F446379

General Info

Members Datasets Scaffolds Average Seq Length
449 196 898 137

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10063875|Ga0105248_100638753
Length 157
Sequence LIVQARIEVAHEQEANMHAFVLIGALALQAPAPDQPIEGTWRSPGGNTIITIAPCGNGPXXTVAWATEKAKKDAAKTTAQLVGTQLLTNLQKRKDGSWLGKLFIPDRNMRVTAKLQRLSPDSLQVSGCAAGKALCKADIWTAFSASLPTDTSVPAPR

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
131 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
144 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
171 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 11.8
Rhizosphere 87.97
Stem 0
Stem Tuber 0
Unclassified 16.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10063875 3300009177 Bacteria 4133
2 JGI24752J21851_1002732 3300001976 Bacteria 2344
3 JGI24739J22299_10029450 3300001989 Bacteria 1909
4 JGI24737J22298_10001690 3300001990 Bacteria 7875
5 JGI24738J21930_10000780 3300002075 Bacteria 9115
6 JGI24749J21850_1033289 3300002076 Unclassified 744
7 Ga0065712_10249397 3300005290 Bacteria 964
8 Ga0065712_10600381 3300005290 Unclassified 591
9 Ga0065715_10038782 3300005293 Bacteria 1990
10 Ga0070658_10001606 3300005327 Bacteria 19112
11 Ga0070658_10028762 3300005327 Bacteria 4462
12 Ga0070658_10885077 3300005327 Unclassified 776
13 Ga0070676_10420032 3300005328 Bacteria 934
14 Ga0070676_10651276 3300005328 Unclassified 765
15 Ga0070683_100012454 3300005329 Bacteria 7394
16 Ga0070690_100197759 3300005330 Bacteria 1397
17 Ga0070670_100000265 3300005331 Bacteria 46560
18 Ga0070670_100060707 3300005331 Bacteria 3246
19 Ga0070670_101318993 3300005331 Bacteria 661
20 Ga0070677_10314644 3300005333 Bacteria 800
21 Ga0068869_100166582 3300005334 Bacteria 1719
22 Ga0068869_100591253 3300005334 Unclassified 937
23 Ga0070666_10000682 3300005335 Bacteria 20556
24 Ga0070666_10022623 3300005335 Bacteria 4083
25 Ga0070666_10070379 3300005335 Bacteria 2380
26 Ga0070680_100471439 3300005336 Bacteria 1073
27 Ga0070680_100579360 3300005336 Unclassified 963
28 Ga0070682_100029413 3300005337 Bacteria 3308
29 Ga0070682_100200659 3300005337 Bacteria 1407
30 Ga0070682_100928766 3300005337 Unclassified 717
31 Ga0068868_100081379 3300005338 Bacteria 2596
32 Ga0068868_100189719 3300005338 Bacteria 1709
33 Ga0070660_100000779 3300005339 Bacteria 21163
34 Ga0070660_100101088 3300005339 Bacteria 2285
35 Ga0070660_100495578 3300005339 Unclassified 1016
36 Ga0070660_100808665 3300005339 Unclassified 789
37 Ga0070660_100931397 3300005339 Bacteria 733
38 Ga0070660_101027469 3300005339 Unclassified 697
39 Ga0070687_100425882 3300005343 Bacteria 877
40 Ga0070687_100587390 3300005343 Unclassified 763
41 Ga0070661_100001034 3300005344 Bacteria 19690
42 Ga0070661_100095881 3300005344 Unclassified 2201
43 Ga0070661_101267501 3300005344 Unclassified 618
44 Ga0070669_100356955 3300005353 Unclassified 1188
45 Ga0070669_100962577 3300005353 Bacteria 731
46 Ga0070675_100023644 3300005354 Bacteria 4915
47 Ga0070675_100041037 3300005354 Bacteria 3780
48 Ga0070675_100465574 3300005354 Unclassified 1135
49 Ga0070675_100968502 3300005354 Bacteria 781
50 Ga0070671_100011780 3300005355 Bacteria 7034
51 Ga0070671_100014904 3300005355 Bacteria 6281
52 Ga0070671_100034878 3300005355 Bacteria 4166
53 Ga0070671_100053802 3300005355 Bacteria 3346
54 Ga0070671_100084822 3300005355 Bacteria 2649
55 Ga0070671_100312203 3300005355 Bacteria 1339
56 Ga0070671_100340971 3300005355 Bacteria 1278
57 Ga0070674_100010136 3300005356 Bacteria 5678
58 Ga0070673_100306351 3300005364 Bacteria 1400
59 Ga0070673_100368527 3300005364 Bacteria 1278
60 Ga0070673_100849358 3300005364 Unclassified 845
61 Ga0070673_100855996 3300005364 Unclassified 841
62 Ga0070673_100909761 3300005364 Bacteria 816
63 Ga0070659_100000965 3300005366 Bacteria 21162
64 Ga0070659_100044927 3300005366 Bacteria 3460
65 Ga0070659_100084067 3300005366 Bacteria 2545
66 Ga0070659_100177308 3300005366 Bacteria 1748
67 Ga0070659_100552814 3300005366 Unclassified 986
68 Ga0070659_100929822 3300005366 Bacteria 761
69 Ga0070667_100023234 3300005367 Bacteria 5144
70 Ga0070667_100025812 3300005367 Bacteria 4886
71 Ga0070667_100053658 3300005367 Bacteria 3402
72 Ga0070667_102073657 3300005367 Bacteria 536
73 Ga0070713_100826318 3300005436 Unclassified 889
74 Ga0070663_100024455 3300005455 Bacteria 4066
75 Ga0070663_100568236 3300005455 Bacteria 950
76 Ga0070678_100036804 3300005456 Bacteria 3429
77 Ga0070662_100000639 3300005457 Bacteria 21171
78 Ga0070662_100025041 3300005457 Bacteria 4117
79 Ga0070681_10369875 3300005458 Bacteria 1344
80 Ga0070681_10389961 3300005458 Bacteria 1304
81 Ga0070681_10503354 3300005458 Bacteria 1124
82 Ga0070681_11308910 3300005458 Unclassified 647
83 Ga0068867_100454076 3300005459 Bacteria 1093
84 Ga0070679_101011928 3300005530 Bacteria 775
85 Ga0070679_101407827 3300005530 Unclassified 643
86 Ga0070679_101415367 3300005530 Unclassified 642
87 Ga0070684_100078659 3300005535 Bacteria 2914
88 Ga0070684_101229911 3300005535 Bacteria 704
89 Ga0068853_100000847 3300005539 Bacteria 21352
90 Ga0068853_100069783 3300005539 Bacteria 3058
91 Ga0070672_100027075 3300005543 Bacteria 4274
92 Ga0070672_100086719 3300005543 Bacteria 2518
93 Ga0070672_100124616 3300005543 Bacteria 2112
94 Ga0070672_100528910 3300005543 Bacteria 1022
95 Ga0070686_100085581 3300005544 Bacteria 2097
96 Ga0070686_101361142 3300005544 Unclassified 594
97 Ga0070696_100177102 3300005546 Bacteria 1580
98 Ga0070693_100001054 3300005547 Bacteria 12316
99 Ga0070693_100236069 3300005547 Bacteria 1205
100 Ga0070665_100002303 3300005548 Bacteria 21187
101 Ga0070665_101439460 3300005548 Unclassified 698
102 Ga0068855_100001613 3300005563 Bacteria 28302
103 Ga0068855_100218776 3300005563 Bacteria 2137
104 Ga0068855_100300729 3300005563 Bacteria 1777
105 Ga0070664_100001124 3300005564 Bacteria 21163
106 Ga0070664_100013757 3300005564 Bacteria 6594
107 Ga0070664_100016051 3300005564 Bacteria 6136
108 Ga0070664_100298724 3300005564 Bacteria 1455
109 Ga0070664_100340566 3300005564 Bacteria 1362
110 Ga0068857_100100161 3300005577 Bacteria 2599
111 Ga0068857_100334086 3300005577 Bacteria 1401
112 Ga0068857_101225978 3300005577 Bacteria 727
113 Ga0068854_100021144 3300005578 Bacteria 4413
114 Ga0068854_100124064 3300005578 Bacteria 1965
115 Ga0068854_100840389 3300005578 Unclassified 803
116 Ga0068856_100001441 3300005614 Bacteria 24954
117 Ga0068856_100024428 3300005614 Bacteria 5883
118 Ga0068852_100003780 3300005616 Bacteria 10615
119 Ga0068852_100332900 3300005616 Bacteria 1478
120 Ga0068852_100392266 3300005616 Bacteria 1364
121 Ga0068859_100205025 3300005617 Bacteria 2057
122 Ga0068859_100274533 3300005617 Bacteria 1778
123 Ga0068859_101196916 3300005617 Bacteria 837
124 Ga0068864_100020164 3300005618 Bacteria 5577
125 Ga0068864_100034451 3300005618 Bacteria 4307
126 Ga0068864_100036201 3300005618 Bacteria 4205
127 Ga0068864_100059639 3300005618 Bacteria 3302
128 Ga0068864_100632451 3300005618 Unclassified 1041
129 Ga0068851_10054436 3300005834 Bacteria 2038
130 Ga0068851_10059501 3300005834 Bacteria 1954
131 Ga0068851_10822824 3300005834 Bacteria 578
132 Ga0068870_10793734 3300005840 Unclassified 661
133 Ga0068863_100006044 3300005841 Bacteria 11881
134 Ga0068863_100016964 3300005841 Bacteria 6984
135 Ga0068863_100038266 3300005841 Bacteria 4564
136 Ga0068863_102038612 3300005841 Unclassified 584
137 Ga0068858_100002927 3300005842 Bacteria 17178
138 Ga0068858_100029571 3300005842 Bacteria 5088
139 Ga0068858_100110346 3300005842 Bacteria 2569
140 Ga0068858_102429964 3300005842 Unclassified 518
141 Ga0068860_100109277 3300005843 Bacteria 2643
142 Ga0068860_100118978 3300005843 Bacteria 2529
143 Ga0068860_100128271 3300005843 Bacteria 2432
144 Ga0068862_100201661 3300005844 Bacteria 1794
145 Ga0068862_100291541 3300005844 Bacteria 1498
146 Ga0070712_100025124 3300006175 Bacteria 3956
147 Ga0097621_100048503 3300006237 Bacteria 3446
148 Ga0097621_100163421 3300006237 Bacteria 1915
149 Ga0097621_100190477 3300006237 Bacteria 1776
150 Ga0097621_100717041 3300006237 Bacteria 922
151 Ga0068871_100022750 3300006358 Bacteria 4837
152 Ga0068871_100094991 3300006358 Bacteria 2489
153 Ga0068871_100146740 3300006358 Bacteria 2009
154 Ga0068871_100763371 3300006358 Bacteria 889
155 Ga0097620_100205034 3300006931 Bacteria 2057
156 Ga0097620_100274547 3300006931 Bacteria 1778
157 Ga0097620_101196983 3300006931 Bacteria 837
158 Ga0105251_10019646 3300009011 Bacteria 3564
159 Ga0111539_10313383 3300009094 Bacteria 1826
160 Ga0105247_10059676 3300009101 Bacteria 2362
161 Ga0105241_10133032 3300009174 Bacteria 2016
162 Ga0105241_10618458 3300009174 Unclassified 980
163 Ga0105242_11971434 3300009176 Bacteria 626
164 Ga0105248_10002314 3300009177 Bacteria 21126
165 Ga0105248_10052266 3300009177 Bacteria 4585
166 Ga0105248_10089375 3300009177 Bacteria 3467
167 Ga0105248_10201949 3300009177 Bacteria 2240
168 Ga0105237_10410518 3300009545 Bacteria 1359
169 Ga0105238_10125675 3300009551 Bacteria 2543
170 Ga0105238_10391239 3300009551 Bacteria 1382
171 Ga0105246_10169773 3300011119 Bacteria 1669
172 Ga0157373_10090855 3300013100 Bacteria 2150
173 Ga0157373_10126063 3300013100 Bacteria 1800
174 Ga0157373_10136132 3300013100 Bacteria 1727
175 Ga0157371_10004719 3300013102 Bacteria 11773
176 Ga0157371_10169049 3300013102 Bacteria 1562
177 Ga0157371_10419003 3300013102 Bacteria 982
178 Ga0157371_11188614 3300013102 Unclassified 587
179 Ga0157369_10409003 3300013105 Bacteria 1407
180 Ga0157374_10027384 3300013296 Bacteria 5141
181 Ga0157374_10208153 3300013296 Bacteria 1917
182 Ga0157374_10240464 3300013296 Bacteria 1780
183 Ga0157374_10434672 3300013296 Bacteria 1312
184 Ga0157374_11052417 3300013296 Unclassified 833
185 Ga0157378_10164383 3300013297 Bacteria 2078
186 Ga0163162_10041595 3300013306 Bacteria 4600
187 Ga0157372_10314250 3300013307 Bacteria 1824
188 Ga0157375_10005824 3300013308 Bacteria 10723
189 Ga0157375_12216250 3300013308 Bacteria 655
190 Ga0163163_10015399 3300014325 Bacteria 7069
191 Ga0163163_10027400 3300014325 Bacteria 5458
192 Ga0163163_10083710 3300014325 Bacteria 3195
193 Ga0157380_10455647 3300014326 Bacteria 1230
194 Ga0182008_10042897 3300014497 Bacteria 2253
195 Ga0157379_10044665 3300014968 Bacteria 3955
196 Ga0157379_10110087 3300014968 Bacteria 2474
197 Ga0157376_10544248 3300014969 Bacteria 1148
198 Ga0163161_10033552 3300017792 Bacteria 3667
199 Ga0207697_10064832 3300025315 Bacteria 1524
200 Ga0207656_10076725 3300025321 Bacteria 1495
201 Ga0207656_10157515 3300025321 Bacteria 1079
202 Ga0207656_10439721 3300025321 Unclassified 658
203 Ga0207713_1116721 3300025735 Unclassified 900
204 Ga0207688_10189450 3300025901 Bacteria 1229
205 Ga0207680_10000601 3300025903 Bacteria 16993
206 Ga0207680_10027738 3300025903 Bacteria 3158
207 Ga0207680_10217578 3300025903 Unclassified 1308
208 Ga0207680_10972900 3300025903 Unclassified 608
209 Ga0207647_10009423 3300025904 Bacteria 6938
210 Ga0207645_10306757 3300025907 Bacteria 1057
211 Ga0207705_10000632 3300025909 Bacteria 29414
212 Ga0207654_10075247 3300025911 Bacteria 2017
213 Ga0207654_10169303 3300025911 Unclassified 1417
214 Ga0207707_10114458 3300025912 Bacteria 2357
215 Ga0207671_10629201 3300025914 Bacteria 855
216 Ga0207693_10059413 3300025915 Bacteria 2995
217 Ga0207660_10559901 3300025917 Unclassified 930
218 Ga0207657_10002214 3300025919 Bacteria 21089
219 Ga0207657_10217234 3300025919 Bacteria 1533
220 Ga0207657_10302924 3300025919 Bacteria 1266
221 Ga0207657_11135728 3300025919 Unclassified 596
222 Ga0207649_10000648 3300025920 Bacteria 23207
223 Ga0207649_10205052 3300025920 Unclassified 1395
224 Ga0207649_10399518 3300025920 Bacteria 1028
225 Ga0207649_10429378 3300025920 Bacteria 994
226 Ga0207649_10703354 3300025920 Unclassified 784
227 Ga0207652_10584573 3300025921 Unclassified 1002
228 Ga0207652_11896298 3300025921 Unclassified 501
229 Ga0207681_10311066 3300025923 Bacteria 1249
230 Ga0207681_10597951 3300025923 Bacteria 911
231 Ga0207694_10800471 3300025924 Bacteria 796
232 Ga0207650_10001366 3300025925 Bacteria 17614
233 Ga0207650_10032233 3300025925 Bacteria 3790
234 Ga0207650_10597481 3300025925 Bacteria 928
235 Ga0207650_10835807 3300025925 Bacteria 781
236 Ga0207659_10038356 3300025926 Bacteria 3332
237 Ga0207659_10063171 3300025926 Bacteria 2676
238 Ga0207700_11186876 3300025928 Unclassified 681
239 Ga0207644_10002431 3300025931 Bacteria 12003
240 Ga0207644_10028924 3300025931 Bacteria 3841
241 Ga0207644_10073764 3300025931 Bacteria 2503
242 Ga0207644_10096135 3300025931 Bacteria 2216
243 Ga0207644_10176100 3300025931 Bacteria 1673
244 Ga0207644_10193436 3300025931 Bacteria 1600
245 Ga0207644_10314708 3300025931 Bacteria 1264
246 Ga0207644_11131511 3300025931 Bacteria 658
247 Ga0207690_10000749 3300025932 Bacteria 20976
248 Ga0207690_10034929 3300025932 Bacteria 3242
249 Ga0207706_10001010 3300025933 Bacteria 28690
250 Ga0207706_10020540 3300025933 Bacteria 5936
251 Ga0207706_10169260 3300025933 Bacteria 1920
252 Ga0207706_10249398 3300025933 Bacteria 1551
253 Ga0207706_10548933 3300025933 Bacteria 995
254 Ga0207691_10041026 3300025940 Bacteria 4275
255 Ga0207691_10054217 3300025940 Bacteria 3658
256 Ga0207691_10106059 3300025940 Bacteria 2503
257 Ga0207691_10420503 3300025940 Bacteria 1139
258 Ga0207711_10007236 3300025941 Bacteria 9303
259 Ga0207711_10035893 3300025941 Bacteria 4204
260 Ga0207711_10053713 3300025941 Bacteria 3455
261 Ga0207711_10077449 3300025941 Bacteria 2898
262 Ga0207711_10137559 3300025941 Bacteria 2195
263 Ga0207661_10006610 3300025944 Bacteria 8195
264 Ga0207679_10000817 3300025945 Bacteria 20063
265 Ga0207679_10036777 3300025945 Bacteria 3475
266 Ga0207679_10073766 3300025945 Bacteria 2583
267 Ga0207679_10108672 3300025945 Bacteria 2184
268 Ga0207679_10126233 3300025945 Bacteria 2045
269 Ga0207679_10168845 3300025945 Bacteria 1799
270 Ga0207667_10003378 3300025949 Bacteria 19691
271 Ga0207667_10619880 3300025949 Bacteria 1090
272 Ga0207651_10018565 3300025960 Bacteria 4143
273 Ga0207651_10075605 3300025960 Bacteria 2404
274 Ga0207651_10747137 3300025960 Bacteria 864
275 Ga0207651_11310263 3300025960 Unclassified 651
276 Ga0207640_10014633 3300025981 Bacteria 4520
277 Ga0207658_10016376 3300025986 Bacteria 5099
278 Ga0207658_10088935 3300025986 Bacteria 2389
279 Ga0207658_10110435 3300025986 Bacteria 2172
280 Ga0207703_10116122 3300026035 Bacteria 2291
281 Ga0207703_10444336 3300026035 Bacteria 1210
282 Ga0207703_10817602 3300026035 Unclassified 890
283 Ga0207639_10001099 3300026041 Bacteria 18394
284 Ga0207678_10003021 3300026067 Bacteria 15220
285 Ga0207678_10046397 3300026067 Bacteria 3757
286 Ga0207678_10049476 3300026067 Bacteria 3633
287 Ga0207678_11653263 3300026067 Bacteria 563
288 Ga0207702_10003158 3300026078 Bacteria 15251
289 Ga0207702_10029709 3300026078 Bacteria 4549
290 Ga0207702_10148507 3300026078 Bacteria 2130
291 Ga0207641_10023897 3300026088 Bacteria 5038
292 Ga0207641_10024563 3300026088 Bacteria 4967
293 Ga0207641_10057613 3300026088 Bacteria 3304
294 Ga0207648_10093077 3300026089 Bacteria 2636
295 Ga0207676_10026038 3300026095 Bacteria 4345
296 Ga0207676_10048187 3300026095 Bacteria 3307
297 Ga0207676_10081497 3300026095 Bacteria 2629
298 Ga0207676_10587103 3300026095 Bacteria 1069
299 Ga0207674_10003685 3300026116 Bacteria 18697
300 Ga0207674_10139841 3300026116 Bacteria 2381
301 Ga0207674_10165998 3300026116 Bacteria 2162
302 Ga0207674_11158799 3300026116 Bacteria 742
303 Ga0207675_101367042 3300026118 Unclassified 729
304 Ga0207683_10013911 3300026121 Bacteria 6861
305 Ga0207683_10207830 3300026121 Bacteria 1781
306 Ga0207698_10002156 3300026142 Bacteria 11625
307 Ga0207698_10189264 3300026142 Bacteria 1831
308 Ga0207698_10311457 3300026142 Bacteria 1470
309 Ga0207698_10564533 3300026142 Bacteria 1117
310 Ga0268266_10003315 3300028379 Bacteria 16167
311 Ga0268265_10207889 3300028380 Bacteria 1703
312 Ga0268264_10079135 3300028381 Bacteria 2804
313 Ga0268264_10106130 3300028381 Bacteria 2451
314 Ga0316178_1103532 3300030735 Bacteria 1917
315 Ga0316182_1299536 3300030745 Bacteria 921
316 Ga0307405_10066402 3300031731 Bacteria 2300
317 Ga0307413_10150444 3300031824 Bacteria 1621
318 Ga0307413_10352979 3300031824 Bacteria 1136
319 Ga0307410_11101580 3300031852 Bacteria 688
320 Ga0307406_10025038 3300031901 Bacteria 3569
321 Ga0307406_10049606 3300031901 Bacteria 2657
322 Ga0307407_10029609 3300031903 Bacteria 2944
323 Ga0307412_10173131 3300031911 Bacteria 1616
324 Ga0307409_100115044 3300031995 Bacteria 2264
325 Ga0307409_100419484 3300031995 Bacteria 1283
326 Ga0307416_102806022 3300032002 Unclassified 583
327 Ga0307414_11310515 3300032004 Unclassified 672
328 Ga0307411_10144557 3300032005 Bacteria 1758
329 Ga0307411_10166548 3300032005 Bacteria 1657
330 Ga0307411_10882789 3300032005 Bacteria 793
331 Ga0307411_11610923 3300032005 Unclassified 599
332 Ga0307411_11907546 3300032005 Unclassified 553
333 Ga0307415_100028461 3300032126 Bacteria 3556
334 Ga0307415_100293660 3300032126 Unclassified 1343
335 Ga0373951_0248179 3300035091 Bacteria 534
336 Ga0373932_0297495 3300035112 Unclassified 601
337 Ga0373954_0018949 3300035118 Bacteria 3102
338 Ga0373960_0006493 3300035121 Bacteria 2746
339 Ga0373955_0001401 3300035172 Bacteria 10261
340 Ga0373961_0069065 3300035241 Bacteria 1089
341 Ga0373931_0084767 3300035691 Bacteria 1755
342 Ga0373935_0037319 3300035692 Bacteria 3041
343 Ga0373937_0014027 3300036401 Bacteria 7066
344 Ga0395899_0012100 3300037312 Bacteria 6606
345 Ga0395899_0030570 3300037312 Bacteria 4050
346 Ga0395899_0087154 3300037312 Bacteria 2266
347 Ga0395900_0020191 3300037418 Bacteria 6797
348 Ga0395900_0048757 3300037418 Bacteria 4362
349 Ga0395900_0242952 3300037418 Bacteria 1805
350 Ga0395900_0344860 3300037418 Bacteria 1464
351 Ga0395900_0550043 3300037418 Bacteria 1099
352 Ga0395898_0005987 3300037466 Bacteria 13059
353 Ga0395898_0277477 3300037466 Bacteria 1599
354 Ga0395905_0007956 3300037471 Bacteria 10482
355 Ga0395905_0028796 3300037471 Bacteria 5233
356 Ga0395905_0099958 3300037471 Bacteria 2724
357 Ga0395905_0291912 3300037471 Bacteria 1517
358 Ga0395905_0607535 3300037471 Bacteria 995
359 Ga0395905_0687618 3300037471 Bacteria 925
360 Ga0395905_0975475 3300037471 Bacteria 750
361 Ga0395905_1166825 3300037471 Unclassified 674
362 Ga0395905_1231529 3300037471 Unclassified 652
363 Ga0395901_0002363 3300038443 Bacteria 19190
364 Ga0395901_0257291 3300038443 Bacteria 1818
365 Ga0395901_0322742 3300038443 Bacteria 1597
366 Ga0395901_0408265 3300038443 Bacteria 1395
367 Ga0466965_0299777 3300044683 Unclassified 872
368 Ga0466961_0847838 3300044693 Unclassified 545
369 Ga0466963_0075120 3300044694 Bacteria 2280
370 Ga0466963_0720020 3300044694 Bacteria 704
371 Ga0466971_0186145 3300044719 Unclassified 977
372 Ga0466957_0280331 3300044842 Bacteria 1115
373 Ga0466967_0036569 3300045976 Bacteria 4193
374 Ga0466967_0479919 3300045976 Bacteria 1218
375 Ga0466967_0947881 3300045976 Bacteria 856
376 Ga0495583_0314308 3300046506 Bacteria 621
377 Ga0495606_0543623 3300046507 Unclassified 579
378 Ga0495620_0328622 3300046515 Bacteria 580
379 Ga0495668_0004511 3300046616 Bacteria 9854
380 Ga0495668_0122212 3300046616 Bacteria 1424
381 Ga0495625_0063883 3300046660 Bacteria 2599
382 Ga0495669_0002319 3300046684 Bacteria 7797
383 Ga0495669_0006025 3300046684 Bacteria 5057
384 Ga0495669_0015924 3300046684 Bacteria 3220
385 Ga0495670_0137133 3300046691 Bacteria 1278
386 Ga0495589_0596528 3300046794 Bacteria 503
387 Ga0495685_098518 3300047447 Bacteria 966
388 Ga0495602_0267218 3300048088 Bacteria 1266
389 Ga0496100_0149315 3300048903 Bacteria 1665
390 Ga0496100_0158250 3300048903 Bacteria 1622
391 Ga0496101_0225344 3300048904 Bacteria 1456
392 Ga0496101_0324198 3300048904 Bacteria 1209
393 Ga0496101_0499429 3300048904 Unclassified 961
394 Ga0496101_0958088 3300048904 Unclassified 673
395 Ga0496102_0075060 3300048905 Bacteria 3108
396 Ga0496102_1381578 3300048905 Unclassified 623
397 Ga0496103_0096223 3300048906 Bacteria 1871
398 Ga0496103_0158941 3300048906 Bacteria 1449
399 Ga0496104_0374073 3300048907 Bacteria 1337
400 Ga0496105_0954222 3300048908 Unclassified 644
401 Ga0496106_0177949 3300048909 Bacteria 1688
402 Ga0496106_0716629 3300048909 Unclassified 797
403 Ga0496107_0090096 3300048910 Bacteria 2240
404 Ga0496107_0124006 3300048910 Bacteria 1904
405 Ga0496107_0328758 3300048910 Unclassified 1137
406 Ga0496107_0390536 3300048910 Bacteria 1035
407 Ga0496107_0399764 3300048910 Bacteria 1022
408 Ga0496108_0008525 3300048911 Bacteria 8314
409 Ga0496108_0038171 3300048911 Bacteria 4001
410 Ga0496108_0041519 3300048911 Bacteria 3840
411 Ga0496108_0050764 3300048911 Bacteria 3473
412 Ga0496108_0899602 3300048911 Unclassified 760
413 Ga0496109_0078585 3300048912 Bacteria 3038
414 Ga0496109_0102402 3300048912 Bacteria 2657
415 Ga0496109_0119646 3300048912 Bacteria 2452
416 Ga0496109_0127099 3300048912 Bacteria 2377
417 Ga0496109_0453220 3300048912 Bacteria 1211
418 Ga0496109_0469552 3300048912 Bacteria 1188
419 Ga0496109_0568413 3300048912 Bacteria 1069
420 Ga0496110_0029226 3300048913 Bacteria 4741
421 Ga0496110_0029637 3300048913 Bacteria 4712
422 Ga0496110_0247203 3300048913 Unclassified 1623
423 Ga0496110_0269446 3300048913 Bacteria 1550
424 Ga0496110_1290257 3300048913 Bacteria 639
425 Ga0496110_1383507 3300048913 Unclassified 613
426 Ga0496111_0016365 3300048914 Bacteria 5107
427 Ga0496111_0062213 3300048914 Bacteria 2706
428 Ga0496111_0154380 3300048914 Bacteria 1703
429 Ga0496111_0746115 3300048914 Unclassified 710
430 Ga0496112_0026530 3300048915 Bacteria 5575
431 Ga0496112_0050749 3300048915 Bacteria 4068
432 Ga0496112_0060272 3300048915 Bacteria 3739
433 Ga0496112_0064436 3300048915 Bacteria 3616
434 Ga0496112_0074285 3300048915 Bacteria 3361
435 Ga0496113_0019254 3300048916 Bacteria 4771
436 Ga0496113_0030237 3300048916 Bacteria 3919
437 Ga0496113_0317830 3300048916 Bacteria 1248
438 Ga0496114_0002108 3300048917 Bacteria 15105
439 Ga0496114_0039033 3300048917 Bacteria 3930
440 Ga0496115_0104153 3300048918 Bacteria 2328
441 Ga0496115_1148539 3300048918 Unclassified 586
442 Ga0501068_0087378 3300049584 Bacteria 1920
443 Ga0501073_0836984 3300049589 Unclassified 634
444 Ga0501074_0063962 3300049590 Bacteria 2649
445 Ga0501080_0011438 3300049742 Bacteria 8127
446 Ga0501044_0851893 3300049823 Unclassified 788
447 nmdc:mga03683_16401_c1 3300050489 Bacteria 2782
448 nmdc:mga08y16_317052_c1 3300050511 Bacteria 1605
449 Ga0501084_0673456 3300054114 Unclassified 873
450 Ga0105248_10063875
451 JGI24752J21851_1002732
452 JGI24739J22299_10029450
453 JGI24737J22298_10001690
454 JGI24738J21930_10000780
455 JGI24749J21850_1033289
456 Ga0065712_10249397
457 Ga0065712_10600381
458 Ga0065715_10038782
459 Ga0070658_10001606
460 Ga0070658_10028762
461 Ga0070658_10885077
462 Ga0070676_10420032
463 Ga0070676_10651276
464 Ga0070683_100012454
465 Ga0070690_100197759
466 Ga0070670_100000265
467 Ga0070670_100060707
468 Ga0070670_101318993
469 Ga0070677_10314644
470 Ga0068869_100166582
471 Ga0068869_100591253
472 Ga0070666_10000682
473 Ga0070666_10022623
474 Ga0070666_10070379
475 Ga0070680_100471439
476 Ga0070680_100579360
477 Ga0070682_100029413
478 Ga0070682_100200659
479 Ga0070682_100928766
480 Ga0068868_100081379
481 Ga0068868_100189719
482 Ga0070660_100000779
483 Ga0070660_100101088
484 Ga0070660_100495578
485 Ga0070660_100808665
486 Ga0070660_100931397
487 Ga0070660_101027469
488 Ga0070687_100425882
489 Ga0070687_100587390
490 Ga0070661_100001034
491 Ga0070661_100095881
492 Ga0070661_101267501
493 Ga0070669_100356955
494 Ga0070669_100962577
495 Ga0070675_100023644
496 Ga0070675_100041037
497 Ga0070675_100465574
498 Ga0070675_100968502
499 Ga0070671_100011780
500 Ga0070671_100014904
501 Ga0070671_100034878
502 Ga0070671_100053802
503 Ga0070671_100084822
504 Ga0070671_100312203
505 Ga0070671_100340971
506 Ga0070674_100010136
507 Ga0070673_100306351
508 Ga0070673_100368527
509 Ga0070673_100849358
510 Ga0070673_100855996
511 Ga0070673_100909761
512 Ga0070659_100000965
513 Ga0070659_100044927
514 Ga0070659_100084067
515 Ga0070659_100177308
516 Ga0070659_100552814
517 Ga0070659_100929822
518 Ga0070667_100023234
519 Ga0070667_100025812
520 Ga0070667_100053658
521 Ga0070667_102073657
522 Ga0070713_100826318
523 Ga0070663_100024455
524 Ga0070663_100568236
525 Ga0070678_100036804
526 Ga0070662_100000639
527 Ga0070662_100025041
528 Ga0070681_10369875
529 Ga0070681_10389961
530 Ga0070681_10503354
531 Ga0070681_11308910
532 Ga0068867_100454076
533 Ga0070679_101011928
534 Ga0070679_101407827
535 Ga0070679_101415367
536 Ga0070684_100078659
537 Ga0070684_101229911
538 Ga0068853_100000847
539 Ga0068853_100069783
540 Ga0070672_100027075
541 Ga0070672_100086719
542 Ga0070672_100124616
543 Ga0070672_100528910
544 Ga0070686_100085581
545 Ga0070686_101361142
546 Ga0070696_100177102
547 Ga0070693_100001054
548 Ga0070693_100236069
549 Ga0070665_100002303
550 Ga0070665_101439460
551 Ga0068855_100001613
552 Ga0068855_100218776
553 Ga0068855_100300729
554 Ga0070664_100001124
555 Ga0070664_100013757
556 Ga0070664_100016051
557 Ga0070664_100298724
558 Ga0070664_100340566
559 Ga0068857_100100161
560 Ga0068857_100334086
561 Ga0068857_101225978
562 Ga0068854_100021144
563 Ga0068854_100124064
564 Ga0068854_100840389
565 Ga0068856_100001441
566 Ga0068856_100024428
567 Ga0068852_100003780
568 Ga0068852_100332900
569 Ga0068852_100392266
570 Ga0068859_100205025
571 Ga0068859_100274533
572 Ga0068859_101196916
573 Ga0068864_100020164
574 Ga0068864_100034451
575 Ga0068864_100036201
576 Ga0068864_100059639
577 Ga0068864_100632451
578 Ga0068851_10054436
579 Ga0068851_10059501
580 Ga0068851_10822824
581 Ga0068870_10793734
582 Ga0068863_100006044
583 Ga0068863_100016964
584 Ga0068863_100038266
585 Ga0068863_102038612
586 Ga0068858_100002927
587 Ga0068858_100029571
588 Ga0068858_100110346
589 Ga0068858_102429964
590 Ga0068860_100109277
591 Ga0068860_100118978
592 Ga0068860_100128271
593 Ga0068862_100201661
594 Ga0068862_100291541
595 Ga0070712_100025124
596 Ga0097621_100048503
597 Ga0097621_100163421
598 Ga0097621_100190477
599 Ga0097621_100717041
600 Ga0068871_100022750
601 Ga0068871_100094991
602 Ga0068871_100146740
603 Ga0068871_100763371
604 Ga0097620_100205034
605 Ga0097620_100274547
606 Ga0097620_101196983
607 Ga0105251_10019646
608 Ga0111539_10313383
609 Ga0105247_10059676
610 Ga0105241_10133032
611 Ga0105241_10618458
612 Ga0105242_11971434
613 Ga0105248_10002314
614 Ga0105248_10052266
615 Ga0105248_10089375
616 Ga0105248_10201949
617 Ga0105237_10410518
618 Ga0105238_10125675
619 Ga0105238_10391239
620 Ga0105246_10169773
621 Ga0157373_10090855
622 Ga0157373_10126063
623 Ga0157373_10136132
624 Ga0157371_10004719
625 Ga0157371_10169049
626 Ga0157371_10419003
627 Ga0157371_11188614
628 Ga0157369_10409003
629 Ga0157374_10027384
630 Ga0157374_10208153
631 Ga0157374_10240464
632 Ga0157374_10434672
633 Ga0157374_11052417
634 Ga0157378_10164383
635 Ga0163162_10041595
636 Ga0157372_10314250
637 Ga0157375_10005824
638 Ga0157375_12216250
639 Ga0163163_10015399
640 Ga0163163_10027400
641 Ga0163163_10083710
642 Ga0157380_10455647
643 Ga0182008_10042897
644 Ga0157379_10044665
645 Ga0157379_10110087
646 Ga0157376_10544248
647 Ga0163161_10033552
648 Ga0207697_10064832
649 Ga0207656_10076725
650 Ga0207656_10157515
651 Ga0207656_10439721
652 Ga0207713_1116721
653 Ga0207688_10189450
654 Ga0207680_10000601
655 Ga0207680_10027738
656 Ga0207680_10217578
657 Ga0207680_10972900
658 Ga0207647_10009423
659 Ga0207645_10306757
660 Ga0207705_10000632
661 Ga0207654_10075247
662 Ga0207654_10169303
663 Ga0207707_10114458
664 Ga0207671_10629201
665 Ga0207693_10059413
666 Ga0207660_10559901
667 Ga0207657_10002214
668 Ga0207657_10217234
669 Ga0207657_10302924
670 Ga0207657_11135728
671 Ga0207649_10000648
672 Ga0207649_10205052
673 Ga0207649_10399518
674 Ga0207649_10429378
675 Ga0207649_10703354
676 Ga0207652_10584573
677 Ga0207652_11896298
678 Ga0207681_10311066
679 Ga0207681_10597951
680 Ga0207694_10800471
681 Ga0207650_10001366
682 Ga0207650_10032233
683 Ga0207650_10597481
684 Ga0207650_10835807
685 Ga0207659_10038356
686 Ga0207659_10063171
687 Ga0207700_11186876
688 Ga0207644_10002431
689 Ga0207644_10028924
690 Ga0207644_10073764
691 Ga0207644_10096135
692 Ga0207644_10176100
693 Ga0207644_10193436
694 Ga0207644_10314708
695 Ga0207644_11131511
696 Ga0207690_10000749
697 Ga0207690_10034929
698 Ga0207706_10001010
699 Ga0207706_10020540
700 Ga0207706_10169260
701 Ga0207706_10249398
702 Ga0207706_10548933
703 Ga0207691_10041026
704 Ga0207691_10054217
705 Ga0207691_10106059
706 Ga0207691_10420503
707 Ga0207711_10007236
708 Ga0207711_10035893
709 Ga0207711_10053713
710 Ga0207711_10077449
711 Ga0207711_10137559
712 Ga0207661_10006610
713 Ga0207679_10000817
714 Ga0207679_10036777
715 Ga0207679_10073766
716 Ga0207679_10108672
717 Ga0207679_10126233
718 Ga0207679_10168845
719 Ga0207667_10003378
720 Ga0207667_10619880
721 Ga0207651_10018565
722 Ga0207651_10075605
723 Ga0207651_10747137
724 Ga0207651_11310263
725 Ga0207640_10014633
726 Ga0207658_10016376
727 Ga0207658_10088935
728 Ga0207658_10110435
729 Ga0207703_10116122
730 Ga0207703_10444336
731 Ga0207703_10817602
732 Ga0207639_10001099
733 Ga0207678_10003021
734 Ga0207678_10046397
735 Ga0207678_10049476
736 Ga0207678_11653263
737 Ga0207702_10003158
738 Ga0207702_10029709
739 Ga0207702_10148507
740 Ga0207641_10023897
741 Ga0207641_10024563
742 Ga0207641_10057613
743 Ga0207648_10093077
744 Ga0207676_10026038
745 Ga0207676_10048187
746 Ga0207676_10081497
747 Ga0207676_10587103
748 Ga0207674_10003685
749 Ga0207674_10139841
750 Ga0207674_10165998
751 Ga0207674_11158799
752 Ga0207675_101367042
753 Ga0207683_10013911
754 Ga0207683_10207830
755 Ga0207698_10002156
756 Ga0207698_10189264
757 Ga0207698_10311457
758 Ga0207698_10564533
759 Ga0268266_10003315
760 Ga0268265_10207889
761 Ga0268264_10079135
762 Ga0268264_10106130
763 Ga0316178_1103532
764 Ga0316182_1299536
765 Ga0307405_10066402
766 Ga0307413_10150444
767 Ga0307413_10352979
768 Ga0307410_11101580
769 Ga0307406_10025038
770 Ga0307406_10049606
771 Ga0307407_10029609
772 Ga0307412_10173131
773 Ga0307409_100115044
774 Ga0307409_100419484
775 Ga0307416_102806022
776 Ga0307414_11310515
777 Ga0307411_10144557
778 Ga0307411_10166548
779 Ga0307411_10882789
780 Ga0307411_11610923
781 Ga0307411_11907546
782 Ga0307415_100028461
783 Ga0307415_100293660
784 Ga0373951_0248179
785 Ga0373932_0297495
786 Ga0373954_0018949
787 Ga0373960_0006493
788 Ga0373955_0001401
789 Ga0373961_0069065
790 Ga0373931_0084767
791 Ga0373935_0037319
792 Ga0373937_0014027
793 Ga0395899_0012100
794 Ga0395899_0030570
795 Ga0395899_0087154
796 Ga0395900_0020191
797 Ga0395900_0048757
798 Ga0395900_0242952
799 Ga0395900_0344860
800 Ga0395900_0550043
801 Ga0395898_0005987
802 Ga0395898_0277477
803 Ga0395905_0007956
804 Ga0395905_0028796
805 Ga0395905_0099958
806 Ga0395905_0291912
807 Ga0395905_0607535
808 Ga0395905_0687618
809 Ga0395905_0975475
810 Ga0395905_1166825
811 Ga0395905_1231529
812 Ga0395901_0002363
813 Ga0395901_0257291
814 Ga0395901_0322742
815 Ga0395901_0408265
816 Ga0466965_0299777
817 Ga0466961_0847838
818 Ga0466963_0075120
819 Ga0466963_0720020
820 Ga0466971_0186145
821 Ga0466957_0280331
822 Ga0466967_0036569
823 Ga0466967_0479919
824 Ga0466967_0947881
825 Ga0495583_0314308
826 Ga0495606_0543623
827 Ga0495620_0328622
828 Ga0495668_0004511
829 Ga0495668_0122212
830 Ga0495625_0063883
831 Ga0495669_0002319
832 Ga0495669_0006025
833 Ga0495669_0015924
834 Ga0495670_0137133
835 Ga0495589_0596528
836 Ga0495685_098518
837 Ga0495602_0267218
838 Ga0496100_0149315
839 Ga0496100_0158250
840 Ga0496101_0225344
841 Ga0496101_0324198
842 Ga0496101_0499429
843 Ga0496101_0958088
844 Ga0496102_0075060
845 Ga0496102_1381578
846 Ga0496103_0096223
847 Ga0496103_0158941
848 Ga0496104_0374073
849 Ga0496105_0954222
850 Ga0496106_0177949
851 Ga0496106_0716629
852 Ga0496107_0090096
853 Ga0496107_0124006
854 Ga0496107_0328758
855 Ga0496107_0390536
856 Ga0496107_0399764
857 Ga0496108_0008525
858 Ga0496108_0038171
859 Ga0496108_0041519
860 Ga0496108_0050764
861 Ga0496108_0899602
862 Ga0496109_0078585
863 Ga0496109_0102402
864 Ga0496109_0119646
865 Ga0496109_0127099
866 Ga0496109_0453220
867 Ga0496109_0469552
868 Ga0496109_0568413
869 Ga0496110_0029226
870 Ga0496110_0029637
871 Ga0496110_0247203
872 Ga0496110_0269446
873 Ga0496110_1290257
874 Ga0496110_1383507
875 Ga0496111_0016365
876 Ga0496111_0062213
877 Ga0496111_0154380
878 Ga0496111_0746115
879 Ga0496112_0026530
880 Ga0496112_0050749
881 Ga0496112_0060272
882 Ga0496112_0064436
883 Ga0496112_0074285
884 Ga0496113_0019254
885 Ga0496113_0030237
886 Ga0496113_0317830
887 Ga0496114_0002108
888 Ga0496114_0039033
889 Ga0496115_0104153
890 Ga0496115_1148539
891 Ga0501068_0087378
892 Ga0501073_0836984
893 Ga0501074_0063962
894 Ga0501080_0011438
895 Ga0501044_0851893
896 nmdc:mga03683_16401_c1
897 nmdc:mga08y16_317052_c1
898 Ga0501084_0673456

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09917

DUF2147

Uncharacterized protein conserved in bacteria (DUF2147)

39

142

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p78-assembly1.cif.gz_D hica3 and hicb3 toxin-antitoxin complex 0.6981 97 127
7tom-assembly1.cif.gz_A x-ray crystal structure of glycerol dibiphytanyl glycerol tetraether - macrocyclic archaeol synthase (gdgt-mas) from methanocaldococcus jannaschii with bacterial lipid substrate analog, 5'deoxyadenosine, and methionine bound 0.6719 72 123
7tol-assembly1.cif.gz_A x-ray crystal structure of glycerol dibiphytanyl glycerol tetraether - macrocyclic archaeol synthase (gdgt-mas) from methanocaldococcus jannaschii with archaeal lipid, 5'deoxyadenosine, and methionine bound 0.6679 72 123
2w2w-assembly11.cif.gz_K plcg2 split pleckstrin homology (ph) domain 0.6564 79 107
2w2w-assembly6.cif.gz_F plcg2 split pleckstrin homology (ph) domain 0.6562 79 107
ID Description Score Start End Superfamily
af_Q9P7U7_2_118_3.40.1000.30 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A; 0.7169 80 122 3.40.1000.30
6bz0A02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7111 97 123 3.50.50.60
af_Q8IB99_1_188_3.30.450.50 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin domain 0.7047 95 124 3.30.450.50
af_Q0DTQ9_188_334_3.40.1000.30 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A; 0.7019 79 122 3.40.1000.30
4p78D00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.6981 97 127 3.30.920.30
ID Description Score Start End GO Terms
AF-A0A2W6X0X9-F1-model_v4 DUF2147 domain-containing protein 0.9408 20 126
AF-A0A7Y0FC25-F1-model_v4 deleted 0.9388 20 124
AF-A0A7V9YP21-F1-model_v4 deleted 0.928 20 126
AF-A0A2W6WEM7-F1-model_v4 DUF2147 domain-containing protein 0.9255 18 124
AF-A0A5N8AG82-F1-model_v4 DUF2147 domain-containing protein 0.9244 18 124

Map