207665_100971191 247
68 3300048907 Ga0496104_0145925 Ga0496104_0145925_1024_1767 247
69 3300005329 Ga0070683_100227728 Ga0070683_1002277282 248
70 3300005842 Ga0068858_100240386 Ga0068858_1002403862 248
71 3300013308 Ga0157375_10440379 Ga0157375_104403792 248
72 3300014969 Ga0157376_10533737 Ga0157376_105337371 248
73 3300025944 Ga0207661_10366441 Ga0207661_103664412 248
74 3300048905 Ga0496102_0023554 Ga0496102_0023554_3885_4631 248
75 3300048911 Ga0496108_0083747 Ga0496108_0083747_1457_2203 248
76 3300048912 Ga0496109_0024212 Ga0496109_0024212_139_885 248
77 3300048913 Ga0496110_0037649 Ga0496110_0037649_1774_2520 248
78 3300048914 Ga0496111_0339467 Ga0496111_0339467_191_937 248
79 3300048915 Ga0496112_0022578 Ga0496112_0022578_298_1044 248
80 3300048918 Ga0496115_0083306 Ga0496115_0083306_121_867 248
81 3300005535 Ga0070684_100964724 Ga0070684_1009647241 249
82 3300005578 Ga0068854_100857443 Ga0068854_1008574431 249
83 3300010375 Ga0105239_10361523 Ga0105239_103615232 249
84 3300013306 Ga0163162_10863306 Ga0163162_108633061 249
85 3300013308 Ga0157375_10113678 Ga0157375_101136782 249
86 3300014325 Ga0163163_10099524 Ga0163163_100995244 249
87 3300026067 Ga0207678_10619311 Ga0207678_106193111 249
88 3300031507 Ga0307509_10168081 Ga0307509_101680811 249
89 3300031730 Ga0307516_10067440 Ga0307516_100674402 249
90 3300031730 Ga0307516_10188216 Ga0307516_101882162 249
91 3300031730 Ga0307516_10319903 Ga0307516_103199032 249
92 3300047317 Ga0495604_0284952 Ga0495604_0284952_245_994 249
93 3300048903 Ga0496100_0640844 Ga0496100_0640844_68_817 249
94 3300048908 Ga0496105_0295565 Ga0496105_0295565_171_920 249
95 3300048915 Ga0496112_0057555 Ga0496112_0057555_2583_3332 249
96 3300053148 Ga0500590_027613 Ga0500590_027613_1607_2356 249
97 3300005329 Ga0070683_100017704 Ga0070683_1000177043 250
98 3300005329 Ga0070683_100072240 Ga0070683_1000722403 250
99 3300005334 Ga0068869_100013710 Ga0068869_1000137103 250
100 3300005336 Ga0070680_100018051 Ga0070680_1000180511 250
101 3300005336 Ga0070680_100074865 Ga0070680_1000748652 250
102 3300005336 Ga0070680_100434561 Ga0070680_1004345612 250
103 3300005337 Ga0070682_100028536 Ga0070682_1000285362 250
104 3300005338 Ga0068868_100656413 Ga0068868_1006564131 250
105 3300005340 Ga0070689_100060435 Ga0070689_1000604351 250
106 3300005344 Ga0070661_100210927 Ga0070661_1002109272 250
107 3300005355 Ga0070671_100050017 Ga0070671_1000500172 250
108 3300005367 Ga0070667_100642319 Ga0070667_1006423191 250
109 3300005434 Ga0070709_10000656 Ga0070709_1000065613 250
110 3300005434 Ga0070709_10026466 Ga0070709_100264662 250
111 3300005436 Ga0070713_100037254 Ga0070713_1000372542 250
112 3300005436 Ga0070713_100057938 Ga0070713_1000579382 250
113 3300005436 Ga0070713_100258406 Ga0070713_1002584062 250
114 3300005439 Ga0070711_100015425 Ga0070711_1000154252 250
115 3300005439 Ga0070711_100032536 Ga0070711_1000325362 250
116 3300005439 Ga0070711_100375956 Ga0070711_1003759561 250
117 3300005441 Ga0070700_100114163 Ga0070700_1001141632 250
118 3300005455 Ga0070663_100218055 Ga0070663_1002180552 250
119 3300005455 Ga0070663_100251993 Ga0070663_1002519932 250
120 3300005456 Ga0070678_100031273 Ga0070678_1000312732 250
121 3300005458 Ga0070681_10129509 Ga0070681_101295092 250
122 3300005459 Ga0068867_100243368 Ga0068867_1002433682 250
123 3300005467 Ga0070706_100631380 Ga0070706_1006313802 250
124 3300005468 Ga0070707_100135140 Ga0070707_1001351401 250
125 3300005471 Ga0070698_100019717 Ga0070698_1000197176 250
126 3300005518 Ga0070699_100186561 Ga0070699_1001865612 250
127 3300005530 Ga0070679_100367456 Ga0070679_1003674561 250
128 3300005530 Ga0070679_100374980 Ga0070679_1003749802 250
129 3300005535 Ga0070684_100006660 Ga0070684_1000066604 250
130 3300005535 Ga0070684_100018450 Ga0070684_1000184506 250
131 3300005539 Ga0068853_100144845 Ga0068853_1001448451 250
132 3300005539 Ga0068853_100168772 Ga0068853_1001687722 250
133 3300005547 Ga0070693_100246305 Ga0070693_1002463052 250
134 3300005547 Ga0070693_100354794 Ga0070693_1003547941 250
135 3300005548 Ga0070665_100076424 Ga0070665_1000764242 250
136 3300005548 Ga0070665_100087646 Ga0070665_1000876462 250
137 3300005548 Ga0070665_100091094 Ga0070665_1000910942 250
138 3300005548 Ga0070665_100530945 Ga0070665_1005309452 250
139 3300005563 Ga0068855_100028344 Ga0068855_1000283446 250
140 3300005563 Ga0068855_100092318 Ga0068855_1000923183 250
141 3300005563 Ga0068855_100138673 Ga0068855_1001386732 250
142 3300005563 Ga0068855_100380113 Ga0068855_1003801132 250
143 3300005563 Ga0068855_100693903 Ga0068855_1006939031 250
144 3300005564 Ga0070664_100193695 Ga0070664_1001936952 250
145 3300005564 Ga0070664_100321966 Ga0070664_1003219662 250
146 3300005577 Ga0068857_100109416 Ga0068857_1001094162 250
147 3300005578 Ga0068854_100047834 Ga0068854_1000478342 250
148 3300005614 Ga0068856_100233157 Ga0068856_1002331572 250
149 3300005616 Ga0068852_100150373 Ga0068852_1001503732 250
150 3300005616 Ga0068852_100189606 Ga0068852_1001896062 250
151 3300005617 Ga0068859_100240230 Ga0068859_1002402302 250
152 3300005718 Ga0068866_10222858 Ga0068866_102228582 250
153 3300005719 Ga0068861_100182326 Ga0068861_1001823262 250
154 3300005841 Ga0068863_100208246 Ga0068863_1002082462 250
155 3300005842 Ga0068858_100047608 Ga0068858_1000476082 250
156 3300005842 Ga0068858_100194716 Ga0068858_1001947162 250
157 3300005844 Ga0068862_100758566 Ga0068862_1007585661 250
158 3300005937 Ga0081455_10007625 Ga0081455_100076252 250
159 3300005937 Ga0081455_10074849 Ga0081455_100748492 250
160 3300005937 Ga0081455_10108320 Ga0081455_101083202 250
161 3300005983 Ga0081540_1006482 Ga0081540_10064824 250
162 3300005985 Ga0081539_10001290 Ga0081539_1000129045 250
163 3300005985 Ga0081539_10034725 Ga0081539_100347252 250
164 3300006028 Ga0070717_10031143 Ga0070717_100311432 250
165 3300006042 Ga0075368_10080683 Ga0075368_100806832 250
166 3300006048 Ga0075363_100115326 Ga0075363_1001153262 250
167 3300006051 Ga0075364_10015406 Ga0075364_100154062 250
168 3300006051 Ga0075364_10324667 Ga0075364_103246672 250
169 3300006173 Ga0070716_100108620 Ga0070716_1001086202 250
170 3300006175 Ga0070712_100027903 Ga0070712_1000279032 250
171 3300006178 Ga0075367_10104181 Ga0075367_101041812 250
172 3300006178 Ga0075367_10151934 Ga0075367_101519341 250
173 3300006178 Ga0075367_10197783 Ga0075367_101977832 250
174 3300006195 Ga0075366_10083882 Ga0075366_100838822 250
175 3300006237 Ga0097621_100080504 Ga0097621_1000805042 250
176 3300006237 Ga0097621_100421784 Ga0097621_1004217842 250
177 3300006871 Ga0075434_100658225 Ga0075434_1006582252 250
178 3300006931 Ga0097620_100240241 Ga0097620_1002402412 250
179 3300009093 Ga0105240_10007301 Ga0105240_100073015 250
180 3300009093 Ga0105240_10183631 Ga0105240_101836312 250
181 3300009093 Ga0105240_10426543 Ga0105240_104265432 250
182 3300009098 Ga0105245_10024948 Ga0105245_100249484 250
183 3300009098 Ga0105245_10452357 Ga0105245_104523571 250
184 3300009101 Ga0105247_10086181 Ga0105247_100861812 250
185 3300009174 Ga0105241_10040412 Ga0105241_100404122 250
186 3300009174 Ga0105241_10113536 Ga0105241_101135362 250
187 3300009177 Ga0105248_10016328 Ga0105248_100163286 250
188 3300009177 Ga0105248_10907446 Ga0105248_109074462 250
189 3300009545 Ga0105237_10185710 Ga0105237_101857102 250
190 3300009551 Ga0105238_10068463 Ga0105238_100684633 250
191 3300009551 Ga0105238_10507186 Ga0105238_105071861 250
192 3300009553 Ga0105249_10736552 Ga0105249_107365522 250
193 3300010159 Ga0099796_10067328 Ga0099796_100673282 250
194 3300010375 Ga0105239_10028484 Ga0105239_100284846 250
195 3300010375 Ga0105239_10075888 Ga0105239_100758882 250
196 3300011119 Ga0105246_10026658 Ga0105246_100266584 250
197 3300011119 Ga0105246_10029723 Ga0105246_100297232 250
198 3300013104 Ga0157370_10034724 Ga0157370_100347242 250
199 3300013105 Ga0157369_10004338 Ga0157369_1000433811 250
200 3300013105 Ga0157369_10025007 Ga0157369_100250074 250
201 3300013105 Ga0157369_10126326 Ga0157369_101263261 250
202 3300013105 Ga0157369_10490392 Ga0157369_104903922 250
203 3300013306 Ga0163162_10175114 Ga0163162_101751143 250
204 3300013306 Ga0163162_10298846 Ga0163162_102988462 250
205 3300013306 Ga0163162_10499531 Ga0163162_104995312 250
206 3300013306 Ga0163162_10708220 Ga0163162_107082202 250
207 3300013307 Ga0157372_10064318 Ga0157372_100643182 250
208 3300013307 Ga0157372_10269600 Ga0157372_102696002 250
209 3300014325 Ga0163163_10119813 Ga0163163_101198133 250
210 3300014326 Ga0157380_10184744 Ga0157380_101847442 250
211 3300014968 Ga0157379_10841015 Ga0157379_108410151 250
212 3300014969 Ga0157376_10239027 Ga0157376_102390271 250
213 3300020069 Ga0197907_10667738 Ga0197907_106677382 250
214 3300020070 Ga0206356_11294997 Ga0206356_112949971 250
215 3300025297 Ga0209758_1013291 Ga0209758_10132913 250
216 3300025901 Ga0207688_10229107 Ga0207688_102291072 250
217 3300025904 Ga0207647_10066711 Ga0207647_100667112 250
218 3300025906 Ga0207699_10004205 Ga0207699_100042052 250
219 3300025906 Ga0207699_10038737 Ga0207699_100387372 250
220 3300025908 Ga0207643_10278448 Ga0207643_102784481 250
221 3300025909 Ga0207705_10222000 Ga0207705_102220002 250
222 3300025909 Ga0207705_10356611 Ga0207705_103566111 250
223 3300025910 Ga0207684_10384362 Ga0207684_103843622 250
224 3300025911 Ga0207654_10018086 Ga0207654_100180863 250
225 3300025911 Ga0207654_10073648 Ga0207654_100736482 250
226 3300025912 Ga0207707_10019838 Ga0207707_100198383 250
227 3300025912 Ga0207707_10041569 Ga0207707_100415692 250
228 3300025912 Ga0207707_10068350 Ga0207707_100683503 250
229 3300025912 Ga0207707_10358755 Ga0207707_103587552 250
230 3300025913 Ga0207695_10008320 Ga0207695_100083205 250
231 3300025913 Ga0207695_10357522 Ga0207695_103575222 250
232 3300025914 Ga0207671_10054890 Ga0207671_100548902 250
233 3300025914 Ga0207671_10075321 Ga0207671_100753212 250
234 3300025914 Ga0207671_10510624 Ga0207671_105106242 250
235 3300025915 Ga0207693_10007680 Ga0207693_100076805 250
236 3300025915 Ga0207693_10052813 Ga0207693_100528132 250
237 3300025915 Ga0207693_10138319 Ga0207693_101383192 250
238 3300025916 Ga0207663_10028682 Ga0207663_100286823 250
239 3300025916 Ga0207663_10032477 Ga0207663_100324772 250
240 3300025916 Ga0207663_10052103 Ga0207663_100521032 250
241 3300025917 Ga0207660_10028670 Ga0207660_100286702 250
242 3300025917 Ga0207660_10101014 Ga0207660_101010141 250
243 3300025920 Ga0207649_10160598 Ga0207649_101605982 250
244 3300025921 Ga0207652_10015328 Ga0207652_100153284 250
245 3300025921 Ga0207652_10063844 Ga0207652_100638443 250
246 3300025921 Ga0207652_10312105 Ga0207652_103121052 250
247 3300025924 Ga0207694_10276315 Ga0207694_102763152 250
248 3300025928 Ga0207700_10088173 Ga0207700_100881732 250
249 3300025928 Ga0207700_10208068 Ga0207700_102080682 250
250 3300025928 Ga0207700_10210866 Ga0207700_102108662 250
251 3300025929 Ga0207664_10103546 Ga0207664_101035462 250
252 3300025932 Ga0207690_10162193 Ga0207690_101621932 250
253 3300025935 Ga0207709_10080289 Ga0207709_100802892 250
254 3300025937 Ga0207669_10093036 Ga0207669_100930362 250
255 3300025938 Ga0207704_10626071 Ga0207704_106260711 250
256 3300025939 Ga0207665_10011500 Ga0207665_100115004 250
257 3300025941 Ga0207711_10035426 Ga0207711_100354262 250
258 3300025941 Ga0207711_10061683 Ga0207711_100616833 250
259 3300025941 Ga0207711_10096005 Ga0207711_100960052 250
260 3300025942 Ga0207689_10023974 Ga0207689_100239742 250
261 3300025944 Ga0207661_10001465 Ga0207661_1000146514 250
262 3300025944 Ga0207661_10009855 Ga0207661_100098552 250
263 3300025945 Ga0207679_10360257 Ga0207679_103602572 250
264 3300025945 Ga0207679_10367004 Ga0207679_103670042 250
265 3300025949 Ga0207667_10019496 Ga0207667_100194965 250
266 3300025949 Ga0207667_10043499 Ga0207667_100434993 250
267 3300025949 Ga0207667_10166219 Ga0207667_101662192 250
268 3300025949 Ga0207667_10181419 Ga0207667_101814192 250
269 3300025949 Ga0207667_10239986 Ga0207667_102399862 250
270 3300025949 Ga0207667_10666908 Ga0207667_106669082 250
271 3300025960 Ga0207651_10163488 Ga0207651_101634882 250
272 3300025972 Ga0207668_10025704 Ga0207668_100257042 250
273 3300025972 Ga0207668_10240451 Ga0207668_102404512 250
274 3300025981 Ga0207640_10065470 Ga0207640_100654702 250
275 3300026023 Ga0207677_10011829 Ga0207677_100118292 250
276 3300026035 Ga0207703_10090391 Ga0207703_100903912 250
277 3300026035 Ga0207703_10170023 Ga0207703_101700232 250
278 3300026041 Ga0207639_10229540 Ga0207639_102295402 250
279 3300026041 Ga0207639_10620392 Ga0207639_106203922 250
280 3300026067 Ga0207678_10095924 Ga0207678_100959242 250
281 3300026067 Ga0207678_10263657 Ga0207678_102636572 250
282 3300026078 Ga0207702_10484960 Ga0207702_104849601 250
283 3300026088 Ga0207641_10264292 Ga0207641_102642922 250
284 3300026095 Ga0207676_10140885 Ga0207676_101408852 250
285 3300026095 Ga0207676_10208656 Ga0207676_102086562 250
286 3300026095 Ga0207676_10498704 Ga0207676_104987042 250
287 3300026116 Ga0207674_10499548 Ga0207674_104995483 250
288 3300026118 Ga0207675_100359519 Ga0207675_1003595192 250
289 3300026121 Ga0207683_10035128 Ga0207683_100351282 250
290 3300028379 Ga0268266_10046149 Ga0268266_100461493 250
291 3300028379 Ga0268266_10050503 Ga0268266_100505032 250
292 3300028379 Ga0268266_10186220 Ga0268266_101862202 250
293 3300028379 Ga0268266_10228854 Ga0268266_102288542 250
294 3300028381 Ga0268264_10228891 Ga0268264_102288911 250
295 3300028786 Ga0307517_10000154 Ga0307517_1000015499 250
296 3300028794 Ga0307515_10036737 Ga0307515_100367377 250
297 3300031235 Ga0265330_10061320 Ga0265330_100613202 250
298 3300031238 Ga0265332_10047772 Ga0265332_100477722 250
299 3300031247 Ga0265340_10082669 Ga0265340_100826692 250
300 3300031250 Ga0265331_10060441 Ga0265331_100604412 250
301 3300031344 Ga0265316_10075616 Ga0265316_100756162 250
302 3300031344 Ga0265316_10393497 Ga0265316_103934971 250
303 3300031616 Ga0307508_10212401 Ga0307508_102124012 250
304 3300031616 Ga0307508_10460471 Ga0307508_104604711 250
305 3300031711 Ga0265314_10038869 Ga0265314_100388692 250
306 3300031711 Ga0265314_10111845 Ga0265314_101118452 250
307 3300031712 Ga0265342_10051298 Ga0265342_100512982 250
308 3300031730 Ga0307516_10007782 Ga0307516_100077826 250
309 3300031730 Ga0307516_10008726 Ga0307516_100087262 250
310 3300031731 Ga0307405_10406119 Ga0307405_104061192 250
311 3300033180 Ga0307510_10245848 Ga0307510_102458482 250
312 3300033180 Ga0307510_10275773 Ga0307510_102757732 250
313 3300034816 Ga0373930_0002341 Ga0373930_0002341_1490_2242 250
314 3300035083 Ga0373926_0013206 Ga0373926_0013206_292_1044 250
315 3300035086 Ga0373934_0076916 Ga0373934_0076916_505_1257 250
316 3300035111 Ga0373923_0061352 Ga0373923_0061352_292_1050 250
317 3300035112 Ga0373932_0016942 Ga0373932_0016942_231_983 250
318 3300035113 Ga0373936_0035500 Ga0373936_0035500_161_913 250
319 3300035115 Ga0373941_0059000 Ga0373941_0059000_408_1160 250
320 3300035116 Ga0373945_0155197 Ga0373945_0155197_118_870 250
321 3300035117 Ga0373953_0047064 Ga0373953_0047064_866_1624 250
322 3300035118 Ga0373954_0047695 Ga0373954_0047695_1198_1956 250
323 3300035120 Ga0373957_0039832 Ga0373957_0039832_252_1004 250
324 3300035120 Ga0373957_0122260 Ga0373957_0122260_84_842 250
325 3300035172 Ga0373955_0007865 Ga0373955_0007865_3812_4564 250
326 3300035207 Ga0373942_0078443 Ga0373942_0078443_116_868 250
327 3300035691 Ga0373931_0007186 Ga0373931_0007186_861_1613 250
328 3300035692 Ga0373935_0328345 Ga0373935_0328345_310_1062 250
329 3300035695 Ga0373927_0016529 Ga0373927_0016529_13_765 250
330 3300035695 Ga0373927_0020797 Ga0373927_0020797_718_1476 250
331 3300035695 Ga0373927_0028531 Ga0373927_0028531_1930_2682 250
332 3300035724 Ga0373933_0206407 Ga0373933_0206407_330_1088 250
333 3300035724 Ga0373933_0324662 Ga0373933_0324662_227_979 250
334 3300035725 Ga0373947_0023737 Ga0373947_0023737_1688_2440 250
335 3300036401 Ga0373937_0198526 Ga0373937_0198526_87_839 250
336 3300036401 Ga0373937_0388262 Ga0373937_0388262_379_1137 250
337 3300036459 Ga0372808_001404 Ga0372808_001404_80_838 250
338 3300037068 Ga0373925_0019916 Ga0373925_0019916_1786_2541 250
339 3300037068 Ga0373925_0670843 Ga0373925_0670843_20_772 250
340 3300037418 Ga0395900_0026123 Ga0395900_0026123_3616_4368 250
341 3300037466 Ga0395898_0330053 Ga0395898_0330053_593_1345 250
342 3300038443 Ga0395901_0090872 Ga0395901_0090872_1905_2657 250
343 3300039437 Ga0436365_0135853 Ga0436365_0135853_2784_3536 250
344 3300039438 Ga0436360_0436674 Ga0436360_0436674_129_884 250
345 3300041460 Ga0451802_0112925 Ga0451802_0112925_89_841 250
346 3300044694 Ga0466963_0048484 Ga0466963_0048484_217_969 250
347 3300045049 Ga0466959_0149198 Ga0466959_0149198_704_1456 250
348 3300046454 Ga0495592_0046391 Ga0495592_0046391_473_1225 250
349 3300046457 Ga0495590_0121312 Ga0495590_0121312_29_781 250
350 3300046459 Ga0495629_0023858 Ga0495629_0023858_2507_3259 250
351 3300046459 Ga0495629_0027496 Ga0495629_0027496_1434_2192 250
352 3300046461 Ga0495641_0020021 Ga0495641_0020021_799_1557 250
353 3300046472 Ga0495580_0017778 Ga0495580_0017778_1415_2167 250
354 3300046476 Ga0495662_0073159 Ga0495662_0073159_720_1472 250
355 3300046477 Ga0495664_0045132 Ga0495664_0045132_76_828 250
356 3300046477 Ga0495664_0141626 Ga0495664_0141626_35_793 250
357 3300046501 Ga0495607_0036558 Ga0495607_0036558_2123_2875 250
358 3300046506 Ga0495583_0025401 Ga0495583_0025401_422_1174 250
359 3300046513 Ga0495616_0146390 Ga0495616_0146390_237_989 250
360 3300046516 Ga0495628_0029001 Ga0495628_0029001_616_1374 250
361 3300046518 Ga0495631_0021074 Ga0495631_0021074_1781_2533 250
362 3300046519 Ga0495632_0025587 Ga0495632_0025587_1192_1944 250
363 3300046522 Ga0495643_0152587 Ga0495643_0152587_247_999 250
364 3300046529 Ga0495652_0380248 Ga0495652_0380248_130_882 250
365 3300046533 Ga0495640_0065295 Ga0495640_0065295_1252_2004 250
366 3300046533 Ga0495640_0091758 Ga0495640_0091758_427_1185 250
367 3300046543 Ga0495645_0003561 Ga0495645_0003561_3682_4434 250
368 3300046543 Ga0495645_0143771 Ga0495645_0143771_33_791 250
369 3300046543 Ga0495645_0379922 Ga0495645_0379922_44_802 250
370 3300046557 Ga0495622_0073498 Ga0495622_0073498_657_1415 250
371 3300046615 Ga0495656_0010761 Ga0495656_0010761_1689_2441 250
372 3300046642 Ga0495634_0031212 Ga0495634_0031212_2494_3252 250
373 3300046642 Ga0495634_0294408 Ga0495634_0294408_85_843 250
374 3300046660 Ga0495625_0038784 Ga0495625_0038784_2282_3034 250
375 3300046660 Ga0495625_0140576 Ga0495625_0140576_692_1444 250
376 3300046663 Ga0495635_0262222 Ga0495635_0262222_227_979 250
377 3300046664 Ga0495659_0020696 Ga0495659_0020696_231_983 250
378 3300046665 Ga0495661_0041983 Ga0495661_0041983_1263_2015 250
379 3300046678 Ga0495599_0056761 Ga0495599_0056761_864_1622 250
380 3300046678 Ga0495599_0074692 Ga0495599_0074692_869_1627 250
381 3300046680 Ga0495646_0047859 Ga0495646_0047859_1515_2273 250
382 3300046680 Ga0495646_0055337 Ga0495646_0055337_954_1706 250
383 3300046681 Ga0495647_0032540 Ga0495647_0032540_380_1132 250
384 3300046683 Ga0495658_0114857 Ga0495658_0114857_597_1355 250
385 3300046684 Ga0495669_0124770 Ga0495669_0124770_223_975 250
386 3300046690 Ga0495624_0154825 Ga0495624_0154825_20_772 250
387 3300046691 Ga0495670_0088005 Ga0495670_0088005_605_1357 250
388 3300046809 Ga0495600_0257235 Ga0495600_0257235_124_882 250
389 3300047315 Ga0495581_0013922 Ga0495581_0013922_2353_3105 250
390 3300047315 Ga0495581_0149330 Ga0495581_0149330_443_1201 250
391 3300047319 Ga0495674_0062697 Ga0495674_0062697_1455_2213 250
392 3300047319 Ga0495674_0068177 Ga0495674_0068177_61_813 250
393 3300047323 Ga0495683_0036005 Ga0495683_0036005_1298_2050 250
394 3300047444 Ga0495675_0021540 Ga0495675_0021540_1164_1916 250
395 3300047444 Ga0495675_0087015 Ga0495675_0087015_177_935 250
396 3300047445 Ga0495677_0033687 Ga0495677_0033687_810_1562 250
397 3300047469 Ga0495673_0013160 Ga0495673_0013160_369_1127 250
398 3300047673 Ga0495593_0044491 Ga0495593_0044491_211_969 250
399 3300048903 Ga0496100_0033288 Ga0496100_0033288_1728_2480 250
400 3300048904 Ga0496101_0011026 Ga0496101_0011026_3731_4483 250
401 3300048905 Ga0496102_0102803 Ga0496102_0102803_1002_1757 250
402 3300048905 Ga0496102_0704891 Ga0496102_0704891_87_839 250
403 3300048907 Ga0496104_0055614 Ga0496104_0055614_84_836 250
404 3300048907 Ga0496104_0291686 Ga0496104_0291686_295_1047 250
405 3300048908 Ga0496105_0018871 Ga0496105_0018871_4408_5160 250
406 3300048909 Ga0496106_0019033 Ga0496106_0019033_1040_1792 250
407 3300048909 Ga0496106_0027689 Ga0496106_0027689_2243_2995 250
408 3300048910 Ga0496107_0006065 Ga0496107_0006065_1656_2408 250
409 3300048910 Ga0496107_0223004 Ga0496107_0223004_453_1205 250
410 3300048910 Ga0496107_0301569 Ga0496107_0301569_244_996 250
411 3300048911 Ga0496108_0176029 Ga0496108_0176029_286_1038 250
412 3300048911 Ga0496108_0202399 Ga0496108_0202399_521_1273 250
413 3300048912 Ga0496109_0070335 Ga0496109_0070335_1038_1790 250
414 3300048912 Ga0496109_0238269 Ga0496109_0238269_83_835 250
415 3300048912 Ga0496109_0619550 Ga0496109_0619550_43_795 250
416 3300048913 Ga0496110_0029809 Ga0496110_0029809_3457_4209 250
417 3300048914 Ga0496111_0029598 Ga0496111_0029598_2429_3181 250
418 3300048915 Ga0496112_0025979 Ga0496112_0025979_4800_5552 250
419 3300048915 Ga0496112_0028286 Ga0496112_0028286_1084_1836 250
420 3300048916 Ga0496113_0024832 Ga0496113_0024832_3437_4189 250
421 3300048917 Ga0496114_0021110 Ga0496114_0021110_3706_4458 250
422 3300048918 Ga0496115_0008011 Ga0496115_0008011_3904_4656 250
423 3300048918 Ga0496115_0229190 Ga0496115_0229190_342_1100 250
424 3300048924 Ga0496121_0013310 Ga0496121_0013310_4253_5005 250
425 3300048924 Ga0496121_0072127 Ga0496121_0072127_409_1161 250
426 3300048924 Ga0496121_0148254 Ga0496121_0148254_755_1507 250
427 3300048924 Ga0496121_0229000 Ga0496121_0229000_420_1172 250
428 3300048928 Ga0496125_0225369 Ga0496125_0225369_406_1158 250
429 3300048929 Ga0496126_0063831 Ga0496126_0063831_831_1583 250
430 3300048929 Ga0496126_0266313 Ga0496126_0266313_453_1205 250
431 3300048929 Ga0496126_0357016 Ga0496126_0357016_127_879 250
432 3300048929 Ga0496126_0619805 Ga0496126_0619805_19_771 250
433 3300049583 Ga0501067_0128479 Ga0501067_0128479_635_1387 250
434 3300049585 Ga0501069_0219373 Ga0501069_0219373_281_1033 250
435 3300050490 nmdc:mga03n38_184004_c1 nmdc:mga03n38_184004_c1_107_859 250
436 3300050491 nmdc:mga00v17_187424_c1 nmdc:mga00v17_187424_c1_50_802 250
437 3300050494 nmdc:mga06z11_173608_c1 nmdc:mga06z11_173608_c1_443_1195 250
438 3300050512 nmdc:mga0n895_255982_c1 nmdc:mga0n895_255982_c1_460_1212 250
439 3300050513 nmdc:mga0rr50_607051_c1 nmdc:mga0rr50_607051_c1_142_894 250
440 3300053077 Ga0495601_0365103 Ga0495601_0365103_46_798 250
441 3300053078 Ga0495612_0025063 Ga0495612_0025063_1542_2294 250
442 3300053084 Ga0495595_0027024 Ga0495595_0027024_750_1502 250
443 3300053085 Ga0495619_0248149 Ga0495619_0248149_399_1151 250
444 3300053094 Ga0500566_0057021 Ga0500566_0057021_962_1714 250
445 3300053119 Ga0500595_000467 Ga0500595_000467_5810_6562 250
446 3300053119 Ga0500595_012155 Ga0500595_012155_311_1063 250
447 3300053156 Ga0500622_0080620 Ga0500622_0080620_802_1554 250
448 3300053177 Ga0500636_0030549 Ga0500636_0030549_306_1064 250
449 3300053178 Ga0500637_0001547 Ga0500637_0001547_8740_9492 250
450 3300055283 Ga0500661_000043 Ga0500661_000043_1086_1838 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

40

234

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

46

279

0.94

PF08659

KR

KR domain

40

223

0.83

PF23441

33

281

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3edm-assembly1.cif.gz_D crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens 0.9455 4 245
2ehd-assembly1.cif.gz_A crystal structure analysis of oxidoreductase 0.9442 7 240
1gz6-assembly1.cif.gz_B (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 0.9434 5 241
2ehd-assembly1.cif.gz_B crystal structure analysis of oxidoreductase 0.9395 7 241
3edm-assembly1.cif.gz_D crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens 0.9369 4 245
ID Description Score Start End Superfamily
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9604 5 186 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9593 5 188 3.40.50.720
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9593 3 95 3.40.50.720
af_Q54N15_5_159_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9552 65 181 3.40.50.720
af_Q0JDN0_53_323_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9521 8 189 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7C4SFP5-F1-model_v4 SDR family oxidoreductase 0.9772 5 187 GO:0016616
GO:0030497
AF-X1KF86-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase 0.9752 4 188 GO:0016616
GO:0030497
AF-A0A3N5NQ50-F1-model_v4 SDR family oxidoreductase 0.9731 1 188 GO:0006633
GO:0016616
GO:0048038
AF-A0A7C4DJX8-F1-model_v4 SDR family oxidoreductase 0.9712 1 188
AF-A0A384AZA9-F1-model_v4 3-ketoacyl-[acyl-carrier-protein] reductase beta subunit (Quinone reductase CBR4) 0.971 7 184 GO:0006633
GO:0016616
GO:0048038

Feature Viewer

pLDDT pTM Quality
87.87 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map