F446470

General Info

Members Datasets Scaffolds Average Seq Length
449 170 898 310

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0100783|Ga0496100_0100783_683_1630
Length 315
Sequence VITDRRTEFEATLARTAEQRGQEAGAALPRASLFRDAVHRFSRNRGAVAAAISLVILVGYVYITPLISNASAYGLDFGAAYLSPSWAHPFGTDEFGRDLFLRTALGGQVSVEIGLAATFAIMVVGISYGAISGFAGGAIDNGMMRFLDALYGLPYLPFAIITLAIFGPDFPIFWGMVIALTIASWFTTARVMRGQIITLKENDYVRAAHAVGARWYRVLFRHLLPNTLGIIIVFVFLELPGVVLGEAFLSFLGLGINPPKASWGTLAQDGYASYQSHPYLIIVPSLCIAWLILSAFFVADGLRDALDPRSRENFS

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
50 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
94 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
95 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
102 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
103 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
111 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
166 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.55
Metatranscriptomes 2.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 9.58
Rhizosphere 89.98
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0100783 3300048903 Bacteria 1990
2 Ga0070658_10025354 3300005327 Bacteria 4754
3 Ga0070683_100018029 3300005329 Bacteria 6244
4 Ga0070683_100057545 3300005329 Bacteria 3612
5 Ga0070683_100061011 3300005329 Bacteria 3505
6 Ga0070683_100090302 3300005329 Bacteria 2876
7 Ga0070683_100107340 3300005329 Bacteria 2632
8 Ga0070683_100112880 3300005329 Bacteria 2564
9 Ga0070683_100213432 3300005329 Bacteria 1834
10 Ga0070670_100218057 3300005331 Bacteria 1659
11 Ga0068869_100320863 3300005334 Bacteria 1256
12 Ga0070680_100011427 3300005336 Bacteria 6868
13 Ga0070680_100073494 3300005336 Bacteria 2812
14 Ga0070682_100039922 3300005337 Bacteria 2886
15 Ga0070682_100111777 3300005337 Bacteria 1822
16 Ga0070682_100302037 3300005337 Bacteria 1175
17 Ga0068868_100068349 3300005338 Bacteria 2829
18 Ga0070660_100008038 3300005339 Bacteria 7373
19 Ga0070660_100015202 3300005339 Bacteria 5552
20 Ga0070660_100359706 3300005339 Bacteria 1199
21 Ga0070661_100028177 3300005344 Bacteria 4050
22 Ga0070692_10021044 3300005345 Bacteria 3170
23 Ga0070671_100045919 3300005355 Bacteria 3632
24 Ga0070705_100008154 3300005440 Bacteria 5179
25 Ga0070705_100074026 3300005440 Bacteria 2069
26 Ga0070700_100036331 3300005441 Bacteria 2987
27 Ga0070694_100013430 3300005444 Bacteria 5115
28 Ga0070681_10044412 3300005458 Bacteria 4448
29 Ga0070681_10076532 3300005458 Bacteria 3304
30 Ga0070681_10090139 3300005458 Bacteria 3017
31 Ga0070681_10158438 3300005458 Bacteria 2188
32 Ga0070681_10195120 3300005458 Bacteria 1944
33 Ga0070681_10298984 3300005458 Bacteria 1520
34 Ga0070685_10168457 3300005466 Bacteria 1402
35 Ga0070679_100019465 3300005530 Bacteria 6600
36 Ga0070679_100025048 3300005530 Bacteria 5851
37 Ga0070679_100363387 3300005530 Bacteria 1395
38 Ga0070679_100482404 3300005530 Bacteria 1184
39 Ga0070684_100019303 3300005535 Bacteria 5637
40 Ga0070684_100031621 3300005535 Bacteria 4507
41 Ga0070684_100116201 3300005535 Bacteria 2403
42 Ga0070684_100166725 3300005535 Bacteria 2000
43 Ga0068853_100496456 3300005539 Bacteria 1152
44 Ga0070686_100010782 3300005544 Bacteria 5168
45 Ga0070695_100000016 3300005545 Bacteria 66345
46 Ga0070695_100051686 3300005545 Bacteria 2638
47 Ga0070695_100105502 3300005545 Bacteria 1904
48 Ga0070696_100055780 3300005546 Bacteria 2755
49 Ga0070704_100010046 3300005549 Bacteria 5750
50 Ga0070704_100425844 3300005549 Bacteria 1138
51 Ga0068855_100133199 3300005563 Bacteria 2837
52 Ga0068855_100171919 3300005563 Bacteria 2454
53 Ga0070664_100198738 3300005564 Bacteria 1788
54 Ga0070664_100282915 3300005564 Bacteria 1496
55 Ga0068857_100006763 3300005577 Bacteria 9864
56 Ga0068857_100102629 3300005577 Bacteria 2567
57 Ga0068857_100211602 3300005577 Bacteria 1769
58 Ga0068856_100011417 3300005614 Bacteria 8616
59 Ga0068856_100135263 3300005614 Bacteria 2470
60 Ga0068856_100236446 3300005614 Bacteria 1842
61 Ga0070702_100032872 3300005615 Bacteria 2849
62 Ga0081455_10007555 3300005937 Bacteria 11431
63 Ga0081455_10013070 3300005937 Bacteria 8229
64 Ga0081455_10099079 3300005937 Bacteria 2345
65 Ga0081538_10009596 3300005981 Bacteria 8053
66 Ga0081538_10010715 3300005981 Bacteria 7503
67 Ga0081538_10042810 3300005981 Bacteria 2851
68 Ga0075429_100074560 3300006880 Bacteria 2956
69 Ga0105240_10006174 3300009093 Bacteria 17661
70 Ga0105240_10372723 3300009093 Bacteria 1614
71 Ga0111539_10099424 3300009094 Bacteria 3416
72 Ga0105245_10027568 3300009098 Bacteria 5005
73 Ga0105245_10058214 3300009098 Bacteria 3478
74 Ga0105245_10177468 3300009098 Bacteria 2033
75 Ga0105245_10343019 3300009098 Bacteria 1478
76 Ga0105241_10017967 3300009174 Bacteria 5199
77 Ga0105248_10213647 3300009177 Bacteria 2173
78 Ga0105237_10169354 3300009545 Bacteria 2184
79 Ga0105238_10118052 3300009551 Bacteria 2633
80 Ga0105239_10014824 3300010375 Bacteria 8645
81 Ga0105239_10132941 3300010375 Bacteria 2769
82 Ga0157370_10534373 3300013104 Bacteria 1075
83 Ga0157369_10561667 3300013105 Bacteria 1179
84 Ga0157378_10293836 3300013297 Bacteria 1570
85 Ga0157372_10017444 3300013307 Bacteria 7706
86 Ga0157372_10135444 3300013307 Bacteria 2836
87 Ga0157372_10350986 3300013307 Bacteria 1719
88 Ga0157372_10483466 3300013307 Bacteria 1444
89 Ga0157375_10530863 3300013308 Bacteria 1339
90 Ga0163163_10240138 3300014325 Bacteria 1861
91 Ga0182008_10023059 3300014497 Bacteria 3183
92 Ga0157377_10110728 3300014745 Bacteria 1650
93 Ga0182007_10036646 3300015262 Bacteria 1650
94 Ga0206356_10059144 3300020070 Bacteria 4851
95 Ga0206356_11567203 3300020070 Bacteria 1943
96 Ga0206354_11593644 3300020081 Bacteria 2008
97 Ga0206353_11428957 3300020082 Bacteria 1269
98 Ga0206353_11833579 3300020082 Bacteria 2112
99 Ga0154015_1136243 3300020610 Bacteria 1944
100 Ga0224712_10014695 3300022467 Bacteria 2528
101 Ga0207688_10019278 3300025901 Bacteria 3714
102 Ga0207684_10068747 3300025910 Bacteria 3010
103 Ga0207654_10090955 3300025911 Bacteria 1860
104 Ga0207707_10012866 3300025912 Bacteria 7282
105 Ga0207707_10036428 3300025912 Bacteria 4302
106 Ga0207707_10096840 3300025912 Bacteria 2578
107 Ga0207707_10150770 3300025912 Bacteria 2033
108 Ga0207707_10226121 3300025912 Bacteria 1628
109 Ga0207707_10233262 3300025912 Bacteria 1601
110 Ga0207707_10335618 3300025912 Bacteria 1304
111 Ga0207695_10031485 3300025913 Bacteria 5816
112 Ga0207671_10155554 3300025914 Bacteria 1768
113 Ga0207693_10003081 3300025915 Bacteria 14381
114 Ga0207660_10014251 3300025917 Bacteria 5223
115 Ga0207660_10389995 3300025917 Bacteria 1120
116 Ga0207657_10000286 3300025919 Bacteria 53863
117 Ga0207657_10003035 3300025919 Bacteria 17975
118 Ga0207649_10317501 3300025920 Bacteria 1144
119 Ga0207652_10007531 3300025921 Bacteria 8766
120 Ga0207652_10019019 3300025921 Bacteria 5641
121 Ga0207652_10468428 3300025921 Bacteria 1135
122 Ga0207694_10147015 3300025924 Bacteria 1897
123 Ga0207650_10113881 3300025925 Bacteria 2097
124 Ga0207687_10019485 3300025927 Bacteria 4495
125 Ga0207687_10100440 3300025927 Bacteria 2128
126 Ga0207687_10161129 3300025927 Bacteria 1722
127 Ga0207687_10179253 3300025927 Bacteria 1640
128 Ga0207687_10246538 3300025927 Bacteria 1418
129 Ga0207687_10255975 3300025927 Bacteria 1394
130 Ga0207644_10019170 3300025931 Bacteria 4638
131 Ga0207690_10061231 3300025932 Bacteria 2558
132 Ga0207689_10224126 3300025942 Bacteria 1554
133 Ga0207661_10115395 3300025944 Bacteria 2278
134 Ga0207661_10138616 3300025944 Bacteria 2091
135 Ga0207661_10241089 3300025944 Bacteria 1604
136 Ga0207661_10429800 3300025944 Bacteria 1200
137 Ga0207679_10470703 3300025945 Bacteria 1117
138 Ga0207667_10197242 3300025949 Bacteria 2065
139 Ga0207677_10080581 3300026023 Bacteria 2333
140 Ga0207708_10054719 3300026075 Bacteria 3043
141 Ga0207708_10077871 3300026075 Bacteria 2545
142 Ga0207702_10100828 3300026078 Bacteria 2548
143 Ga0207702_10173104 3300026078 Bacteria 1981
144 Ga0207674_10002991 3300026116 Bacteria 20962
145 Ga0207674_10135646 3300026116 Bacteria 2423
146 Ga0207683_10006362 3300026121 Bacteria 10111
147 Ga0265327_10114375 3300031251 Bacteria 1285
148 Ga0307413_10282345 3300031824 Bacteria 1249
149 Ga0307410_10054835 3300031852 Bacteria 2703
150 Ga0307412_10068625 3300031911 Bacteria 2411
151 Ga0307412_10492114 3300031911 Bacteria 1019
152 Ga0307409_100063862 3300031995 Bacteria 2890
153 Ga0307409_100077698 3300031995 Bacteria 2667
154 Ga0307416_100003976 3300032002 Bacteria 8813
155 Ga0307416_100152203 3300032002 Bacteria 2123
156 Ga0307414_10136596 3300032004 Bacteria 1913
157 Ga0373947_0009834 3300035725 Bacteria 5488
158 Ga0395899_0002627 3300037312 Bacteria 14485
159 Ga0395899_0015062 3300037312 Bacteria 5894
160 Ga0395899_0015901 3300037312 Bacteria 5737
161 Ga0395899_0018629 3300037312 Bacteria 5275
162 Ga0395900_0005370 3300037418 Bacteria 13426
163 Ga0395900_0094717 3300037418 Bacteria 3067
164 Ga0395900_0140726 3300037418 Bacteria 2471
165 Ga0395900_0268126 3300037418 Bacteria 1703
166 Ga0395898_0003212 3300037466 Bacteria 18387
167 Ga0395898_0003653 3300037466 Bacteria 17105
168 Ga0395898_0042334 3300037466 Bacteria 4494
169 Ga0395898_0425020 3300037466 Bacteria 1266
170 Ga0395905_0010931 3300037471 Bacteria 8784
171 Ga0395905_0023455 3300037471 Bacteria 5829
172 Ga0395905_0192930 3300037471 Bacteria 1910
173 Ga0395901_0008583 3300038443 Bacteria 10329
174 Ga0395901_0013085 3300038443 Bacteria 8420
175 Ga0395901_0146603 3300038443 Bacteria 2480
176 Ga0395901_0336898 3300038443 Bacteria 1559
177 Ga0439448_0026952 3300042005 Bacteria 1809
178 Ga0450906_002095 3300042145 Bacteria 4365
179 Ga0439446_0006653 3300042156 Bacteria 3022
180 Ga0466972_0102158 3300044658 Bacteria 1356
181 Ga0466966_0183607 3300044684 Bacteria 1269
182 Ga0466961_0017215 3300044693 Bacteria 4643
183 Ga0466961_0213894 3300044693 Bacteria 1189
184 Ga0466963_0002203 3300044694 Bacteria 10773
185 Ga0466963_0002422 3300044694 Bacteria 10429
186 Ga0466963_0003123 3300044694 Bacteria 9389
187 Ga0466963_0003229 3300044694 Bacteria 9284
188 Ga0466963_0012324 3300044694 Bacteria 5229
189 Ga0466963_0015388 3300044694 Bacteria 4735
190 Ga0466963_0049959 3300044694 Bacteria 2767
191 Ga0466963_0065387 3300044694 Bacteria 2438
192 Ga0466964_0006560 3300044706 Bacteria 4340
193 Ga0466964_0012604 3300044706 Bacteria 3200
194 Ga0466964_0023800 3300044706 Bacteria 2383
195 Ga0466964_0068070 3300044706 Bacteria 1498
196 Ga0466971_0002039 3300044719 Bacteria 8552
197 Ga0466968_0011064 3300044735 Bacteria 3510
198 Ga0466968_0015343 3300044735 Bacteria 3035
199 Ga0466968_0022243 3300044735 Bacteria 2576
200 Ga0466968_0119225 3300044735 Bacteria 1193
201 Ga0466970_0069459 3300044765 Bacteria 1894
202 Ga0466957_0010709 3300044842 Bacteria 5273
203 Ga0466957_0033394 3300044842 Bacteria 3087
204 Ga0466957_0062240 3300044842 Bacteria 2292
205 Ga0466957_0090905 3300044842 Bacteria 1912
206 Ga0466960_0042971 3300044901 Bacteria 2148
207 Ga0466959_0078158 3300045049 Bacteria 2386
208 Ga0466959_0119900 3300045049 Bacteria 1871
209 Ga0466958_0002793 3300045836 Bacteria 8884
210 Ga0466958_0005192 3300045836 Bacteria 6975
211 Ga0466958_0009272 3300045836 Bacteria 5480
212 Ga0466958_0011211 3300045836 Bacteria 5043
213 Ga0466958_0031908 3300045836 Bacteria 3131
214 Ga0466958_0080927 3300045836 Bacteria 1998
215 Ga0466967_0002399 3300045976 Bacteria 11627
216 Ga0466967_0009596 3300045976 Bacteria 7192
217 Ga0466967_0015261 3300045976 Bacteria 6017
218 Ga0466967_0016328 3300045976 Bacteria 5851
219 Ga0466967_0029046 3300045976 Bacteria 4623
220 Ga0466967_0094993 3300045976 Bacteria 2716
221 Ga0466967_0114817 3300045976 Bacteria 2479
222 Ga0466967_0123079 3300045976 Bacteria 2399
223 Ga0466967_0130025 3300045976 Unclassified 2336
224 Ga0466967_0154629 3300045976 Bacteria 2147
225 Ga0466967_0177399 3300045976 Bacteria 2007
226 Ga0466967_0218520 3300045976 Bacteria 1810
227 Ga0466967_0556463 3300045976 Bacteria 1129
228 Ga0495582_0036197 3300046473 Bacteria 2715
229 Ga0495639_0070724 3300046475 Bacteria 1612
230 Ga0495609_0138662 3300046538 Bacteria 1039
231 Ga0495634_0013720 3300046642 Bacteria 5851
232 Ga0495647_0018509 3300046681 Bacteria 2481
233 Ga0495658_0026176 3300046683 Bacteria 3124
234 Ga0496100_0008142 3300048903 Bacteria 5834
235 Ga0496101_0002825 3300048904 Bacteria 10672
236 Ga0496101_0021662 3300048904 Bacteria 4417
237 Ga0496101_0271995 3300048904 Bacteria 1323
238 Ga0496102_0033103 3300048905 Bacteria 4644
239 Ga0496102_0100422 3300048905 Bacteria 2687
240 Ga0496103_0090699 3300048906 Bacteria 1928
241 Ga0496104_0000644 3300048907 Bacteria 29884
242 Ga0496104_0009365 3300048907 Bacteria 8708
243 Ga0496104_0149341 3300048907 Bacteria 2244
244 Ga0496105_0002426 3300048908 Bacteria 13511
245 Ga0496105_0164289 3300048908 Bacteria 1822
246 Ga0496106_0004150 3300048909 Bacteria 10800
247 Ga0496106_0030246 3300048909 Bacteria 4038
248 Ga0496106_0071033 3300048909 Bacteria 2660
249 Ga0496107_0000545 3300048910 Bacteria 21061
250 Ga0496107_0006007 3300048910 Bacteria 8326
251 Ga0496108_0012611 3300048911 Bacteria 6885
252 Ga0496108_0017327 3300048911 Bacteria 5892
253 Ga0496108_0022907 3300048911 Bacteria 5139
254 Ga0496108_0167990 3300048911 Bacteria 1897
255 Ga0496109_0024339 3300048912 Bacteria 5382
256 Ga0496109_0035208 3300048912 Bacteria 4514
257 Ga0496109_0076658 3300048912 Bacteria 3075
258 Ga0496109_0114168 3300048912 Bacteria 2513
259 Ga0496109_0583648 3300048912 Bacteria 1053
260 Ga0496110_0002651 3300048913 Bacteria 13492
261 Ga0496110_0006747 3300048913 Bacteria 9130
262 Ga0496110_0010795 3300048913 Bacteria 7445
263 Ga0496110_0085226 3300048913 Bacteria 2820
264 Ga0496110_0140272 3300048913 Bacteria 2185
265 Ga0496110_0177082 3300048913 Bacteria 1936
266 Ga0496111_0001830 3300048914 Bacteria 12517
267 Ga0496111_0011720 3300048914 Bacteria 5918
268 Ga0496112_0012198 3300048915 Bacteria 7888
269 Ga0496112_0014137 3300048915 Bacteria 7393
270 Ga0496112_0055623 3300048915 Bacteria 3892
271 Ga0496112_0062862 3300048915 Bacteria 3663
272 Ga0496112_0169875 3300048915 Bacteria 2146
273 Ga0496112_0250950 3300048915 Bacteria 1720
274 Ga0496112_0434425 3300048915 Bacteria 1251
275 Ga0496113_0001632 3300048916 Bacteria 12645
276 Ga0501031_0038676 3300049568 Bacteria 3113
277 Ga0501032_0089917 3300049569 Bacteria 2038
278 Ga0501032_0089967 3300049569 Bacteria 2037
279 Ga0501033_0028036 3300049570 Bacteria 4232
280 Ga0501033_0058569 3300049570 Bacteria 2845
281 Ga0501034_0007409 3300049571 Bacteria 11679
282 Ga0501034_0246361 3300049571 Bacteria 1732
283 Ga0501036_0004178 3300049572 Bacteria 11631
284 Ga0501036_0029774 3300049572 Bacteria 4613
285 Ga0501036_0077504 3300049572 Bacteria 2812
286 Ga0501036_0308863 3300049572 Bacteria 1322
287 Ga0501037_0019525 3300049573 Bacteria 5000
288 Ga0501037_0032981 3300049573 Bacteria 3826
289 Ga0501038_0021344 3300049574 Bacteria 5813
290 Ga0501038_0024986 3300049574 Bacteria 5326
291 Ga0501038_0064537 3300049574 Bacteria 3122
292 Ga0501038_0287137 3300049574 Bacteria 1294
293 Ga0501039_0003659 3300049575 Bacteria 11526
294 Ga0501039_0004410 3300049575 Bacteria 10618
295 Ga0501039_0049942 3300049575 Bacteria 3235
296 Ga0501040_0001766 3300049576 Bacteria 13889
297 Ga0501040_0019810 3300049576 Bacteria 4476
298 Ga0501040_0020325 3300049576 Bacteria 4422
299 Ga0501040_0024205 3300049576 Bacteria 4074
300 Ga0501040_0031944 3300049576 Bacteria 3560
301 Ga0501040_0074658 3300049576 Bacteria 2343
302 Ga0501040_0177143 3300049576 Bacteria 1511
303 Ga0501041_0002765 3300049577 Bacteria 10025
304 Ga0501041_0003775 3300049577 Bacteria 8713
305 Ga0501041_0014298 3300049577 Bacteria 4712
306 Ga0501041_0017275 3300049577 Bacteria 4293
307 Ga0501041_0021801 3300049577 Bacteria 3837
308 Ga0501041_0131887 3300049577 Bacteria 1556
309 Ga0501042_0002156 3300049578 Bacteria 11976
310 Ga0501042_0006850 3300049578 Bacteria 7436
311 Ga0501042_0032919 3300049578 Bacteria 3673
312 Ga0501042_0036743 3300049578 Bacteria 3475
313 Ga0501042_0094350 3300049578 Bacteria 2149
314 Ga0501042_0129477 3300049578 Bacteria 1818
315 Ga0501043_0134100 3300049579 Bacteria 1940
316 Ga0501043_0183109 3300049579 Bacteria 1632
317 Ga0501046_0023108 3300049580 Bacteria 5119
318 Ga0501046_0037464 3300049580 Bacteria 3896
319 Ga0501046_0102584 3300049580 Bacteria 2193
320 Ga0501046_0118022 3300049580 Bacteria 2021
321 Ga0501047_0067271 3300049581 Bacteria 3453
322 Ga0501048_0002752 3300049582 Bacteria 13413
323 Ga0501048_0004022 3300049582 Bacteria 11178
324 Ga0501048_0028276 3300049582 Bacteria 4069
325 Ga0501048_0039490 3300049582 Bacteria 3386
326 Ga0501048_0054908 3300049582 Bacteria 2829
327 Ga0501068_0008832 3300049584 Bacteria 5623
328 Ga0501068_0068879 3300049584 Bacteria 2157
329 Ga0501068_0070247 3300049584 Bacteria 2136
330 Ga0501068_0071815 3300049584 Bacteria 2113
331 Ga0501068_0075761 3300049584 Bacteria 2058
332 Ga0501068_0115171 3300049584 Bacteria 1674
333 Ga0501069_0007804 3300049585 Bacteria 5619
334 Ga0501069_0014183 3300049585 Bacteria 4256
335 Ga0501069_0030323 3300049585 Bacteria 2969
336 Ga0501069_0075914 3300049585 Bacteria 1889
337 Ga0501069_0180314 3300049585 Bacteria 1221
338 Ga0501070_0013192 3300049586 Bacteria 6965
339 Ga0501070_0033379 3300049586 Bacteria 4307
340 Ga0501070_0052134 3300049586 Bacteria 3396
341 Ga0501070_0108341 3300049586 Bacteria 2295
342 Ga0501070_0122436 3300049586 Bacteria 2150
343 Ga0501071_0000277 3300049587 Bacteria 24366
344 Ga0501071_0002325 3300049587 Bacteria 11476
345 Ga0501071_0002496 3300049587 Bacteria 11188
346 Ga0501071_0002630 3300049587 Bacteria 10990
347 Ga0501071_0004073 3300049587 Bacteria 9238
348 Ga0501071_0006045 3300049587 Bacteria 7841
349 Ga0501071_0006800 3300049587 Bacteria 7449
350 Ga0501071_0051901 3300049587 Bacteria 2956
351 Ga0501072_0002555 3300049588 Bacteria 13641
352 Ga0501072_0003596 3300049588 Bacteria 11667
353 Ga0501072_0008601 3300049588 Bacteria 7744
354 Ga0501072_0009035 3300049588 Bacteria 7574
355 Ga0501072_0024545 3300049588 Bacteria 4690
356 Ga0501072_0060772 3300049588 Bacteria 2979
357 Ga0501073_0024770 3300049589 Bacteria 4308
358 Ga0501073_0134426 3300049589 Bacteria 1714
359 Ga0501074_0004778 3300049590 Bacteria 9710
360 Ga0501074_0006327 3300049590 Bacteria 8550
361 Ga0501074_0008082 3300049590 Bacteria 7622
362 Ga0501074_0014280 3300049590 Bacteria 5776
363 Ga0501074_0017459 3300049590 Bacteria 5208
364 Ga0501074_0333229 3300049590 Bacteria 1077
365 Ga0501075_0001045 3300049591 Bacteria 17789
366 Ga0501075_0006029 3300049591 Bacteria 8308
367 Ga0501075_0013845 3300049591 Bacteria 5768
368 Ga0501075_0018573 3300049591 Bacteria 5034
369 Ga0501075_0053344 3300049591 Bacteria 3041
370 Ga0501075_0054504 3300049591 Bacteria 3008
371 Ga0501075_0067346 3300049591 Bacteria 2704
372 Ga0501075_0104612 3300049591 Bacteria 2151
373 Ga0501075_0144150 3300049591 Bacteria 1815
374 Ga0501076_0003774 3300049592 Bacteria 10658
375 Ga0501076_0006039 3300049592 Bacteria 8760
376 Ga0501076_0007642 3300049592 Bacteria 7870
377 Ga0501076_0010657 3300049592 Bacteria 6827
378 Ga0501076_0013929 3300049592 Bacteria 6039
379 Ga0501076_0133733 3300049592 Bacteria 2013
380 Ga0501077_0004179 3300049593 Bacteria 8723
381 Ga0501077_0006246 3300049593 Bacteria 7286
382 Ga0501077_0008012 3300049593 Bacteria 6531
383 Ga0501077_0009762 3300049593 Bacteria 5969
384 Ga0501077_0015520 3300049593 Bacteria 4795
385 Ga0501077_0105480 3300049593 Bacteria 1786
386 Ga0501079_0001623 3300049741 Bacteria 16031
387 Ga0501079_0005492 3300049741 Bacteria 9447
388 Ga0501079_0009741 3300049741 Bacteria 7286
389 Ga0501079_0023056 3300049741 Bacteria 4778
390 Ga0501079_0086325 3300049741 Bacteria 2429
391 Ga0501079_0091764 3300049741 Bacteria 2353
392 Ga0501079_0158843 3300049741 Bacteria 1762
393 Ga0501080_0008830 3300049742 Bacteria 9161
394 Ga0501080_0035548 3300049742 Bacteria 4649
395 Ga0501080_0052919 3300049742 Bacteria 3779
396 Ga0501080_0144009 3300049742 Bacteria 2203
397 Ga0501080_0152110 3300049742 Bacteria 2138
398 Ga0501080_0263664 3300049742 Bacteria 1569
399 Ga0501080_0271829 3300049742 Bacteria 1542
400 Ga0501080_0305072 3300049742 Bacteria 1443
401 Ga0501081_0003339 3300049743 Bacteria 10206
402 Ga0501081_0004397 3300049743 Bacteria 9038
403 Ga0501081_0022703 3300049743 Bacteria 4199
404 Ga0501081_0103984 3300049743 Bacteria 2010
405 Ga0501081_0125503 3300049743 Bacteria 1830
406 Ga0501081_0152045 3300049743 Bacteria 1663
407 Ga0501083_0017855 3300049744 Bacteria 4948
408 Ga0501035_0031496 3300049822 Bacteria 4829
409 Ga0501035_0069638 3300049822 Bacteria 3117
410 Ga0501035_0151602 3300049822 Bacteria 2011
411 Ga0501044_0059198 3300049823 Bacteria 3926
412 Ga0501044_0203356 3300049823 Bacteria 1938
413 Ga0501045_0001366 3300049824 Bacteria 16235
414 Ga0501045_0007850 3300049824 Bacteria 7426
415 Ga0501045_0009261 3300049824 Bacteria 6886
416 Ga0501045_0013666 3300049824 Bacteria 5739
417 Ga0501045_0027090 3300049824 Bacteria 4127
418 nmdc:mga00v17_37110_c1 3300050491 Bacteria 2908
419 nmdc:mga06z11_85910_c1 3300050494 Bacteria 1698
420 nmdc:mga08y16_228410_c1 3300050511 Bacteria 1925
421 Ga0495612_0036006 3300053078 Bacteria 2008
422 Ga0501084_0005357 3300054114 Bacteria 10512
423 Ga0501084_0034263 3300054114 Bacteria 4246
424 Ga0501084_0048958 3300054114 Bacteria 3537
425 Ga0501084_0096079 3300054114 Bacteria 2488
426 Ga0501084_0108272 3300054114 Bacteria 2334
427 Ga0501084_0127367 3300054114 Bacteria 2143
428 Ga0501084_0128435 3300054114 Bacteria 2133
429 Ga0590077_012604 3300059426 Bacteria 1755
430 Ga0590077_015043 3300059426 Bacteria 1615
431 Ga0587073_0000671 3300059492 Bacteria 3379
432 Ga0587073_0004795 3300059492 Bacteria 1968
433 Ga0587075_000389 3300059644 Bacteria 3381
434 Ga0587114_002716 3300059655 Bacteria 1682
435 Ga0501082_0005548 3300060353 Bacteria 10953
436 Ga0501082_0006717 3300060353 Bacteria 9950
437 Ga0501082_0009039 3300060353 Bacteria 8594
438 Ga0501082_0045996 3300060353 Bacteria 3763
439 Ga0501082_0050295 3300060353 Bacteria 3594
440 Ga0501082_0055492 3300060353 Bacteria 3413
441 Ga0501082_0198294 3300060353 Bacteria 1746
442 Ga0501082_0316917 3300060353 Bacteria 1359
443 Ga0530510_0002635 3300061734 Bacteria 12331
444 Ga0530510_0012803 3300061734 Bacteria 5896
445 Ga0530510_0030122 3300061734 Bacteria 3896
446 Ga0530510_0039315 3300061734 Bacteria 3414
447 Ga0530510_0086510 3300061734 Bacteria 2284
448 Ga0530510_0100999 3300061734 Bacteria 2109
449 Ga0530510_0190146 3300061734 Bacteria 1524
450 Ga0496100_0100783
451 Ga0070658_10025354
452 Ga0070683_100018029
453 Ga0070683_100057545
454 Ga0070683_100061011
455 Ga0070683_100090302
456 Ga0070683_100107340
457 Ga0070683_100112880
458 Ga0070683_100213432
459 Ga0070670_100218057
460 Ga0068869_100320863
461 Ga0070680_100011427
462 Ga0070680_100073494
463 Ga0070682_100039922
464 Ga0070682_100111777
465 Ga0070682_100302037
466 Ga0068868_100068349
467 Ga0070660_100008038
468 Ga0070660_100015202
469 Ga0070660_100359706
470 Ga0070661_100028177
471 Ga0070692_10021044
472 Ga0070671_100045919
473 Ga0070705_100008154
474 Ga0070705_100074026
475 Ga0070700_100036331
476 Ga0070694_100013430
477 Ga0070681_10044412
478 Ga0070681_10076532
479 Ga0070681_10090139
480 Ga0070681_10158438
481 Ga0070681_10195120
482 Ga0070681_10298984
483 Ga0070685_10168457
484 Ga0070679_100019465
485 Ga0070679_100025048
486 Ga0070679_100363387
487 Ga0070679_100482404
488 Ga0070684_100019303
489 Ga0070684_100031621
490 Ga0070684_100116201
491 Ga0070684_100166725
492 Ga0068853_100496456
493 Ga0070686_100010782
494 Ga0070695_100000016
495 Ga0070695_100051686
496 Ga0070695_100105502
497 Ga0070696_100055780
498 Ga0070704_100010046
499 Ga0070704_100425844
500 Ga0068855_100133199
501 Ga0068855_100171919
502 Ga0070664_100198738
503 Ga0070664_100282915
504 Ga0068857_100006763
505 Ga0068857_100102629
506 Ga0068857_100211602
507 Ga0068856_100011417
508 Ga0068856_100135263
509 Ga0068856_100236446
510 Ga0070702_100032872
511 Ga0081455_10007555
512 Ga0081455_10013070
513 Ga0081455_10099079
514 Ga0081538_10009596
515 Ga0081538_10010715
516 Ga0081538_10042810
517 Ga0075429_100074560
518 Ga0105240_10006174
519 Ga0105240_10372723
520 Ga0111539_10099424
521 Ga0105245_10027568
522 Ga0105245_10058214
523 Ga0105245_10177468
524 Ga0105245_10343019
525 Ga0105241_10017967
526 Ga0105248_10213647
527 Ga0105237_10169354
528 Ga0105238_10118052
529 Ga0105239_10014824
530 Ga0105239_10132941
531 Ga0157370_10534373
532 Ga0157369_10561667
533 Ga0157378_10293836
534 Ga0157372_10017444
535 Ga0157372_10135444
536 Ga0157372_10350986
537 Ga0157372_10483466
538 Ga0157375_10530863
539 Ga0163163_10240138
540 Ga0182008_10023059
541 Ga0157377_10110728
542 Ga0182007_10036646
543 Ga0206356_10059144
544 Ga0206356_11567203
545 Ga0206354_11593644
546 Ga0206353_11428957
547 Ga0206353_11833579
548 Ga0154015_1136243
549 Ga0224712_10014695
550 Ga0207688_10019278
551 Ga0207684_10068747
552 Ga0207654_10090955
553 Ga0207707_10012866
554 Ga0207707_10036428
555 Ga0207707_10096840
556 Ga0207707_10150770
557 Ga0207707_10226121
558 Ga0207707_10233262
559 Ga0207707_10335618
560 Ga0207695_10031485
561 Ga0207671_10155554
562 Ga0207693_10003081
563 Ga0207660_10014251
564 Ga0207660_10389995
565 Ga0207657_10000286
566 Ga0207657_10003035
567 Ga0207649_10317501
568 Ga0207652_10007531
569 Ga0207652_10019019
570 Ga0207652_10468428
571 Ga0207694_10147015
572 Ga0207650_10113881
573 Ga0207687_10019485
574 Ga0207687_10100440
575 Ga0207687_10161129
576 Ga0207687_10179253
577 Ga0207687_10246538
578 Ga0207687_10255975
579 Ga0207644_10019170
580 Ga0207690_10061231
581 Ga0207689_10224126
582 Ga0207661_10115395
583 Ga0207661_10138616
584 Ga0207661_10241089
585 Ga0207661_10429800
586 Ga0207679_10470703
587 Ga0207667_10197242
588 Ga0207677_10080581
589 Ga0207708_10054719
590 Ga0207708_10077871
591 Ga0207702_10100828
592 Ga0207702_10173104
593 Ga0207674_10002991
594 Ga0207674_10135646
595 Ga0207683_10006362
596 Ga0265327_10114375
597 Ga0307413_10282345
598 Ga0307410_10054835
599 Ga0307412_10068625
600 Ga0307412_10492114
601 Ga0307409_100063862
602 Ga0307409_100077698
603 Ga0307416_100003976
604 Ga0307416_100152203
605 Ga0307414_10136596
606 Ga0373947_0009834
607 Ga0395899_0002627
608 Ga0395899_0015062
609 Ga0395899_0015901
610 Ga0395899_0018629
611 Ga0395900_0005370
612 Ga0395900_0094717
613 Ga0395900_0140726
614 Ga0395900_0268126
615 Ga0395898_0003212
616 Ga0395898_0003653
617 Ga0395898_0042334
618 Ga0395898_0425020
619 Ga0395905_0010931
620 Ga0395905_0023455
621 Ga0395905_0192930
622 Ga0395901_0008583
623 Ga0395901_0013085
624 Ga0395901_0146603
625 Ga0395901_0336898
626 Ga0439448_0026952
627 Ga0450906_002095
628 Ga0439446_0006653
629 Ga0466972_0102158
630 Ga0466966_0183607
631 Ga0466961_0017215
632 Ga0466961_0213894
633 Ga0466963_0002203
634 Ga0466963_0002422
635 Ga0466963_0003123
636 Ga0466963_0003229
637 Ga0466963_0012324
638 Ga0466963_0015388
639 Ga0466963_0049959
640 Ga0466963_0065387
641 Ga0466964_0006560
642 Ga0466964_0012604
643 Ga0466964_0023800
644 Ga0466964_0068070
645 Ga0466971_0002039
646 Ga0466968_0011064
647 Ga0466968_0015343
648 Ga0466968_0022243
649 Ga0466968_0119225
650 Ga0466970_0069459
651 Ga0466957_0010709
652 Ga0466957_0033394
653 Ga0466957_0062240
654 Ga0466957_0090905
655 Ga0466960_0042971
656 Ga0466959_0078158
657 Ga0466959_0119900
658 Ga0466958_0002793
659 Ga0466958_0005192
660 Ga0466958_0009272
661 Ga0466958_0011211
662 Ga0466958_0031908
663 Ga0466958_0080927
664 Ga0466967_0002399
665 Ga0466967_0009596
666 Ga0466967_0015261
667 Ga0466967_0016328
668 Ga0466967_0029046
669 Ga0466967_0094993
670 Ga0466967_0114817
671 Ga0466967_0123079
672 Ga0466967_0130025
673 Ga0466967_0154629
674 Ga0466967_0177399
675 Ga0466967_0218520
676 Ga0466967_0556463
677 Ga0495582_0036197
678 Ga0495639_0070724
679 Ga0495609_0138662
680 Ga0495634_0013720
681 Ga0495647_0018509
682 Ga0495658_0026176
683 Ga0496100_0008142
684 Ga0496101_0002825
685 Ga0496101_0021662
686 Ga0496101_0271995
687 Ga0496102_0033103
688 Ga0496102_0100422
689 Ga0496103_0090699
690 Ga0496104_0000644
691 Ga0496104_0009365
692 Ga0496104_0149341
693 Ga0496105_0002426
694 Ga0496105_0164289
695 Ga0496106_0004150
696 Ga0496106_0030246
697 Ga0496106_0071033
698 Ga0496107_0000545
699 Ga0496107_0006007
700 Ga0496108_0012611
701 Ga0496108_0017327
702 Ga0496108_0022907
703 Ga0496108_0167990
704 Ga0496109_0024339
705 Ga0496109_0035208
706 Ga0496109_0076658
707 Ga0496109_0114168
708 Ga0496109_0583648
709 Ga0496110_0002651
710 Ga0496110_0006747
711 Ga0496110_0010795
712 Ga0496110_0085226
713 Ga0496110_0140272
714 Ga0496110_0177082
715 Ga0496111_0001830
716 Ga0496111_0011720
717 Ga0496112_0012198
718 Ga0496112_0014137
719 Ga0496112_0055623
720 Ga0496112_0062862
721 Ga0496112_0169875
722 Ga0496112_0250950
723 Ga0496112_0434425
724 Ga0496113_0001632
725 Ga0501031_0038676
726 Ga0501032_0089917
727 Ga0501032_0089967
728 Ga0501033_0028036
729 Ga0501033_0058569
730 Ga0501034_0007409
731 Ga0501034_0246361
732 Ga0501036_0004178
733 Ga0501036_0029774
734 Ga0501036_0077504
735 Ga0501036_0308863
736 Ga0501037_0019525
737 Ga0501037_0032981
738 Ga0501038_0021344
739 Ga0501038_0024986
740 Ga0501038_0064537
741 Ga0501038_0287137
742 Ga0501039_0003659
743 Ga0501039_0004410
744 Ga0501039_0049942
745 Ga0501040_0001766
746 Ga0501040_0019810
747 Ga0501040_0020325
748 Ga0501040_0024205
749 Ga0501040_0031944
750 Ga0501040_0074658
751 Ga0501040_0177143
752 Ga0501041_0002765
753 Ga0501041_0003775
754 Ga0501041_0014298
755 Ga0501041_0017275
756 Ga0501041_0021801
757 Ga0501041_0131887
758 Ga0501042_0002156
759 Ga0501042_0006850
760 Ga0501042_0032919
761 Ga0501042_0036743
762 Ga0501042_0094350
763 Ga0501042_0129477
764 Ga0501043_0134100
765 Ga0501043_0183109
766 Ga0501046_0023108
767 Ga0501046_0037464
768 Ga0501046_0102584
769 Ga0501046_0118022
770 Ga0501047_0067271
771 Ga0501048_0002752
772 Ga0501048_0004022
773 Ga0501048_0028276
774 Ga0501048_0039490
775 Ga0501048_0054908
776 Ga0501068_0008832
777 Ga0501068_0068879
778 Ga0501068_0070247
779 Ga0501068_0071815
780 Ga0501068_0075761
781 Ga0501068_0115171
782 Ga0501069_0007804
783 Ga0501069_0014183
784 Ga0501069_0030323
785 Ga0501069_0075914
786 Ga0501069_0180314
787 Ga0501070_0013192
788 Ga0501070_0033379
789 Ga0501070_0052134
790 Ga0501070_0108341
791 Ga0501070_0122436
792 Ga0501071_0000277
793 Ga0501071_0002325
794 Ga0501071_0002496
795 Ga0501071_0002630
796 Ga0501071_0004073
797 Ga0501071_0006045
798 Ga0501071_0006800
799 Ga0501071_0051901
800 Ga0501072_0002555
801 Ga0501072_0003596
802 Ga0501072_0008601
803 Ga0501072_0009035
804 Ga0501072_0024545
805 Ga0501072_0060772
806 Ga0501073_0024770
807 Ga0501073_0134426
808 Ga0501074_0004778
809 Ga0501074_0006327
810 Ga0501074_0008082
811 Ga0501074_0014280
812 Ga0501074_0017459
813 Ga0501074_0333229
814 Ga0501075_0001045
815 Ga0501075_0006029
816 Ga0501075_0013845
817 Ga0501075_0018573
818 Ga0501075_0053344
819 Ga0501075_0054504
820 Ga0501075_0067346
821 Ga0501075_0104612
822 Ga0501075_0144150
823 Ga0501076_0003774
824 Ga0501076_0006039
825 Ga0501076_0007642
826 Ga0501076_0010657
827 Ga0501076_0013929
828 Ga0501076_0133733
829 Ga0501077_0004179
830 Ga0501077_0006246
831 Ga0501077_0008012
832 Ga0501077_0009762
833 Ga0501077_0015520
834 Ga0501077_0105480
835 Ga0501079_0001623
836 Ga0501079_0005492
837 Ga0501079_0009741
838 Ga0501079_0023056
839 Ga0501079_0086325
840 Ga0501079_0091764
841 Ga0501079_0158843
842 Ga0501080_0008830
843 Ga0501080_0035548
844 Ga0501080_0052919
845 Ga0501080_0144009
846 Ga0501080_0152110
847 Ga0501080_0263664
848 Ga0501080_0271829
849 Ga0501080_0305072
850 Ga0501081_0003339
851 Ga0501081_0004397
852 Ga0501081_0022703
853 Ga0501081_0103984
854 Ga0501081_0125503
855 Ga0501081_0152045
856 Ga0501083_0017855
857 Ga0501035_0031496
858 Ga0501035_0069638
859 Ga0501035_0151602
860 Ga0501044_0059198
861 Ga0501044_0203356
862 Ga0501045_0001366
863 Ga0501045_0007850
864 Ga0501045_0009261
865 Ga0501045_0013666
866 Ga0501045_0027090
867 nmdc:mga00v17_37110_c1
868 nmdc:mga06z11_85910_c1
869 nmdc:mga08y16_228410_c1
870 Ga0495612_0036006
871 Ga0501084_0005357
872 Ga0501084_0034263
873 Ga0501084_0048958
874 Ga0501084_0096079
875 Ga0501084_0108272
876 Ga0501084_0127367
877 Ga0501084_0128435
878 Ga0590077_012604
879 Ga0590077_015043
880 Ga0587073_0000671
881 Ga0587073_0004795
882 Ga0587075_000389
883 Ga0587114_002716
884 Ga0501082_0005548
885 Ga0501082_0006717
886 Ga0501082_0009039
887 Ga0501082_0045996
888 Ga0501082_0050295
889 Ga0501082_0055492
890 Ga0501082_0198294
891 Ga0501082_0316917
892 Ga0530510_0002635
893 Ga0530510_0012803
894 Ga0530510_0030122
895 Ga0530510_0039315
896 Ga0530510_0086510
897 Ga0530510_0100999
898 Ga0530510_0190146

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

125

312

0.94

PF12911

OppC_N

N-terminal TM domain of oligopeptide transport permease C

32

84

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7538 94 285
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.7084 95 283
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7073 87 288
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.678 94 285
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.6656 87 288
ID Description Score Start End Superfamily
af_P0AGH5_85_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8471 87 290 1.10.3720.10
af_Q2FVE9_63_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8343 93 286 1.10.3720.10
af_P0AGH5_85_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8246 87 290 1.10.3720.10
af_Q2G1F6_179_383_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8157 87 290 1.10.3720.10
af_P75799_92_298_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8083 87 290 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A4P8XJU3-F1-model_v4 ABC transporter permease 0.828 28 291 GO:0005886
GO:0055085
AF-A0A0R2NQB2-F1-model_v4 ABC transporter permease 0.8235 77 296 GO:0005886
GO:0055085
AF-A0A7K1KM60-F1-model_v4 Nickel ABC transporter permease subunit NikC 0.823 33 291 GO:0005886
GO:0071916
AF-A0A3E3HXJ3-F1-model_v4 ABC transporter permease 0.8224 19 295 GO:0005886
GO:0055085
AF-A0A3M9LN86-F1-model_v4 ABC transporter permease 0.8199 31 296 GO:0005886
GO:0055085

Map