F446418

General Info

Members Datasets Scaffolds Average Seq Length
449 265 430 312

Family's Representative Sequence

Representative Sequence 3300031241|Ga0265325_10002952|Ga0265325_100029523
Length 362
Sequence LERAIRQVTAVVKRRSILYEYWPRRADGATARKQGVAMGRMITNSSVVRSIWLAHARRAAVGLVLACALAAPSLALNDKMTPIAIPAQPGAIELGTGPLPNATVAESWHSQYERVFARNVTVATLTPFLPDPAKATGAAVIVAPGGGFTTLSMENEGWDVARALASRGVAAFVLKYRLRQTPASIDDYEKSMAAMFAGMARTPAPPRPSGGDMMAGLAPQLADARAAFALVRKRAAEWHVDPDRIGMVGFSAGAGLTMAATLAGQDAKPAFIGIIYGSLAPVTVPADAPPLFVALAADDPLFGNGGYGLIDSWRAAKRPVEFHLYEQGGHGFGMYQKETTSTGWFDAFARWLGMHGMLSHAK

Samples

Sample ID Description Type Environment
1 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
2 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
3 2643221556 Massilia sp. Root1485 Isolate Unclassified
4 2643221584 Caulobacter sp. Root656 Isolate Unclassified
5 2643221684 Massilia sp. Root133 Isolate Unclassified
6 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
7 2842711865 Duganella sp. R-73148 Isolate Unclassified
8 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
9 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
10 2857558681 Duganella sp. R-74565 Isolate Unclassified
11 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
12 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
13 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
14 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
15 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
16 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
17 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
18 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
19 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
20 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
21 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
22 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
23 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
24 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
25 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
89 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
90 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
135 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
151 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
152 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
153 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
154 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
155 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
156 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
157 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
158 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
159 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
160 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
161 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
162 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
163 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
164 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
165 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
178 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
189 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
190 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
191 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
192 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
193 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
194 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
195 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
196 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
197 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
198 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
199 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
203 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
204 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
211 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
212 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
218 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
225 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
226 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
227 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
228 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
229 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
230 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
231 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
244 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
258 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
259 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
260 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
261 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
262 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
263 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
264 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
265 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.77
Metatranscriptomes 0
Isolates 4.23

Biome Distribution

Category Percentage (%)
Aerial Root 0.67
Bulb 0
Endosphere 6.24
Nodule 0
Rhizoplane 2.45
Rhizosphere 82.18
Stem 0
Stem Tuber 0
Unclassified 8.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001172 3300001904 Bacteria 4809
2 JGI24740J21852_10007394 3300001979 Bacteria 4468
3 JGI24739J22299_10000786 3300001989 Bacteria 11587
4 JGI24739J22299_10001171 3300001989 Bacteria 9818
5 JGI24739J22299_10005088 3300001989 Bacteria 5010
6 JGI24739J22299_10035169 3300001989 Bacteria 1700
7 JGI24737J22298_10001980 3300001990 Bacteria 7319
8 JGI24737J22298_10002147 3300001990 Bacteria 7032
9 JGI24737J22298_10047863 3300001990 Bacteria 1302
10 JGI24735J21928_10000626 3300002067 Bacteria 12446
11 JGI24735J21928_10010988 3300002067 Bacteria 2876
12 JGI24735J21928_10038832 3300002067 Bacteria 1393
13 JGI24738J21930_10000362 3300002075 Bacteria 12596
14 JGI24738J21930_10003100 3300002075 Bacteria 4251
15 JGI24738J21930_10004279 3300002075 Bacteria 3512
16 JGI25150J39212_1007286 3300002774 Bacteria 2229
17 JGI25165J46597_1000007 3300003214 Bacteria 518996
18 rootL2_10007198 3300003322 Bacteria 30268
19 rootL2_10007858 3300003322 Bacteria 14320
20 rootH1_10052949 3300003323 Bacteria 2556
21 rootH1_10295736 3300003323 Bacteria 1358
22 Ga0055525_1000073 3300003759 Bacteria 180663
23 Ga0055526_1000029 3300003771 Bacteria 148855
24 Ga0055537_1000684 3300003773 Bacteria 17784
25 Ga0065165_1001329 3300005262 Bacteria 27483
26 Ga0065165_1041398 3300005262 Bacteria 1368
27 Ga0070658_10000292 3300005327 Bacteria 43714
28 Ga0070658_10072521 3300005327 Bacteria 2822
29 Ga0070658_10163619 3300005327 Bacteria 1867
30 Ga0070683_100006338 3300005329 Bacteria 9920
31 Ga0070683_100080469 3300005329 Bacteria 3050
32 Ga0070690_100017853 3300005330 Bacteria 4277
33 Ga0070690_100118998 3300005330 Bacteria 1771
34 Ga0070666_10005004 3300005335 Bacteria 8106
35 Ga0070666_10039562 3300005335 Bacteria 3144
36 Ga0070680_100035008 3300005336 Bacteria 4052
37 Ga0070660_100000655 3300005339 Bacteria 22906
38 Ga0070660_100037329 3300005339 Bacteria 3684
39 Ga0070660_100074314 3300005339 Bacteria 2659
40 Ga0070661_100000138 3300005344 Bacteria 61062
41 Ga0070661_100189769 3300005344 Bacteria 1567
42 Ga0070692_10010420 3300005345 Bacteria 4228
43 Ga0070671_100009712 3300005355 Bacteria 7730
44 Ga0070671_100039537 3300005355 Bacteria 3915
45 Ga0070659_100000081 3300005366 Bacteria 73150
46 Ga0070659_100099269 3300005366 Bacteria 2342
47 Ga0070659_100115466 3300005366 Bacteria 2170
48 Ga0070667_100005341 3300005367 Bacteria 10731
49 Ga0070714_100180892 3300005435 Bacteria 1918
50 Ga0070662_100000025 3300005457 Bacteria 87144
51 Ga0070662_100003310 3300005457 Bacteria 10043
52 Ga0070662_100154777 3300005457 Bacteria 1788
53 Ga0068867_100225708 3300005459 Bacteria 1511
54 Ga0070679_100102921 3300005530 Bacteria 2842
55 Ga0070684_100003050 3300005535 Bacteria 12497
56 Ga0068853_100001144 3300005539 Bacteria 18799
57 Ga0068853_100073120 3300005539 Bacteria 2988
58 Ga0068853_100135863 3300005539 Bacteria 2204
59 Ga0068853_100323678 3300005539 Bacteria 1430
60 Ga0070665_100000075 3300005548 Bacteria 189496
61 Ga0070665_100006346 3300005548 Bacteria 12066
62 Ga0068855_100000503 3300005563 Bacteria 48317
63 Ga0068855_100389483 3300005563 Bacteria 1529
64 Ga0068855_100493491 3300005563 Bacteria 1331
65 Ga0070664_100000012 3300005564 Bacteria 162011
66 Ga0068857_100086566 3300005577 Bacteria 2802
67 Ga0068857_100374471 3300005577 Bacteria 1321
68 Ga0068854_100014492 3300005578 Bacteria 5198
69 Ga0068854_100379779 3300005578 Bacteria 1164
70 Ga0068856_100000163 3300005614 Bacteria 68963
71 Ga0068856_100013326 3300005614 Bacteria 7961
72 Ga0068852_100000426 3300005616 Bacteria 28017
73 Ga0068852_100475624 3300005616 Bacteria 1241
74 Ga0068864_100009025 3300005618 Bacteria 8221
75 Ga0068864_100448305 3300005618 Bacteria 1234
76 Ga0068861_100401046 3300005719 Bacteria 1217
77 Ga0068863_100017569 3300005841 Bacteria 6852
78 Ga0068863_100156704 3300005841 Bacteria 2180
79 Ga0068858_100001099 3300005842 Bacteria 27967
80 Ga0068858_100020140 3300005842 Bacteria 6239
81 Ga0075366_10204565 3300006195 Bacteria 1201
82 Ga0075431_100118316 3300006847 Bacteria 2734
83 Ga0068865_100020743 3300006881 Bacteria 4264
84 Ga0105244_10004189 3300009036 Bacteria 10032
85 Ga0105240_10000120 3300009093 Bacteria 163069
86 Ga0105245_10001154 3300009098 Bacteria 23876
87 Ga0114129_10153874 3300009147 Bacteria 3146
88 Ga0105243_10060576 3300009148 Bacteria 3024
89 Ga0105241_10029401 3300009174 Bacteria 4100
90 Ga0105241_10033155 3300009174 Bacteria 3876
91 Ga0105248_10000299 3300009177 Bacteria 58871
92 Ga0105248_10118909 3300009177 Bacteria 2981
93 Ga0105237_10140406 3300009545 Bacteria 2410
94 Ga0105238_10000692 3300009551 Bacteria 35370
95 Ga0105238_10069615 3300009551 Bacteria 3519
96 Ga0105238_10078867 3300009551 Bacteria 3283
97 Ga0105239_10014202 3300010375 Bacteria 8839
98 Ga0105239_10027416 3300010375 Bacteria 6271
99 Ga0105239_10379449 3300010375 Bacteria 1598
100 Ga0105246_10053124 3300011119 Bacteria 2787
101 Ga0157373_10009075 3300013100 Bacteria 7358
102 Ga0157371_10001635 3300013102 Bacteria 22933
103 Ga0157371_10183147 3300013102 Bacteria 1498
104 Ga0157370_10021638 3300013104 Bacteria 6407
105 Ga0157370_10052719 3300013104 Bacteria 3883
106 Ga0157370_10075734 3300013104 Bacteria 3171
107 Ga0157369_10003947 3300013105 Bacteria 17607
108 Ga0157369_10074847 3300013105 Bacteria 3632
109 Ga0157374_10000241 3300013296 Bacteria 50896
110 Ga0157374_10019355 3300013296 Bacteria 6025
111 Ga0157374_10051983 3300013296 Bacteria 3814
112 Ga0157378_10004630 3300013297 Bacteria 12063
113 Ga0163162_10224046 3300013306 Bacteria 2010
114 Ga0157372_10002222 3300013307 Bacteria 21058
115 Ga0157372_10015946 3300013307 Bacteria 8058
116 Ga0157372_10032013 3300013307 Bacteria 5762
117 Ga0157372_10289986 3300013307 Bacteria 1903
118 Ga0157372_10393495 3300013307 Bacteria 1615
119 Ga0157375_10082990 3300013308 Bacteria 3248
120 Ga0157375_10131208 3300013308 Bacteria 2625
121 Ga0163163_10000341 3300014325 Bacteria 45103
122 Ga0157379_10039325 3300014968 Bacteria 4219
123 Ga0182006_1066580 3300015261 Bacteria 1346
124 Ga0213876_10000059 3300021384 Bacteria 133725
125 Ga0209563_100007 3300025230 Bacteria 1579402
126 Ga0207425_1002582 3300025245 Bacteria 6290
127 Ga0209646_1019272 3300025246 Bacteria 992
128 Ga0209148_1000495 3300025254 Bacteria 40335
129 Ga0209148_1005025 3300025254 Bacteria 3106
130 Ga0209565_1022771 3300025263 Bacteria 1294
131 Ga0209455_1001091 3300025272 Bacteria 13360
132 Ga0209455_1011095 3300025272 Bacteria 2240
133 Ga0209676_1043288 3300025292 Bacteria 1243
134 Ga0209564_1034462 3300025295 Bacteria 1484
135 Ga0209758_1000343 3300025297 Bacteria 85198
136 Ga0209256_1000632 3300025299 Bacteria 48299
137 Ga0207655_1088673 3300025728 Bacteria 1094
138 Ga0207680_10001859 3300025903 Bacteria 9922
139 Ga0207680_10015632 3300025903 Bacteria 3966
140 Ga0207647_10000270 3300025904 Bacteria 42605
141 Ga0207647_10005383 3300025904 Bacteria 9400
142 Ga0207647_10015183 3300025904 Bacteria 5289
143 Ga0207647_10023256 3300025904 Bacteria 4102
144 Ga0207647_10173127 3300025904 Bacteria 1256
145 Ga0207699_10198972 3300025906 Bacteria 1356
146 Ga0207705_10000095 3300025909 Bacteria 106506
147 Ga0207705_10029392 3300025909 Bacteria 3918
148 Ga0207654_10015882 3300025911 Bacteria 3914
149 Ga0207695_10000204 3300025913 Bacteria 163066
150 Ga0207671_10003710 3300025914 Bacteria 15047
151 Ga0207660_10000753 3300025917 Bacteria 21519
152 Ga0207657_10000028 3300025919 Bacteria 141576
153 Ga0207657_10014810 3300025919 Bacteria 7591
154 Ga0207657_10096434 3300025919 Bacteria 2460
155 Ga0207649_10000014 3300025920 Bacteria 255001
156 Ga0207652_10001433 3300025921 Bacteria 21127
157 Ga0207694_10048739 3300025924 Bacteria 3278
158 Ga0207650_10052322 3300025925 Bacteria 3025
159 Ga0207650_10080348 3300025925 Bacteria 2472
160 Ga0207687_10003903 3300025927 Bacteria 10001
161 Ga0207687_10160530 3300025927 Bacteria 1725
162 Ga0207644_10033531 3300025931 Bacteria 3589
163 Ga0207690_10000042 3300025932 Bacteria 120002
164 Ga0207690_10016326 3300025932 Bacteria 4514
165 Ga0207706_10000029 3300025933 Bacteria 146113
166 Ga0207706_10007764 3300025933 Bacteria 9904
167 Ga0207706_10011664 3300025933 Bacteria 8013
168 Ga0207706_10193687 3300025933 Bacteria 1784
169 Ga0207669_10087143 3300025937 Bacteria 2021
170 Ga0207711_10000751 3300025941 Bacteria 31798
171 Ga0207711_10080159 3300025941 Bacteria 2851
172 Ga0207689_10002237 3300025942 Bacteria 18130
173 Ga0207689_10104120 3300025942 Bacteria 2332
174 Ga0207661_10001533 3300025944 Bacteria 15692
175 Ga0207679_10002058 3300025945 Bacteria 12483
176 Ga0207667_10021712 3300025949 Bacteria 7112
177 Ga0207658_10001237 3300025986 Bacteria 20199
178 Ga0207677_10327192 3300026023 Bacteria 1276
179 Ga0207703_10000958 3300026035 Bacteria 27893
180 Ga0207703_10025222 3300026035 Bacteria 4676
181 Ga0207639_10001173 3300026041 Bacteria 17796
182 Ga0207678_10191554 3300026067 Bacteria 1748
183 Ga0207702_10001460 3300026078 Bacteria 23509
184 Ga0207641_10012959 3300026088 Bacteria 6841
185 Ga0207641_10064796 3300026088 Bacteria 3124
186 Ga0207641_10283112 3300026088 Bacteria 1560
187 Ga0207676_10031536 3300026095 Bacteria 3987
188 Ga0207674_10114464 3300026116 Bacteria 2669
189 Ga0207674_10378916 3300026116 Bacteria 1368
190 Ga0207683_10118500 3300026121 Bacteria 2375
191 Ga0207698_10004457 3300026142 Bacteria 8539
192 Ga0268266_10032245 3300028379 Bacteria 4452
193 Ga0307515_10000008 3300028794 Bacteria 663660
194 Ga0265324_10032000 3300029957 Bacteria 1840
195 Ga0265325_10002952 3300031241 Bacteria 11307
196 Ga0265340_10038732 3300031247 Bacteria 2356
197 Ga0265331_10061923 3300031250 Bacteria 1766
198 Ga0265316_10020245 3300031344 Bacteria 5668
199 Ga0307408_100035864 3300031548 Bacteria 3482
200 Ga0265313_10016836 3300031595 Bacteria 4188
201 Ga0265342_10038304 3300031712 Bacteria 2920
202 Ga0307412_10001148 3300031911 Bacteria 15196
203 Ga0307411_10216826 3300032005 Bacteria 1482
204 Ga0395899_0002927 3300037312 Bacteria 13695
205 Ga0395899_0042371 3300037312 Bacteria 3398
206 Ga0395899_0049567 3300037312 Bacteria 3121
207 Ga0395899_0094938 3300037312 Bacteria 2157
208 Ga0395899_0138561 3300037312 Bacteria 1733
209 Ga0395899_0153243 3300037312 Bacteria 1632
210 Ga0395900_0003463 3300037418 Bacteria 17041
211 Ga0395900_0083876 3300037418 Bacteria 3274
212 Ga0395900_0098236 3300037418 Bacteria 3008
213 Ga0395900_0335914 3300037418 Bacteria 1487
214 Ga0395900_0450047 3300037418 Bacteria 1244
215 Ga0395898_0073617 3300037466 Bacteria 3300
216 Ga0395898_0182322 3300037466 Bacteria 2007
217 Ga0395898_0314704 3300037466 Bacteria 1493
218 Ga0395905_0008338 3300037471 Bacteria 10221
219 Ga0395905_0017198 3300037471 Bacteria 6869
220 Ga0395905_0032792 3300037471 Bacteria 4883
221 Ga0395905_0050916 3300037471 Bacteria 3879
222 Ga0395905_0061364 3300037471 Bacteria 3517
223 Ga0395905_0094651 3300037471 Bacteria 2802
224 Ga0395905_0312152 3300037471 Bacteria 1461
225 Ga0395901_0116920 3300038443 Bacteria 2802
226 Ga0395901_0117103 3300038443 Bacteria 2799
227 Ga0395901_0192446 3300038443 Bacteria 2139
228 Ga0395901_0217899 3300038443 Bacteria 1995
229 Ga0395901_0628223 3300038443 Bacteria 1080
230 Ga0436365_1771244 3300039437 Bacteria 100199
231 Ga0439439_0014527 3300041406 Bacteria 1918
232 Ga0439461_0000383 3300041410 Bacteria 6329
233 Ga0439461_0021851 3300041410 Bacteria 1277
234 Ga0439465_0003201 3300041413 Bacteria 5337
235 Ga0439465_0004489 3300041413 Bacteria 4512
236 Ga0451806_647330 3300041462 Bacteria 5454
237 Ga0451835_1144302 3300041492 Bacteria 1421
238 Ga0439431_0001161 3300041997 Bacteria 5750
239 Ga0439431_0026069 3300041997 Bacteria 1430
240 Ga0439442_017367 3300042002 Bacteria 1484
241 Ga0439445_0047068 3300042004 Bacteria 1157
242 Ga0439448_0010478 3300042005 Bacteria 2752
243 Ga0439432_000353 3300042006 Bacteria 16810
244 Ga0439452_008312 3300042010 Bacteria 3133
245 Ga0439457_016077 3300042014 Bacteria 1670
246 Ga0439462_0007993 3300042015 Bacteria 2660
247 Ga0439446_0012252 3300042156 Bacteria 2341
248 Ga0439434_0021650 3300042435 Bacteria 1931
249 Ga0439444_0010653 3300042437 Bacteria 1473
250 Ga0466972_0006464 3300044658 Bacteria 5888
251 Ga0466965_0030009 3300044683 Bacteria 2647
252 Ga0466966_0003133 3300044684 Bacteria 10882
253 Ga0466966_0057247 3300044684 Bacteria 2464
254 Ga0466966_0059018 3300044684 Bacteria 2423
255 Ga0466961_0109150 3300044693 Bacteria 1741
256 Ga0466963_0008115 3300044694 Bacteria 6287
257 Ga0466964_0015850 3300044706 Bacteria 2869
258 Ga0466964_0082127 3300044706 Bacteria 1385
259 Ga0466971_0012416 3300044719 Bacteria 3732
260 Ga0466971_0023724 3300044719 Bacteria 2735
261 Ga0466968_0005157 3300044735 Bacteria 4887
262 Ga0466959_0020509 3300045049 Bacteria 4870
263 Ga0466959_0058294 3300045049 Bacteria 2812
264 Ga0466959_0163587 3300045049 Bacteria 1563
265 Ga0466959_0216656 3300045049 Bacteria 1329
266 Ga0466959_0393789 3300045049 Bacteria 942
267 Ga0466958_0008305 3300045836 Bacteria 5750
268 Ga0466958_0049147 3300045836 Bacteria 2551
269 Ga0466958_0131599 3300045836 Bacteria 1571
270 Ga0466958_0342949 3300045836 Bacteria 961
271 Ga0466967_0214508 3300045976 Bacteria 1827
272 Ga0466967_0448720 3300045976 Bacteria 1260
273 Ga0495617_002840 3300046452 Bacteria 6673
274 Ga0495590_0000083 3300046457 Bacteria 62385
275 Ga0495590_0019249 3300046457 Bacteria 2434
276 Ga0495590_0020443 3300046457 Bacteria 2352
277 Ga0495629_0242190 3300046459 Bacteria 1242
278 Ga0495653_0005130 3300046463 Bacteria 10629
279 Ga0495653_0012698 3300046463 Bacteria 6880
280 Ga0495650_0000108 3300046471 Bacteria 200369
281 Ga0495650_0000910 3300046471 Bacteria 34842
282 Ga0495580_0060753 3300046472 Bacteria 2654
283 Ga0495582_0007566 3300046473 Bacteria 6009
284 Ga0495605_0000184 3300046474 Bacteria 77694
285 Ga0495605_0013505 3300046474 Bacteria 4496
286 Ga0495584_0000166 3300046491 Bacteria 46836
287 Ga0495584_0029430 3300046491 Bacteria 2783
288 Ga0495584_0049918 3300046491 Bacteria 2107
289 Ga0495585_0059706 3300046492 Bacteria 2101
290 Ga0495594_0024558 3300046499 Bacteria 3238
291 Ga0495596_0004701 3300046500 Bacteria 6598
292 Ga0495596_0023367 3300046500 Bacteria 2509
293 Ga0495607_0000461 3300046501 Bacteria 40750
294 Ga0495607_0003694 3300046501 Bacteria 11605
295 Ga0495607_0005793 3300046501 Bacteria 8790
296 Ga0495606_0000004 3300046507 Bacteria 406209
297 Ga0495606_0000030 3300046507 Bacteria 249484
298 Ga0495606_0000179 3300046507 Bacteria 111712
299 Ga0495606_0004288 3300046507 Bacteria 14371
300 Ga0495610_0004497 3300046512 Bacteria 10283
301 Ga0495610_0005665 3300046512 Bacteria 8808
302 Ga0495616_0004100 3300046513 Bacteria 9239
303 Ga0495616_0022414 3300046513 Bacteria 3411
304 Ga0495631_0041082 3300046518 Bacteria 2047
305 Ga0495632_0013375 3300046519 Bacteria 4685
306 Ga0495632_0015239 3300046519 Bacteria 4321
307 Ga0495637_0010787 3300046520 Bacteria 4404
308 Ga0495643_0000051 3300046522 Bacteria 207804
309 Ga0495643_0008562 3300046522 Bacteria 6461
310 Ga0495643_0014611 3300046522 Bacteria 4667
311 Ga0495643_0085545 3300046522 Bacteria 1635
312 Ga0495643_0107785 3300046522 Bacteria 1419
313 Ga0495648_0005131 3300046524 Bacteria 10967
314 Ga0495648_0038505 3300046524 Bacteria 3056
315 Ga0495648_0047600 3300046524 Bacteria 2648
316 Ga0495666_0013927 3300046526 Bacteria 4010
317 Ga0495642_0002510 3300046528 Bacteria 7435
318 Ga0495642_0007803 3300046528 Bacteria 4101
319 Ga0495642_0029081 3300046528 Bacteria 2204
320 Ga0495652_0018619 3300046529 Bacteria 6188
321 Ga0495665_0009623 3300046531 Bacteria 5236
322 Ga0495609_0000002 3300046538 Bacteria 739816
323 Ga0495609_0024374 3300046538 Bacteria 2776
324 Ga0495597_0009429 3300046542 Bacteria 4822
325 Ga0495597_0054482 3300046542 Bacteria 1756
326 Ga0495633_0004233 3300046558 Bacteria 9184
327 Ga0495633_0016078 3300046558 Bacteria 3869
328 Ga0495633_0117991 3300046558 Bacteria 1229
329 Ga0495667_0075052 3300046559 Bacteria 2201
330 Ga0495656_0075499 3300046615 Bacteria 1508
331 Ga0495668_0000714 3300046616 Bacteria 40056
332 Ga0495668_0000767 3300046616 Bacteria 37493
333 Ga0495625_0000682 3300046660 Bacteria 48331
334 Ga0495625_0008719 3300046660 Bacteria 8598
335 Ga0495625_0020326 3300046660 Bacteria 5129
336 Ga0495635_0187267 3300046663 Bacteria 1406
337 Ga0495661_0000149 3300046665 Bacteria 81455
338 Ga0495661_0039670 3300046665 Bacteria 2924
339 Ga0495588_0000067 3300046674 Bacteria 238958
340 Ga0495588_0012543 3300046674 Bacteria 4009
341 Ga0495647_0075900 3300046681 Bacteria 1354
342 Ga0495658_0037677 3300046683 Bacteria 2674
343 Ga0495669_0018935 3300046684 Bacteria 2966
344 Ga0495613_0180091 3300046689 Bacteria 1497
345 Ga0495670_0062165 3300046691 Bacteria 1878
346 Ga0495649_0000629 3300046694 Bacteria 28743
347 Ga0495649_0020527 3300046694 Bacteria 3706
348 Ga0495649_0036451 3300046694 Bacteria 2701
349 Ga0495649_0100083 3300046694 Bacteria 1541
350 Ga0495589_0000009 3300046794 Bacteria 256265
351 Ga0495589_0000062 3300046794 Bacteria 104349
352 Ga0495589_0027311 3300046794 Bacteria 2886
353 Ga0495600_0159809 3300046809 Bacteria 1457
354 Ga0495660_0000082 3300046810 Bacteria 101508
355 Ga0495660_0063376 3300046810 Bacteria 1980
356 Ga0495660_0102362 3300046810 Bacteria 1472
357 Ga0495660_0138658 3300046810 Bacteria 1212
358 Ga0495604_0012602 3300047317 Bacteria 6726
359 Ga0495672_0000030 3300047320 Bacteria 305021
360 Ga0495672_0000386 3300047320 Bacteria 54325
361 Ga0495672_0000583 3300047320 Bacteria 41254
362 Ga0495672_0012816 3300047320 Bacteria 5825
363 Ga0495676_0281021 3300047321 Bacteria 1127
364 Ga0495683_0010909 3300047323 Bacteria 4791
365 Ga0495683_0087586 3300047323 Bacteria 1512
366 Ga0495687_000013 3300047443 Bacteria 371058
367 Ga0495687_000177 3300047443 Bacteria 94301
368 Ga0495687_001942 3300047443 Bacteria 17728
369 Ga0495675_0020661 3300047444 Bacteria 4191
370 Ga0495675_0036946 3300047444 Bacteria 3113
371 Ga0495677_0000043 3300047445 Bacteria 75056
372 Ga0495677_0000136 3300047445 Bacteria 34884
373 Ga0495677_0002219 3300047445 Bacteria 7692
374 Ga0495679_003235 3300047446 Bacteria 7910
375 Ga0495686_0007773 3300047472 Bacteria 7983
376 Ga0495686_0014054 3300047472 Bacteria 5529
377 Ga0495686_0120977 3300047472 Bacteria 1560
378 Ga0495686_0158913 3300047472 Bacteria 1322
379 Ga0495602_0015986 3300048088 Bacteria 7555
380 Ga0495602_0241788 3300048088 Bacteria 1350
381 Ga0495626_0000939 3300048091 Bacteria 25371
382 Ga0496102_0359992 3300048905 Bacteria 1370
383 Ga0496106_0007591 3300048909 Bacteria 8021
384 Ga0496109_0056692 3300048912 Bacteria 3575
385 Ga0496109_0067715 3300048912 Bacteria 3272
386 Ga0496110_0248722 3300048913 Bacteria 1618
387 Ga0496111_0274121 3300048914 Bacteria 1251
388 Ga0496113_0001504 3300048916 Bacteria 13054
389 Ga0496113_0407567 3300048916 Bacteria 1092
390 Ga0496115_0008541 3300048918 Bacteria 7580
391 Ga0496117_0002981 3300048920 Bacteria 20405
392 Ga0496120_0066891 3300048923 Bacteria 1986
393 Ga0496120_0111933 3300048923 Bacteria 1425
394 Ga0496121_0000114 3300048924 Bacteria 179427
395 Ga0496121_0289262 3300048924 Bacteria 1117
396 Ga0496122_0008604 3300048925 Bacteria 10958
397 Ga0496122_0013519 3300048925 Bacteria 7983
398 Ga0496123_0024980 3300048926 Bacteria 4520
399 Ga0496123_0040801 3300048926 Bacteria 3227
400 Ga0496123_0057122 3300048926 Bacteria 2543
401 Ga0496124_0000761 3300048927 Bacteria 52586
402 Ga0496124_0010159 3300048927 Bacteria 9574
403 Ga0496124_0017687 3300048927 Bacteria 6710
404 Ga0496124_0024053 3300048927 Bacteria 5546
405 Ga0496124_0030582 3300048927 Bacteria 4777
406 Ga0496124_0071107 3300048927 Bacteria 2885
407 Ga0496124_0143517 3300048927 Bacteria 1881
408 Ga0496126_0061318 3300048929 Bacteria 3379
409 Ga0495678_001673 3300049459 Bacteria 16843
410 Ga0495678_009989 3300049459 Bacteria 4644
411 Ga0501033_0106124 3300049570 Bacteria 2046
412 Ga0501202_009137 3300049652 Bacteria 1816
413 Ga0501044_0101960 3300049823 Bacteria 2887
414 nmdc:mga07m45_76876_c1 3300050496 Bacteria 1903
415 nmdc:mga05p37_66698_c1 3300050507 Bacteria 4426
416 nmdc:mga09592_36302_c1 3300050508 Bacteria 4127
417 nmdc:mga0qj67_70982_c1 3300050509 Bacteria 2779
418 nmdc:mga06r32_427841_c1 3300050510 Bacteria 1305
419 Ga0495601_0116989 3300053077 Bacteria 1729
420 Ga0495619_0021338 3300053085 Bacteria 4133
421 Ga0500643_026430 3300053087 Bacteria 1817
422 Ga0500566_0001095 3300053094 Bacteria 15682
423 Ga0500658_0015439 3300053134 Bacteria 2836
424 Ga0500559_0041324 3300053136 Bacteria 2010
425 Ga0500559_0062378 3300053136 Bacteria 1664
426 Ga0500559_0171395 3300053136 Bacteria 1021
427 Ga0500604_0015748 3300053151 Bacteria 2075
428 Ga0500596_001543 3300053735 Bacteria 4667
429 Ga0466962_0008080 3300061719 Bacteria 5044
430 Ga0466962_0058951 3300061719 Bacteria 1832

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053136 Ga0500559_0171395 Ga0500559_0171395_241_963 235
2 3300038443 Ga0395901_0628223 Ga0395901_0628223_30_821 255
3 3300042002 Ga0439442_017367 Ga0439442_017367_23_853 271
4 3300005435 Ga0070714_100180892 Ga0070714_1001808922 273
5 3300037418 Ga0395900_0450047 Ga0395900_0450047_37_879 273
6 3300045049 Ga0466959_0393789 Ga0466959_0393789_87_932 273
7 3300046538 Ga0495609_0024374 Ga0495609_0024374_11_856 273
8 3300029957 Ga0265324_10032000 Ga0265324_100320002 279
9 3300046518 Ga0495631_0041082 Ga0495631_0041082_33_896 279
10 3300046528 Ga0495642_0029081 Ga0495642_0029081_941_1804 279
11 3300046694 Ga0495649_0100083 Ga0495649_0100083_245_1108 279
12 3300047446 Ga0495679_003235 Ga0495679_003235_6594_7457 279
13 3300048923 Ga0496120_0111933 Ga0496120_0111933_117_1034 282
14 3300048926 Ga0496123_0040801 Ga0496123_0040801_1013_1930 282
15 3300048927 Ga0496124_0017687 Ga0496124_0017687_5805_6695 283
16 3300037312 Ga0395899_0138561 Ga0395899_0138561_59_997 284
17 3300037466 Ga0395898_0182322 Ga0395898_0182322_55_993 286
18 3300031595 Ga0265313_10016836 Ga0265313_100168362 288
19 3300046507 Ga0495606_0000030 Ga0495606_0000030_234247_235164 288
20 3300046660 Ga0495625_0008719 Ga0495625_0008719_5911_6798 289
21 3300009174 Ga0105241_10029401 Ga0105241_100294014 290
22 3300048905 Ga0496102_0359992 Ga0496102_0359992_181_1098 290
23 3300048924 Ga0496121_0289262 Ga0496121_0289262_94_996 290
24 3300053087 Ga0500643_026430 Ga0500643_026430_263_1150 290
25 3300053134 Ga0500658_0015439 Ga0500658_0015439_1129_2016 290
26 iso_pu_bacteria 2848297114 2848299640 290
27 3300048918 Ga0496115_0008541 Ga0496115_0008541_6081_6974 291
28 3300009093 Ga0105240_10000120 Ga0105240_1000012041 292
29 3300010375 Ga0105239_10014202 Ga0105239_100142025 292
30 3300025913 Ga0207695_10000204 Ga0207695_1000020443 292
31 3300028794 Ga0307515_10000008 Ga0307515_10000008186 292
32 3300041462 Ga0451806_647330 Ga0451806_647330_2480_3373 292
33 3300041492 Ga0451835_1144302 Ga0451835_1144302_25_918 292
34 3300046810 Ga0495660_0063376 Ga0495660_0063376_43_1002 292
35 3300053136 Ga0500559_0062378 Ga0500559_0062378_14_907 292
36 3300053735 Ga0500596_001543 Ga0500596_001543_3242_4189 292
37 iso_pu_bacteria 2879163058 2879163752 292
38 3300025921 Ga0207652_10001433 Ga0207652_1000143312 293
39 3300031247 Ga0265340_10038732 Ga0265340_100387321 293
40 3300031250 Ga0265331_10061923 Ga0265331_100619232 293
41 3300031344 Ga0265316_10020245 Ga0265316_100202456 293
42 3300031712 Ga0265342_10038304 Ga0265342_100383043 293
43 3300046522 Ga0495643_0008562 Ga0495643_0008562_5313_6290 293
44 iso_pu_bacteria 2928027323 2928031203 293
45 iso_pu_bacteria 2984555340 2984556871 293
46 iso_pu_bacteria 2984564862 2984568823 293
47 iso_pu_bacteria 2993356040 2993359813 293
48 iso_pu_bacteria 8047673197 8047674320 293
49 3300003322 rootL2_10007198 rootL2_100071983 294
50 3300046519 Ga0495632_0015239 Ga0495632_0015239_2355_3320 294
51 3300046660 Ga0495625_0020326 Ga0495625_0020326_2826_3734 294
52 3300053094 Ga0500566_0001095 Ga0500566_0001095_863_1762 294
53 iso_pu_bacteria 2643221556 2643798359 294
54 iso_pu_bacteria 2643221684 2644475362 294
55 3300003771 Ga0055526_1000029 Ga0055526_100002945 295
56 3300009036 Ga0105244_10004189 Ga0105244_100041893 295
57 3300013105 Ga0157369_10074847 Ga0157369_100748472 295
58 3300013308 Ga0157375_10131208 Ga0157375_101312083 295
59 3300025263 Ga0209565_1022771 Ga0209565_10227711 295
60 3300025728 Ga0207655_1088673 Ga0207655_10886732 295
61 3300038443 Ga0395901_0192446 Ga0395901_0192446_909_1823 295
62 3300046471 Ga0495650_0000910 Ga0495650_0000910_9778_10692 295
63 3300046616 Ga0495668_0000767 Ga0495668_0000767_32297_33211 295
64 3300048927 Ga0496124_0024053 Ga0496124_0024053_2641_3555 295
65 3300048927 Ga0496124_0030582 Ga0496124_0030582_2652_3566 295
66 3300005262 Ga0065165_1001329 Ga0065165_100132922 296
67 3300006881 Ga0068865_100020743 Ga0068865_1000207433 296
68 3300009147 Ga0114129_10153874 Ga0114129_101538742 296
69 3300009177 Ga0105248_10118909 Ga0105248_101189093 296
70 3300011119 Ga0105246_10053124 Ga0105246_100531242 296
71 3300013104 Ga0157370_10052719 Ga0157370_100527195 296
72 3300013104 Ga0157370_10075734 Ga0157370_100757342 296
73 3300025941 Ga0207711_10080159 Ga0207711_100801593 296
74 3300025942 Ga0207689_10002237 Ga0207689_1000223717 296
75 3300039437 Ga0436365_1771244 Ga0436365_1771244_17124_18053 296
76 3300042437 Ga0439444_0010653 Ga0439444_0010653_447_1352 296
77 3300044719 Ga0466971_0023724 Ga0466971_0023724_451_1365 296
78 3300045049 Ga0466959_0216656 Ga0466959_0216656_321_1235 296
79 3300046694 Ga0495649_0000629 Ga0495649_0000629_3299_4252 296
80 3300050507 nmdc:mga05p37_66698_c1 nmdc:mga05p37_66698_c1_2475_3404 296
81 3300050508 nmdc:mga09592_36302_c1 nmdc:mga09592_36302_c1_726_1655 296
82 3300050509 nmdc:mga0qj67_70982_c1 nmdc:mga0qj67_70982_c1_1717_2646 296
83 3300050510 nmdc:mga06r32_427841_c1 nmdc:mga06r32_427841_c1_243_1172 296
84 iso_pu_bacteria 2842711865 2842713075 296
85 3300003322 rootL2_10007858 rootL2_1000785818 297
86 3300005262 Ga0065165_1041398 Ga0065165_10413981 297
87 3300005563 Ga0068855_100389483 Ga0068855_1003894832 297
88 3300009551 Ga0105238_10000692 Ga0105238_100006922 297
89 3300010375 Ga0105239_10027416 Ga0105239_100274163 297
90 3300013105 Ga0157369_10003947 Ga0157369_1000394725 297
91 3300013296 Ga0157374_10000241 Ga0157374_1000024162 297
92 3300013297 Ga0157378_10004630 Ga0157378_1000463016 297
93 3300013307 Ga0157372_10002222 Ga0157372_1000222229 297
94 3300013307 Ga0157372_10393495 Ga0157372_103934952 297
95 3300037312 Ga0395899_0002927 Ga0395899_0002927_12605_13522 297
96 3300037312 Ga0395899_0094938 Ga0395899_0094938_850_1767 297
97 3300037312 Ga0395899_0153243 Ga0395899_0153243_39_956 297
98 3300037418 Ga0395900_0098236 Ga0395900_0098236_845_1762 297
99 3300037418 Ga0395900_0335914 Ga0395900_0335914_460_1377 297
100 3300037466 Ga0395898_0073617 Ga0395898_0073617_939_1856 297
101 3300037466 Ga0395898_0314704 Ga0395898_0314704_464_1381 297
102 3300037471 Ga0395905_0008338 Ga0395905_0008338_2789_3706 297
103 3300037471 Ga0395905_0032792 Ga0395905_0032792_71_988 297
104 3300038443 Ga0395901_0217899 Ga0395901_0217899_113_1030 297
105 3300044658 Ga0466972_0006464 Ga0466972_0006464_460_1377 297
106 3300044683 Ga0466965_0030009 Ga0466965_0030009_1215_2132 297
107 3300044684 Ga0466966_0003133 Ga0466966_0003133_4084_5001 297
108 3300044706 Ga0466964_0015850 Ga0466964_0015850_572_1489 297
109 3300044735 Ga0466968_0005157 Ga0466968_0005157_1478_2395 297
110 3300045049 Ga0466959_0058294 Ga0466959_0058294_836_1753 297
111 3300045049 Ga0466959_0163587 Ga0466959_0163587_273_1190 297
112 3300045836 Ga0466958_0049147 Ga0466958_0049147_401_1318 297
113 3300045836 Ga0466958_0131599 Ga0466958_0131599_77_994 297
114 3300045836 Ga0466958_0342949 Ga0466958_0342949_26_943 297
115 3300045976 Ga0466967_0214508 Ga0466967_0214508_180_1097 297
116 3300046457 Ga0495590_0020443 Ga0495590_0020443_241_1158 297
117 3300046474 Ga0495605_0000184 Ga0495605_0000184_64636_65553 297
118 3300046491 Ga0495584_0000166 Ga0495584_0000166_2683_3600 297
119 3300046501 Ga0495607_0003694 Ga0495607_0003694_1248_2165 297
120 3300046507 Ga0495606_0004288 Ga0495606_0004288_788_1705 297
121 3300046513 Ga0495616_0022414 Ga0495616_0022414_965_1882 297
122 3300046522 Ga0495643_0014611 Ga0495643_0014611_1248_2165 297
123 3300046522 Ga0495643_0107785 Ga0495643_0107785_75_992 297
124 3300046524 Ga0495648_0005131 Ga0495648_0005131_1448_2365 297
125 3300046528 Ga0495642_0002510 Ga0495642_0002510_3074_3991 297
126 3300046542 Ga0495597_0054482 Ga0495597_0054482_812_1729 297
127 3300046615 Ga0495656_0075499 Ga0495656_0075499_555_1472 297
128 3300046665 Ga0495661_0039670 Ga0495661_0039670_853_1770 297
129 3300046674 Ga0495588_0000067 Ga0495588_0000067_1986_2903 297
130 3300046694 Ga0495649_0020527 Ga0495649_0020527_1597_2514 297
131 3300046794 Ga0495589_0000062 Ga0495589_0000062_40016_40933 297
132 3300046810 Ga0495660_0000082 Ga0495660_0000082_27596_28513 297
133 3300046810 Ga0495660_0102362 Ga0495660_0102362_290_1207 297
134 3300046810 Ga0495660_0138658 Ga0495660_0138658_237_1154 297
135 3300047320 Ga0495672_0000583 Ga0495672_0000583_18733_19650 297
136 3300047323 Ga0495683_0010909 Ga0495683_0010909_73_990 297
137 3300047443 Ga0495687_000177 Ga0495687_000177_55856_56773 297
138 3300047443 Ga0495687_001942 Ga0495687_001942_7045_7962 297
139 3300047445 Ga0495677_0002219 Ga0495677_0002219_1921_2838 297
140 3300048909 Ga0496106_0007591 Ga0496106_0007591_6339_7256 297
141 3300048914 Ga0496111_0274121 Ga0496111_0274121_316_1236 297
142 3300048923 Ga0496120_0066891 Ga0496120_0066891_414_1346 297
143 3300048925 Ga0496122_0013519 Ga0496122_0013519_1758_2678 297
144 3300048927 Ga0496124_0000761 Ga0496124_0000761_7172_8104 297
145 3300048927 Ga0496124_0071107 Ga0496124_0071107_873_1790 297
146 3300049652 Ga0501202_009137 Ga0501202_009137_769_1737 297
147 3300061719 Ga0466962_0058951 Ga0466962_0058951_109_1026 297
148 3300002075 JGI24738J21930_10004279 JGI24738J21930_100042793 298
149 3300002774 JGI25150J39212_1007286 JGI25150J39212_10072862 298
150 3300025245 Ga0207425_1002582 Ga0207425_10025822 298
151 3300025297 Ga0209758_1000343 Ga0209758_100034358 298
152 3300046452 Ga0495617_002840 Ga0495617_002840_4962_5885 298
153 3300046501 Ga0495607_0005793 Ga0495607_0005793_2179_3099 298
154 3300046507 Ga0495606_0000004 Ga0495606_0000004_163734_164654 298
155 3300046512 Ga0495610_0004497 Ga0495610_0004497_9186_10106 298
156 3300046512 Ga0495610_0005665 Ga0495610_0005665_6142_7062 298
157 3300046520 Ga0495637_0010787 Ga0495637_0010787_822_1745 298
158 3300046522 Ga0495643_0000051 Ga0495643_0000051_193881_194801 298
159 3300046524 Ga0495648_0038505 Ga0495648_0038505_475_1395 298
160 3300046558 Ga0495633_0004233 Ga0495633_0004233_5969_6889 298
161 3300046558 Ga0495633_0117991 Ga0495633_0117991_241_1161 298
162 3300046616 Ga0495668_0000714 Ga0495668_0000714_35752_36672 298
163 3300046694 Ga0495649_0036451 Ga0495649_0036451_805_1725 298
164 3300047320 Ga0495672_0000030 Ga0495672_0000030_289821_290741 298
165 3300047472 Ga0495686_0007773 Ga0495686_0007773_74_994 298
166 3300047472 Ga0495686_0158913 Ga0495686_0158913_31_954 298
167 3300049459 Ga0495678_001673 Ga0495678_001673_2987_3907 298
168 3300049823 Ga0501044_0101960 Ga0501044_0101960_1441_2379 298
169 3300005457 Ga0070662_100154777 Ga0070662_1001547771 299
170 3300032005 Ga0307411_10216826 Ga0307411_102168262 299
171 3300041410 Ga0439461_0021851 Ga0439461_0021851_67_981 299
172 3300041413 Ga0439465_0004489 Ga0439465_0004489_473_1387 299
173 3300042004 Ga0439445_0047068 Ga0439445_0047068_19_933 299
174 3300046507 Ga0495606_0000179 Ga0495606_0000179_103146_104072 299
175 3300049570 Ga0501033_0106124 Ga0501033_0106124_380_1324 299
176 iso_pu_bacteria 8054302542 8054303433 299
177 3300005336 Ga0070680_100035008 Ga0070680_1000350083 300
178 3300025917 Ga0207660_10000753 Ga0207660_1000075317 300
179 3300046463 Ga0495653_0005130 Ga0495653_0005130_490_1416 300
180 3300046471 Ga0495650_0000108 Ga0495650_0000108_161805_162731 300
181 3300046473 Ga0495582_0007566 Ga0495582_0007566_4398_5324 300
182 3300046474 Ga0495605_0013505 Ga0495605_0013505_811_1737 300
183 3300046500 Ga0495596_0004701 Ga0495596_0004701_4609_5535 300
184 3300046500 Ga0495596_0023367 Ga0495596_0023367_520_1446 300
185 3300046524 Ga0495648_0047600 Ga0495648_0047600_1014_1940 300
186 3300046531 Ga0495665_0009623 Ga0495665_0009623_1695_2621 300
187 3300046794 Ga0495589_0027311 Ga0495589_0027311_1069_1995 300
188 3300047320 Ga0495672_0000386 Ga0495672_0000386_3678_4604 300
189 3300047320 Ga0495672_0012816 Ga0495672_0012816_1956_2924 300
190 3300047321 Ga0495676_0281021 Ga0495676_0281021_77_1003 300
191 3300047323 Ga0495683_0087586 Ga0495683_0087586_519_1445 300
192 3300053136 Ga0500559_0041324 Ga0500559_0041324_843_1769 300
193 3300005345 Ga0070692_10010420 Ga0070692_100104201 301
194 3300031911 Ga0307412_10001148 Ga0307412_1000114810 301
195 3300037471 Ga0395905_0312152 Ga0395905_0312152_272_1240 301
196 3300041406 Ga0439439_0014527 Ga0439439_0014527_312_1232 301
197 3300041997 Ga0439431_0001161 Ga0439431_0001161_4473_5393 301
198 3300048924 Ga0496121_0000114 Ga0496121_0000114_73807_74757 301
199 iso_pu_bacteria 2857558681 2857560166 301
200 3300025904 Ga0207647_10005383 Ga0207647_100053834 303
201 3300025932 Ga0207690_10016326 Ga0207690_100163262 303
202 3300003759 Ga0055525_1000073 Ga0055525_100007321 304
203 3300005327 Ga0070658_10163619 Ga0070658_101636192 304
204 3300005339 Ga0070660_100074314 Ga0070660_1000743142 304
205 3300005563 Ga0068855_100493491 Ga0068855_1004934911 304
206 3300006195 Ga0075366_10204565 Ga0075366_102045651 304
207 3300015261 Ga0182006_1066580 Ga0182006_10665801 304
208 3300025230 Ga0209563_100007 Ga0209563_1000071224 304
209 3300025254 Ga0209148_1000495 Ga0209148_100049512 304
210 3300025292 Ga0209676_1043288 Ga0209676_10432881 304
211 3300025295 Ga0209564_1034462 Ga0209564_10344622 304
212 3300025919 Ga0207657_10096434 Ga0207657_100964342 304
213 3300026121 Ga0207683_10118500 Ga0207683_101185001 304
214 3300037312 Ga0395899_0042371 Ga0395899_0042371_1749_2684 304
215 3300037418 Ga0395900_0003463 Ga0395900_0003463_8074_9009 304
216 3300041410 Ga0439461_0000383 Ga0439461_0000383_3974_4903 304
217 3300041413 Ga0439465_0003201 Ga0439465_0003201_4056_4985 304
218 3300042006 Ga0439432_000353 Ga0439432_000353_15842_16771 304
219 3300042010 Ga0439452_008312 Ga0439452_008312_1691_2620 304
220 3300042015 Ga0439462_0007993 Ga0439462_0007993_773_1702 304
221 3300042156 Ga0439446_0012252 Ga0439446_0012252_825_1754 304
222 3300044684 Ga0466966_0057247 Ga0466966_0057247_695_1630 304
223 3300044684 Ga0466966_0059018 Ga0466966_0059018_794_1729 304
224 3300044693 Ga0466961_0109150 Ga0466961_0109150_112_1047 304
225 3300044706 Ga0466964_0082127 Ga0466964_0082127_174_1109 304
226 3300045049 Ga0466959_0020509 Ga0466959_0020509_2808_3743 304
227 3300046457 Ga0495590_0000083 Ga0495590_0000083_43738_44682 304
228 3300046457 Ga0495590_0019249 Ga0495590_0019249_703_1647 304
229 3300046463 Ga0495653_0012698 Ga0495653_0012698_66_1010 304
230 3300046472 Ga0495580_0060753 Ga0495580_0060753_1080_2024 304
231 3300046499 Ga0495594_0024558 Ga0495594_0024558_826_1770 304
232 3300046522 Ga0495643_0085545 Ga0495643_0085545_15_947 304
233 3300046526 Ga0495666_0013927 Ga0495666_0013927_1564_2508 304
234 3300046529 Ga0495652_0018619 Ga0495652_0018619_5055_5999 304
235 3300046674 Ga0495588_0012543 Ga0495588_0012543_2765_3709 304
236 3300047317 Ga0495604_0012602 Ga0495604_0012602_3512_4456 304
237 3300047444 Ga0495675_0020661 Ga0495675_0020661_2296_3240 304
238 3300047444 Ga0495675_0036946 Ga0495675_0036946_1447_2385 304
239 3300048088 Ga0495602_0015986 Ga0495602_0015986_2615_3559 304
240 3300048912 Ga0496109_0067715 Ga0496109_0067715_2262_3197 304
241 3300048916 Ga0496113_0001504 Ga0496113_0001504_5163_6098 304
242 3300048925 Ga0496122_0008604 Ga0496122_0008604_2223_3158 304
243 3300048926 Ga0496123_0024980 Ga0496123_0024980_2954_3889 304
244 3300048927 Ga0496124_0143517 Ga0496124_0143517_866_1801 304
245 iso_pu_bacteria 2857504554 2857509224 304
246 3300005577 Ga0068857_100086566 Ga0068857_1000865663 305
247 3300005578 Ga0068854_100014492 Ga0068854_1000144923 305
248 3300009174 Ga0105241_10033155 Ga0105241_100331552 305
249 3300009177 Ga0105248_10000299 Ga0105248_1000029933 305
250 3300009545 Ga0105237_10140406 Ga0105237_101404063 305
251 3300009551 Ga0105238_10078867 Ga0105238_100788672 305
252 3300013100 Ga0157373_10009075 Ga0157373_100090755 305
253 3300013102 Ga0157371_10001635 Ga0157371_100016359 305
254 3300013104 Ga0157370_10021638 Ga0157370_100216384 305
255 3300013296 Ga0157374_10019355 Ga0157374_100193555 305
256 3300014325 Ga0163163_10000341 Ga0163163_1000034135 305
257 3300014968 Ga0157379_10039325 Ga0157379_100393252 305
258 3300025914 Ga0207671_10003710 Ga0207671_100037103 305
259 3300025925 Ga0207650_10080348 Ga0207650_100803482 305
260 3300025927 Ga0207687_10160530 Ga0207687_101605302 305
261 3300026116 Ga0207674_10114464 Ga0207674_101144642 305
262 3300046491 Ga0495584_0029430 Ga0495584_0029430_940_1887 305
263 3300046501 Ga0495607_0000461 Ga0495607_0000461_31544_32491 305
264 3300046513 Ga0495616_0004100 Ga0495616_0004100_7127_8074 305
265 3300046528 Ga0495642_0007803 Ga0495642_0007803_2296_3243 305
266 3300046538 Ga0495609_0000002 Ga0495609_0000002_678022_678969 305
267 3300046542 Ga0495597_0009429 Ga0495597_0009429_1410_2369 305
268 3300046665 Ga0495661_0000149 Ga0495661_0000149_57869_58816 305
269 3300046794 Ga0495589_0000009 Ga0495589_0000009_57887_58834 305
270 3300047443 Ga0495687_000013 Ga0495687_000013_57887_58834 305
271 3300047445 Ga0495677_0000043 Ga0495677_0000043_16236_17183 305
272 3300047472 Ga0495686_0120977 Ga0495686_0120977_230_1192 305
273 3300048091 Ga0495626_0000939 Ga0495626_0000939_17774_18721 305
274 3300048913 Ga0496110_0248722 Ga0496110_0248722_346_1290 305
275 3300048926 Ga0496123_0057122 Ga0496123_0057122_1089_2045 305
276 3300048927 Ga0496124_0010159 Ga0496124_0010159_7865_8821 305
277 3300037312 Ga0395899_0049567 Ga0395899_0049567_976_1917 306
278 3300037471 Ga0395905_0094651 Ga0395905_0094651_1187_2128 306
279 iso_pu_bacteria 2599185359 2600228274 306
280 iso_pu_bacteria 2818991466 2819714782 306
281 iso_pu_bacteria 2928526807 2928529343 306
282 iso_pu_bacteria 2928968154 2928968831 306
283 3300003323 rootH1_10052949 rootH1_100529492 307
284 3300005459 Ga0068867_100225708 Ga0068867_1002257081 307
285 3300005719 Ga0068861_100401046 Ga0068861_1004010461 307
286 3300010375 Ga0105239_10379449 Ga0105239_103794491 307
287 3300013296 Ga0157374_10051983 Ga0157374_100519834 307
288 3300013306 Ga0163162_10224046 Ga0163162_102240461 307
289 3300013308 Ga0157375_10082990 Ga0157375_100829902 307
290 3300025937 Ga0207669_10087143 Ga0207669_100871431 307
291 3300026067 Ga0207678_10191554 Ga0207678_101915542 307
292 3300046459 Ga0495629_0242190 Ga0495629_0242190_138_1100 307
293 3300046559 Ga0495667_0075052 Ga0495667_0075052_403_1365 307
294 3300046663 Ga0495635_0187267 Ga0495635_0187267_417_1379 307
295 3300046681 Ga0495647_0075900 Ga0495647_0075900_64_1026 307
296 3300046683 Ga0495658_0037677 Ga0495658_0037677_496_1458 307
297 3300046689 Ga0495613_0180091 Ga0495613_0180091_452_1414 307
298 3300046809 Ga0495600_0159809 Ga0495600_0159809_50_1012 307
299 3300047445 Ga0495677_0000136 Ga0495677_0000136_32851_33816 307
300 3300048912 Ga0496109_0056692 Ga0496109_0056692_185_1147 307
301 3300048916 Ga0496113_0407567 Ga0496113_0407567_13_975 307
302 3300053077 Ga0495601_0116989 Ga0495601_0116989_293_1255 307
303 3300053085 Ga0495619_0021338 Ga0495619_0021338_677_1639 307
304 3300046491 Ga0495584_0049918 Ga0495584_0049918_399_1364 308
305 3300046519 Ga0495632_0013375 Ga0495632_0013375_813_1778 308
306 3300046558 Ga0495633_0016078 Ga0495633_0016078_963_1928 308
307 3300046684 Ga0495669_0018935 Ga0495669_0018935_1988_2953 308
308 3300046691 Ga0495670_0062165 Ga0495670_0062165_571_1536 308
309 3300049459 Ga0495678_009989 Ga0495678_009989_2354_3319 308
310 iso_pu_bacteria 2643221552 2643781532 309
311 iso_pu_bacteria 2643221584 2643928990 309
312 3300002067 JGI24735J21928_10010988 JGI24735J21928_100109883 310
313 3300005327 Ga0070658_10072521 Ga0070658_100725213 310
314 3300005339 Ga0070660_100037329 Ga0070660_1000373293 310
315 3300005366 Ga0070659_100115466 Ga0070659_1001154662 310
316 3300005539 Ga0068853_100135863 Ga0068853_1001358633 310
317 3300005578 Ga0068854_100379779 Ga0068854_1003797791 310
318 3300005616 Ga0068852_100475624 Ga0068852_1004756241 310
319 3300005842 Ga0068858_100001099 Ga0068858_1000010996 310
320 3300009098 Ga0105245_10001154 Ga0105245_1000115414 310
321 3300009148 Ga0105243_10060576 Ga0105243_100605764 310
322 3300025254 Ga0209148_1005025 Ga0209148_10050253 310
323 3300025272 Ga0209455_1001091 Ga0209455_10010912 310
324 3300025904 Ga0207647_10015183 Ga0207647_100151833 310
325 3300025909 Ga0207705_10029392 Ga0207705_100293922 310
326 3300025919 Ga0207657_10014810 Ga0207657_100148103 310
327 3300025927 Ga0207687_10003903 Ga0207687_100039032 310
328 3300025933 Ga0207706_10011664 Ga0207706_100116643 310
329 3300026035 Ga0207703_10000958 Ga0207703_100009586 310
330 3300037471 Ga0395905_0050916 Ga0395905_0050916_1960_2922 310
331 3300041997 Ga0439431_0026069 Ga0439431_0026069_379_1329 310
332 3300042014 Ga0439457_016077 Ga0439457_016077_175_1125 310
333 3300042435 Ga0439434_0021650 Ga0439434_0021650_102_1052 310
334 3300025272 Ga0209455_1011095 Ga0209455_10110951 311
335 3300037471 Ga0395905_0017198 Ga0395905_0017198_1045_2013 311
336 3300047472 Ga0495686_0014054 Ga0495686_0014054_2600_3553 311
337 3300001979 JGI24740J21852_10007394 JGI24740J21852_100073942 312
338 3300001989 JGI24739J22299_10005088 JGI24739J22299_100050883 312
339 3300001990 JGI24737J22298_10002147 JGI24737J22298_100021472 312
340 3300002075 JGI24738J21930_10003100 JGI24738J21930_100031002 312
341 3300005327 Ga0070658_10000292 Ga0070658_1000029213 312
342 3300005329 Ga0070683_100006338 Ga0070683_1000063384 312
343 3300005330 Ga0070690_100118998 Ga0070690_1001189982 312
344 3300005335 Ga0070666_10005004 Ga0070666_100050046 312
345 3300005339 Ga0070660_100000655 Ga0070660_1000006556 312
346 3300005344 Ga0070661_100000138 Ga0070661_10000013839 312
347 3300005355 Ga0070671_100039537 Ga0070671_1000395372 312
348 3300005366 Ga0070659_100000081 Ga0070659_10000008136 312
349 3300005367 Ga0070667_100005341 Ga0070667_1000053413 312
350 3300005457 Ga0070662_100000025 Ga0070662_1000000257 312
351 3300005535 Ga0070684_100003050 Ga0070684_1000030508 312
352 3300005539 Ga0068853_100001144 Ga0068853_10000114413 312
353 3300005548 Ga0070665_100006346 Ga0070665_1000063467 312
354 3300005563 Ga0068855_100000503 Ga0068855_10000050313 312
355 3300005564 Ga0070664_100000012 Ga0070664_10000001297 312
356 3300005577 Ga0068857_100374471 Ga0068857_1003744712 312
357 3300005614 Ga0068856_100000163 Ga0068856_10000016350 312
358 3300005614 Ga0068856_100013326 Ga0068856_1000133266 312
359 3300005616 Ga0068852_100000426 Ga0068852_10000042611 312
360 3300005618 Ga0068864_100009025 Ga0068864_1000090253 312
361 3300005842 Ga0068858_100020140 Ga0068858_1000201404 312
362 3300013307 Ga0157372_10289986 Ga0157372_102899861 312
363 3300025299 Ga0209256_1000632 Ga0209256_100063228 312
364 3300025903 Ga0207680_10001859 Ga0207680_100018594 312
365 3300025904 Ga0207647_10023256 Ga0207647_100232561 312
366 3300025909 Ga0207705_10000095 Ga0207705_1000009527 312
367 3300025911 Ga0207654_10015882 Ga0207654_100158822 312
368 3300025919 Ga0207657_10000028 Ga0207657_1000002828 312
369 3300025920 Ga0207649_10000014 Ga0207649_10000014214 312
370 3300025924 Ga0207694_10048739 Ga0207694_100487392 312
371 3300025925 Ga0207650_10052322 Ga0207650_100523222 312
372 3300025932 Ga0207690_10000042 Ga0207690_1000004265 312
373 3300025933 Ga0207706_10000029 Ga0207706_1000002933 312
374 3300025941 Ga0207711_10000751 Ga0207711_1000075119 312
375 3300025944 Ga0207661_10001533 Ga0207661_100015338 312
376 3300025945 Ga0207679_10002058 Ga0207679_100020583 312
377 3300025949 Ga0207667_10021712 Ga0207667_100217122 312
378 3300025986 Ga0207658_10001237 Ga0207658_100012378 312
379 3300026023 Ga0207677_10327192 Ga0207677_103271921 312
380 3300026035 Ga0207703_10025222 Ga0207703_100252223 312
381 3300026041 Ga0207639_10001173 Ga0207639_1000117316 312
382 3300026078 Ga0207702_10001460 Ga0207702_100014606 312
383 3300026088 Ga0207641_10283112 Ga0207641_102831122 312
384 3300026095 Ga0207676_10031536 Ga0207676_100315363 312
385 3300026116 Ga0207674_10378916 Ga0207674_103789161 312
386 3300026142 Ga0207698_10004457 Ga0207698_100044572 312
387 3300028379 Ga0268266_10032245 Ga0268266_100322452 312
388 3300046492 Ga0495585_0059706 Ga0495585_0059706_467_1423 312
389 3300048088 Ga0495602_0241788 Ga0495602_0241788_69_1028 312
390 3300002067 JGI24735J21928_10038832 JGI24735J21928_100388321 313
391 3300003773 Ga0055537_1000684 Ga0055537_100068414 313
392 3300005330 Ga0070690_100017853 Ga0070690_1000178533 313
393 3300005530 Ga0070679_100102921 Ga0070679_1001029212 313
394 3300005618 Ga0068864_100448305 Ga0068864_1004483051 313
395 3300005841 Ga0068863_100156704 Ga0068863_1001567042 313
396 3300025246 Ga0209646_1019272 Ga0209646_10192721 313
397 3300025904 Ga0207647_10173127 Ga0207647_101731271 313
398 3300026088 Ga0207641_10064796 Ga0207641_100647962 313
399 3300005539 Ga0068853_100073120 Ga0068853_1000731203 314
400 3300005548 Ga0070665_100000075 Ga0070665_100000075105 314
401 3300046660 Ga0495625_0000682 Ga0495625_0000682_17080_18042 314
402 3300001989 JGI24739J22299_10035169 JGI24739J22299_100351692 315
403 3300003214 JGI25165J46597_1000007 JGI25165J46597_100000733 315
404 3300005335 Ga0070666_10039562 Ga0070666_100395623 315
405 3300005344 Ga0070661_100189769 Ga0070661_1001897691 315
406 3300005355 Ga0070671_100009712 Ga0070671_1000097122 315
407 3300025903 Ga0207680_10015632 Ga0207680_100156322 315
408 3300025931 Ga0207644_10033531 Ga0207644_100335312 315
409 3300025933 Ga0207706_10193687 Ga0207706_101936872 315
410 3300025942 Ga0207689_10104120 Ga0207689_101041202 315
411 3300031241 Ga0265325_10002952 Ga0265325_100029523 315
412 3300038443 Ga0395901_0116920 Ga0395901_0116920_1643_2617 315
413 3300042005 Ga0439448_0010478 Ga0439448_0010478_1499_2464 315
414 3300044694 Ga0466963_0008115 Ga0466963_0008115_3967_4932 315
415 3300044719 Ga0466971_0012416 Ga0466971_0012416_867_1832 315
416 3300045836 Ga0466958_0008305 Ga0466958_0008305_28_993 315
417 3300045976 Ga0466967_0448720 Ga0466967_0448720_166_1131 315
418 3300048920 Ga0496117_0002981 Ga0496117_0002981_13039_14142 315
419 3300048929 Ga0496126_0061318 Ga0496126_0061318_2164_3165 315
420 3300050496 nmdc:mga07m45_76876_c1 nmdc:mga07m45_76876_c1_485_1450 315
421 3300053151 Ga0500604_0015748 Ga0500604_0015748_369_1352 315
422 3300061719 Ga0466962_0008080 Ga0466962_0008080_4049_5014 315
423 3300005329 Ga0070683_100080469 Ga0070683_1000804693 316
424 3300005366 Ga0070659_100099269 Ga0070659_1000992692 316
425 3300005539 Ga0068853_100323678 Ga0068853_1003236781 316
426 3300005841 Ga0068863_100017569 Ga0068863_1000175692 316
427 3300006847 Ga0075431_100118316 Ga0075431_1001183163 316
428 3300009551 Ga0105238_10069615 Ga0105238_100696152 316
429 3300021384 Ga0213876_10000059 Ga0213876_1000005957 316
430 3300025906 Ga0207699_10198972 Ga0207699_101989721 316
431 3300026088 Ga0207641_10012959 Ga0207641_100129595 316
432 3300031548 Ga0307408_100035864 Ga0307408_1000358643 316
433 3300003323 rootH1_10295736 rootH1_102957362 317
434 3300001904 JGI24736J21556_1001172 JGI24736J21556_10011724 318
435 3300001989 JGI24739J22299_10000786 JGI24739J22299_100007865 318
436 3300001989 JGI24739J22299_10001171 JGI24739J22299_100011716 318
437 3300001990 JGI24737J22298_10001980 JGI24737J22298_100019806 318
438 3300001990 JGI24737J22298_10047863 JGI24737J22298_100478631 318
439 3300002067 JGI24735J21928_10000626 JGI24735J21928_1000062612 318
440 3300002075 JGI24738J21930_10000362 JGI24738J21930_100003629 318
441 3300005457 Ga0070662_100003310 Ga0070662_1000033108 318
442 3300013102 Ga0157371_10183147 Ga0157371_101831471 318
443 3300013307 Ga0157372_10015946 Ga0157372_100159468 318
444 3300013307 Ga0157372_10032013 Ga0157372_100320135 318
445 3300025904 Ga0207647_10000270 Ga0207647_1000027019 318
446 3300025933 Ga0207706_10007764 Ga0207706_100077648 318
447 3300037418 Ga0395900_0083876 Ga0395900_0083876_100_1062 318
448 3300037471 Ga0395905_0061364 Ga0395905_0061364_284_1246 318
449 3300038443 Ga0395901_0117103 Ga0395901_0117103_80_1042 318

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

217

287

0.88

PF20434

BD-FAE

BD-FAE

212

299

0.88

PF01738

DLH

Dienelactone hydrolase family

126

352

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q3k-assembly1.cif.gz_B crystal structure of mgs-m1, an alpha/beta hydrolase enzyme from a medee basin deep-sea metagenome library 0.7735 85 314
7dwc-assembly4.cif.gz_D bacteroides thetaiotaomicron vpi5482 btaxe1 0.7726 86 310
6a6o-assembly1.cif.gz_A crystal structure of acetyl ester-xyloside bifunctional hydrolase from caldicellulosiruptor lactoaceticus 0.7612 84 313
1w76-assembly1.cif.gz_A orthorhombic form of torpedo californica acetylcholinesterase (ache) complexed with bis-acting galanthamine derivative 0.7581 83 234
5ydh-assembly1.cif.gz_B crystal structure of acetylcholinesterase catalytic subunits of the malaria vector anopheles gambiae, 3.2 a 0.7308 83 238
ID Description Score Start End Superfamily
af_A0A1D6EGD3_55_198_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.805 100 218 3.40.50.1820
4q3kA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.774 85 314 3.40.50.1820
af_Q04457_5_543_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7567 86 236 3.40.50.1820
af_Q9U295_30_581_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7444 83 235 3.40.50.1820
af_Q21266_11_550_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7404 86 235 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A520JMF0-F1-model_v4 Alpha/beta hydrolase 0.9621 168 317 GO:0016787
AF-A0A3M1GMF0-F1-model_v4 Alpha/beta hydrolase 0.9617 35 318 GO:0016787
AF-V4PKI7-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9593 43 318 GO:0016787
AF-A0A2A4V666-F1-model_v4 Esterase 0.9464 41 311 GO:0016787
AF-V4PKI7-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9458 43 318 GO:0016787

Feature Viewer

pLDDT pTM Quality
84.12 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map