F446373

General Info

Members Datasets Scaffolds Average Seq Length
449 271 898 126

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10972946|Ga0114129_109729462
Length 146
Sequence VAKIGAKTYVRRTCPLENIRMTEDERAIRDLVATWMKASEAGDLATVLSLMTDDVIFLVPGREPFGKEAFAAASQSMKDVGMQGTSDIRELKVLGDWAYLRNHIEVTMTPPGGTPVRRAGYTLTILRKETDGRWRLARDANLLTVQ

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
157 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
158 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
159 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
162 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
171 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
172 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
176 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
189 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
190 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
217 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
218 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
219 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
225 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
228 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
229 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
230 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
247 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
252 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
256 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
257 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
270 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
271 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.91
Nodule 0
Rhizoplane 7.35
Rhizosphere 83.07
Stem 0
Stem Tuber 0
Unclassified 16.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10972946 3300009147 Bacteria 1070
2 JGI25406J46586_10000500 3300003203 Bacteria 18328
3 JGI25406J46586_10000930 3300003203 Bacteria 13777
4 Ga0065704_10426764 3300005289 Bacteria 725
5 Ga0065707_10113852 3300005295 Bacteria 2314
6 Ga0070676_10021493 3300005328 Bacteria 3613
7 Ga0070676_11031989 3300005328 Unclassified 619
8 Ga0070676_11221700 3300005328 Bacteria 572
9 Ga0070683_101840735 3300005329 Unclassified 582
10 Ga0070670_100127515 3300005331 Bacteria 2196
11 Ga0070677_10180564 3300005333 Bacteria 1005
12 Ga0068869_100313014 3300005334 Bacteria 1271
13 Ga0070666_10065542 3300005335 Bacteria 2464
14 Ga0070666_10094443 3300005335 Bacteria 2057
15 Ga0070680_100185615 3300005336 Bacteria 1752
16 Ga0070680_100216354 3300005336 Bacteria 1617
17 Ga0070660_100601739 3300005339 Bacteria 919
18 Ga0070689_101133629 3300005340 Unclassified 700
19 Ga0070689_101236039 3300005340 Unclassified 671
20 Ga0070691_10132965 3300005341 Bacteria 1262
21 Ga0070691_10859693 3300005341 Bacteria 557
22 Ga0070687_100117517 3300005343 Bacteria 1515
23 Ga0070661_100451929 3300005344 Unclassified 1022
24 Ga0070661_100904209 3300005344 Unclassified 729
25 Ga0070661_100981725 3300005344 Unclassified 700
26 Ga0070692_10868052 3300005345 Unclassified 621
27 Ga0070668_100358708 3300005347 Bacteria 1235
28 Ga0070668_100747988 3300005347 Bacteria 865
29 Ga0070669_100013120 3300005353 Bacteria 5888
30 Ga0070675_101051423 3300005354 Bacteria 748
31 Ga0070675_101193081 3300005354 Unclassified 701
32 Ga0070671_100232478 3300005355 Unclassified 1564
33 Ga0070674_100480605 3300005356 Bacteria 1031
34 Ga0070674_101203501 3300005356 Unclassified 673
35 Ga0070673_100124781 3300005364 Bacteria 2153
36 Ga0070673_101518800 3300005364 Unclassified 632
37 Ga0070688_101327262 3300005365 Unclassified 581
38 Ga0070659_100305870 3300005366 Bacteria 1327
39 Ga0070667_100244368 3300005367 Bacteria 1603
40 Ga0070709_10353372 3300005434 Bacteria 1087
41 Ga0070709_10435831 3300005434 Bacteria 985
42 Ga0070714_100268714 3300005435 Bacteria 1581
43 Ga0070714_100362739 3300005435 Unclassified 1362
44 Ga0070714_101093624 3300005435 Bacteria 777
45 Ga0070713_100094207 3300005436 Bacteria 2581
46 Ga0070713_100317284 3300005436 Bacteria 1438
47 Ga0070713_100492934 3300005436 Unclassified 1155
48 Ga0070710_10008120 3300005437 Bacteria 5103
49 Ga0070710_10023366 3300005437 Bacteria 3249
50 Ga0070710_10831928 3300005437 Bacteria 662
51 Ga0070701_11065963 3300005438 Unclassified 567
52 Ga0070711_100062295 3300005439 Bacteria 2599
53 Ga0070711_100359720 3300005439 Bacteria 1172
54 Ga0070711_100380341 3300005439 Bacteria 1141
55 Ga0070705_100013693 3300005440 Bacteria 4152
56 Ga0070700_100647410 3300005441 Unclassified 834
57 Ga0070694_100450108 3300005444 Bacteria 1016
58 Ga0070694_100637655 3300005444 Bacteria 861
59 Ga0070708_101422943 3300005445 Unclassified 646
60 Ga0070663_100042635 3300005455 Bacteria 3189
61 Ga0070678_100020960 3300005456 Bacteria 4299
62 Ga0070678_100104153 3300005456 Bacteria 2206
63 Ga0070678_100426708 3300005456 Unclassified 1157
64 Ga0070678_100634810 3300005456 Bacteria 957
65 Ga0070662_100108786 3300005457 Bacteria 2109
66 Ga0070662_100142465 3300005457 Bacteria 1859
67 Ga0070662_100465382 3300005457 Bacteria 1051
68 Ga0070681_10023881 3300005458 Bacteria 6155
69 Ga0070681_10041055 3300005458 Bacteria 4636
70 Ga0070681_10137357 3300005458 Bacteria 2375
71 Ga0070681_11141229 3300005458 Unclassified 701
72 Ga0068867_100121969 3300005459 Bacteria 2016
73 Ga0070706_101721647 3300005467 Bacteria 571
74 Ga0070698_100138387 3300005471 Bacteria 2388
75 Ga0070699_100020305 3300005518 Bacteria 5729
76 Ga0070699_100603853 3300005518 Bacteria 1001
77 Ga0070679_100047848 3300005530 Bacteria 4261
78 Ga0070679_100882653 3300005530 Bacteria 838
79 Ga0068853_100532961 3300005539 Bacteria 1111
80 Ga0070686_100509445 3300005544 Unclassified 935
81 Ga0070695_100185254 3300005545 Bacteria 1478
82 Ga0070695_101273395 3300005545 Bacteria 607
83 Ga0070693_100021177 3300005547 Bacteria 3441
84 Ga0070693_100187073 3300005547 Bacteria 1337
85 Ga0070665_101833395 3300005548 Unclassified 613
86 Ga0070704_100763620 3300005549 Unclassified 862
87 Ga0070664_100104635 3300005564 Bacteria 2464
88 Ga0070664_101869123 3300005564 Bacteria 570
89 Ga0068857_100048364 3300005577 Bacteria 3776
90 Ga0068857_101843605 3300005577 Unclassified 592
91 Ga0068856_100071462 3300005614 Bacteria 3436
92 Ga0068856_100436341 3300005614 Bacteria 1330
93 Ga0070702_100203577 3300005615 Bacteria 1312
94 Ga0068861_100119525 3300005719 Bacteria 2124
95 Ga0068858_100270577 3300005842 Bacteria 1617
96 Ga0068862_100088179 3300005844 Bacteria 2699
97 Ga0081455_10002969 3300005937 Bacteria 19834
98 Ga0081455_10566399 3300005937 Unclassified 748
99 Ga0081455_10736980 3300005937 Bacteria 624
100 Ga0081538_10034538 3300005981 Bacteria 3341
101 Ga0081540_1012422 3300005983 Bacteria 5609
102 Ga0081539_10000313 3300005985 Bacteria 108469
103 Ga0081539_10000561 3300005985 Bacteria 76621
104 Ga0070717_10142588 3300006028 Bacteria 2067
105 Ga0070717_10729525 3300006028 Unclassified 901
106 Ga0070717_10996734 3300006028 Unclassified 763
107 Ga0070717_11485740 3300006028 Bacteria 615
108 Ga0075365_10123590 3300006038 Bacteria 1787
109 Ga0075365_10322224 3300006038 Bacteria 1088
110 Ga0075368_10060005 3300006042 Bacteria 1522
111 Ga0075363_100058449 3300006048 Bacteria 2071
112 Ga0075363_100094045 3300006048 Bacteria 1652
113 Ga0075363_100333734 3300006048 Bacteria 883
114 Ga0075364_10284723 3300006051 Bacteria 1124
115 Ga0070715_10002777 3300006163 Bacteria 5444
116 Ga0075367_10213679 3300006178 Bacteria 1206
117 Ga0075367_10277956 3300006178 Bacteria 1052
118 Ga0075367_10292234 3300006178 Bacteria 1025
119 Ga0075367_10981791 3300006178 Bacteria 539
120 Ga0075369_10054256 3300006186 Bacteria 1740
121 Ga0075369_10128019 3300006186 Bacteria 1152
122 Ga0075366_10067524 3300006195 Bacteria 2128
123 Ga0075366_11009085 3300006195 Unclassified 519
124 Ga0097621_100068441 3300006237 Bacteria 2928
125 Ga0097621_100252706 3300006237 Bacteria 1544
126 Ga0075370_10246492 3300006353 Bacteria 1058
127 Ga0075370_10291125 3300006353 Bacteria 970
128 Ga0075370_10440646 3300006353 Unclassified 783
129 Ga0075370_10603189 3300006353 Bacteria 665
130 Ga0075370_10787648 3300006353 Bacteria 579
131 Ga0068871_100084989 3300006358 Bacteria 2626
132 Ga0068871_100470289 3300006358 Bacteria 1129
133 Ga0075428_100269768 3300006844 Unclassified 1831
134 Ga0075428_100720432 3300006844 Bacteria 1062
135 Ga0075431_100820717 3300006847 Unclassified 902
136 Ga0075433_10010985 3300006852 Bacteria 7281
137 Ga0075433_10142203 3300006852 Bacteria 2133
138 Ga0075434_100019126 3300006871 Bacteria 6622
139 Ga0075434_100317213 3300006871 Bacteria 1579
140 Ga0068865_100577769 3300006881 Unclassified 947
141 Ga0075435_100128916 3300007076 Unclassified 2116
142 Ga0111539_10035592 3300009094 Bacteria 6027
143 Ga0111539_10125621 3300009094 Bacteria 3006
144 Ga0111539_10152186 3300009094 Bacteria 2708
145 Ga0111539_10231031 3300009094 Bacteria 2154
146 Ga0111539_11667382 3300009094 Unclassified 739
147 Ga0105245_10055669 3300009098 Bacteria 3553
148 Ga0105247_11439376 3300009101 Bacteria 559
149 Ga0114129_10048999 3300009147 Bacteria 5937
150 Ga0114129_10276835 3300009147 Bacteria 2243
151 Ga0114129_10522042 3300009147 Bacteria 1548
152 Ga0114129_12658191 3300009147 Bacteria 597
153 Ga0114129_12978891 3300009147 Unclassified 557
154 Ga0105241_10156661 3300009174 Bacteria 1868
155 Ga0105242_10157675 3300009176 Bacteria 1984
156 Ga0105248_10069536 3300009177 Bacteria 3953
157 Ga0105248_11631432 3300009177 Bacteria 731
158 Ga0105237_10527600 3300009545 Bacteria 1187
159 Ga0105237_10567647 3300009545 Bacteria 1141
160 Ga0105249_10114719 3300009553 Bacteria 2551
161 Ga0105249_12240683 3300009553 Bacteria 619
162 Ga0105239_10393119 3300010375 Bacteria 1569
163 Ga0105239_12014554 3300010375 Bacteria 670
164 Ga0105246_10027788 3300011119 Bacteria 3711
165 Ga0157374_10560123 3300013296 Unclassified 1151
166 Ga0157374_11513679 3300013296 Bacteria 694
167 Ga0157378_10454330 3300013297 Bacteria 1272
168 Ga0157378_10973907 3300013297 Unclassified 881
169 Ga0163162_10041621 3300013306 Bacteria 4598
170 Ga0163162_10220778 3300013306 Bacteria 2025
171 Ga0157372_12674163 3300013307 Unclassified 573
172 Ga0157375_11760348 3300013308 Unclassified 734
173 Ga0163163_10001366 3300014325 Bacteria 20573
174 Ga0163163_11927969 3300014325 Bacteria 651
175 Ga0157379_10084733 3300014968 Bacteria 2840
176 Ga0157376_10248209 3300014969 Bacteria 1661
177 Ga0157376_10310979 3300014969 Bacteria 1495
178 Ga0207692_10025899 3300025898 Bacteria 2747
179 Ga0207692_10252109 3300025898 Bacteria 1058
180 Ga0207710_10103865 3300025900 Bacteria 1343
181 Ga0207680_10398711 3300025903 Unclassified 972
182 Ga0207685_10532164 3300025905 Unclassified 623
183 Ga0207699_10698947 3300025906 Bacteria 742
184 Ga0207645_10026899 3300025907 Bacteria 3717
185 Ga0207654_10030454 3300025911 Bacteria 2962
186 Ga0207654_10440065 3300025911 Bacteria 912
187 Ga0207707_10004648 3300025912 Bacteria 12060
188 Ga0207707_10062658 3300025912 Bacteria 3236
189 Ga0207707_10097475 3300025912 Bacteria 2570
190 Ga0207671_10122795 3300025914 Bacteria 1986
191 Ga0207693_10016708 3300025915 Bacteria 5862
192 Ga0207663_10150291 3300025916 Bacteria 1633
193 Ga0207663_10477407 3300025916 Bacteria 965
194 Ga0207660_10075820 3300025917 Bacteria 2458
195 Ga0207657_10496437 3300025919 Unclassified 956
196 Ga0207649_10144725 3300025920 Bacteria 1630
197 Ga0207649_10404630 3300025920 Unclassified 1022
198 Ga0207649_11405248 3300025920 Unclassified 552
199 Ga0207652_10051468 3300025921 Bacteria 3531
200 Ga0207646_10164466 3300025922 Bacteria 2003
201 Ga0207687_10017125 3300025927 Bacteria 4764
202 Ga0207687_10351792 3300025927 Bacteria 1200
203 Ga0207700_10523235 3300025928 Bacteria 1051
204 Ga0207700_10630346 3300025928 Bacteria 955
205 Ga0207664_10270491 3300025929 Bacteria 1488
206 Ga0207664_10360067 3300025929 Bacteria 1289
207 Ga0207664_11476853 3300025929 Bacteria 601
208 Ga0207644_10354377 3300025931 Bacteria 1192
209 Ga0207690_10919204 3300025932 Bacteria 726
210 Ga0207706_10002877 3300025933 Bacteria 16672
211 Ga0207706_10043004 3300025933 Bacteria 4004
212 Ga0207706_10068027 3300025933 Bacteria 3135
213 Ga0207706_10720009 3300025933 Bacteria 852
214 Ga0207686_10597105 3300025934 Unclassified 868
215 Ga0207709_10118201 3300025935 Bacteria 1785
216 Ga0207670_11174859 3300025936 Unclassified 649
217 Ga0207669_10477353 3300025937 Unclassified 993
218 Ga0207669_10529222 3300025937 Bacteria 948
219 Ga0207669_10701310 3300025937 Bacteria 832
220 Ga0207669_10826272 3300025937 Bacteria 770
221 Ga0207669_11666122 3300025937 Unclassified 545
222 Ga0207704_11216516 3300025938 Unclassified 643
223 Ga0207665_10064079 3300025939 Bacteria 2497
224 Ga0207711_11187135 3300025941 Bacteria 705
225 Ga0207711_12137262 3300025941 Unclassified 502
226 Ga0207689_10266835 3300025942 Bacteria 1417
227 Ga0207689_10729367 3300025942 Bacteria 836
228 Ga0207689_11536814 3300025942 Unclassified 555
229 Ga0207679_10207055 3300025945 Bacteria 1642
230 Ga0207651_10420633 3300025960 Bacteria 1141
231 Ga0207712_10071037 3300025961 Bacteria 2503
232 Ga0207668_10040821 3300025972 Bacteria 3133
233 Ga0207668_10611671 3300025972 Bacteria 950
234 Ga0207640_11043765 3300025981 Bacteria 721
235 Ga0207658_10383107 3300025986 Bacteria 1232
236 Ga0207703_10208888 3300026035 Bacteria 1739
237 Ga0207703_11116968 3300026035 Bacteria 757
238 Ga0207678_10025181 3300026067 Bacteria 5195
239 Ga0207678_10120273 3300026067 Bacteria 2241
240 Ga0207708_10044601 3300026075 Bacteria 3379
241 Ga0207708_10718620 3300026075 Unclassified 855
242 Ga0207702_10246234 3300026078 Bacteria 1677
243 Ga0207648_10268091 3300026089 Bacteria 1525
244 Ga0207674_10052231 3300026116 Bacteria 4169
245 Ga0207675_100101506 3300026118 Bacteria 2711
246 Ga0207675_100224353 3300026118 Bacteria 1811
247 Ga0207675_100706785 3300026118 Bacteria 1017
248 Ga0207683_10034896 3300026121 Bacteria 4375
249 Ga0207683_10049813 3300026121 Bacteria 3667
250 Ga0207683_10289690 3300026121 Unclassified 1497
251 Ga0207428_10017780 3300027907 Bacteria 6096
252 Ga0207428_10097738 3300027907 Bacteria 2272
253 Ga0268266_11434153 3300028379 Bacteria 666
254 Ga0268265_10000839 3300028380 Bacteria 28924
255 Ga0268264_10428310 3300028381 Bacteria 1277
256 Ga0307408_100250113 3300031548 Bacteria 1461
257 Ga0307408_100866269 3300031548 Bacteria 824
258 Ga0307508_10011619 3300031616 Bacteria 8047
259 Ga0307405_10123273 3300031731 Bacteria 1777
260 Ga0307406_10072013 3300031901 Bacteria 2267
261 Ga0307412_10751078 3300031911 Bacteria 842
262 Ga0307412_11581442 3300031911 Bacteria 598
263 Ga0307416_100152816 3300032002 Bacteria 2120
264 Ga0307416_100885769 3300032002 Bacteria 992
265 Ga0307411_10302031 3300032005 Bacteria 1284
266 Ga0307415_100212381 3300032126 Bacteria 1545
267 Ga0307415_100396434 3300032126 Bacteria 1177
268 Ga0307510_10306452 3300033180 Bacteria 1048
269 Ga0373958_0006628 3300034819 Bacteria 1812
270 Ga0373929_0029669 3300035085 Bacteria 1162
271 Ga0373929_0170257 3300035085 Unclassified 595
272 Ga0373934_0067579 3300035086 Bacteria 1428
273 Ga0373940_0011863 3300035088 Unclassified 2079
274 Ga0373944_0083723 3300035089 Bacteria 1057
275 Ga0373951_0050296 3300035091 Bacteria 1024
276 Ga0373951_0094282 3300035091 Unclassified 789
277 Ga0373952_0147760 3300035092 Unclassified 657
278 Ga0373923_0464645 3300035111 Unclassified 614
279 Ga0373932_0048617 3300035112 Unclassified 1251
280 Ga0373932_0160061 3300035112 Bacteria 778
281 Ga0373936_0080368 3300035113 Bacteria 1356
282 Ga0373939_0044712 3300035114 Bacteria 1349
283 Ga0373939_0045279 3300035114 Bacteria 1342
284 Ga0373945_0067755 3300035116 Bacteria 1344
285 Ga0373945_0311029 3300035116 Bacteria 676
286 Ga0373953_0003098 3300035117 Bacteria 5117
287 Ga0373954_0009233 3300035118 Bacteria 4338
288 Ga0373956_0117469 3300035119 Unclassified 1241
289 Ga0373957_0034612 3300035120 Bacteria 1872
290 Ga0373960_0008674 3300035121 Bacteria 2443
291 Ga0373943_0263188 3300035170 Bacteria 971
292 Ga0373943_0381503 3300035170 Bacteria 811
293 Ga0373955_0032654 3300035172 Bacteria 2734
294 Ga0373942_0038388 3300035207 Unclassified 1298
295 Ga0373942_0119493 3300035207 Bacteria 822
296 Ga0373962_0001840 3300035242 Bacteria 5057
297 Ga0373931_0001210 3300035691 Bacteria 11038
298 Ga0373931_0011646 3300035691 Bacteria 4249
299 Ga0373935_0115973 3300035692 Bacteria 1783
300 Ga0373935_0504720 3300035692 Unclassified 878
301 Ga0373927_0106752 3300035695 Bacteria 1823
302 Ga0373927_0619268 3300035695 Bacteria 715
303 Ga0373933_0007484 3300035724 Bacteria 5962
304 Ga0373947_0099273 3300035725 Bacteria 1827
305 Ga0373947_0364837 3300035725 Bacteria 970
306 Ga0373947_0375492 3300035725 Bacteria 956
307 Ga0373937_0014197 3300036401 Bacteria 7027
308 Ga0373925_0250705 3300037068 Bacteria 1420
309 Ga0395900_0130377 3300037418 Bacteria 2577
310 Ga0395905_0538820 3300037471 Bacteria 1068
311 Ga0395901_0398998 3300038443 Bacteria 1413
312 Ga0436365_0599385 3300039437 Bacteria 1412
313 Ga0439434_0163375 3300042435 Bacteria 741
314 Ga0439435_0037381 3300042436 Bacteria 1345
315 Ga0466970_0382213 3300044765 Bacteria 802
316 Ga0466960_0828555 3300044901 Bacteria 561
317 Ga0466967_2380722 3300045976 Unclassified 525
318 Ga0495592_0046113 3300046454 Bacteria 3249
319 Ga0495629_0037625 3300046459 Bacteria 3410
320 Ga0495651_0005425 3300046462 Bacteria 9727
321 Ga0495653_0015217 3300046463 Bacteria 6269
322 Ga0495653_0154300 3300046463 Bacteria 1601
323 Ga0495605_0185212 3300046474 Bacteria 914
324 Ga0495664_0008910 3300046477 Bacteria 5606
325 Ga0495664_0023970 3300046477 Bacteria 3543
326 Ga0495584_0201121 3300046491 Bacteria 1013
327 Ga0495594_0090849 3300046499 Bacteria 1711
328 Ga0495608_0012848 3300046511 Bacteria 5809
329 Ga0495618_0001803 3300046514 Bacteria 14173
330 Ga0495618_0103406 3300046514 Bacteria 1823
331 Ga0495628_0049448 3300046516 Bacteria 3329
332 Ga0495628_0953691 3300046516 Bacteria 592
333 Ga0495630_0493968 3300046517 Bacteria 938
334 Ga0495630_0518908 3300046517 Unclassified 913
335 Ga0495652_0028165 3300046529 Bacteria 4947
336 Ga0495665_0129049 3300046531 Bacteria 1323
337 Ga0495640_0022048 3300046533 Bacteria 4663
338 Ga0495640_0039558 3300046533 Bacteria 3307
339 Ga0495587_0009277 3300046536 Bacteria 6312
340 Ga0495645_0034568 3300046543 Bacteria 3686
341 Ga0495645_0107214 3300046543 Bacteria 1980
342 Ga0495667_0020664 3300046559 Bacteria 4442
343 Ga0495634_0807632 3300046642 Bacteria 534
344 Ga0495635_0001915 3300046663 Bacteria 14147
345 Ga0495657_0004654 3300046675 Bacteria 10945
346 Ga0495599_0050771 3300046678 Bacteria 2598
347 Ga0495623_0026238 3300046679 Bacteria 3751
348 Ga0495646_0013533 3300046680 Bacteria 5186
349 Ga0495647_0196435 3300046681 Bacteria 883
350 Ga0495613_0384304 3300046689 Bacteria 959
351 Ga0495624_0314051 3300046690 Bacteria 944
352 Ga0495624_0637145 3300046690 Unclassified 634
353 Ga0495600_0007883 3300046809 Bacteria 6524
354 Ga0495581_0245402 3300047315 Bacteria 1047
355 Ga0495604_0005141 3300047317 Bacteria 10360
356 Ga0495674_0004849 3300047319 Bacteria 12936
357 Ga0495674_0022676 3300047319 Bacteria 5787
358 Ga0495672_0000808 3300047320 Bacteria 33700
359 Ga0495676_0191509 3300047321 Bacteria 1426
360 Ga0495676_0206631 3300047321 Bacteria 1361
361 Ga0495676_0362161 3300047321 Bacteria 968
362 Ga0495680_0016455 3300047322 Bacteria 6351
363 Ga0495675_0049619 3300047444 Bacteria 2667
364 Ga0495684_0018050 3300047471 Bacteria 5437
365 Ga0495593_0285343 3300047673 Bacteria 825
366 Ga0495602_0028120 3300048088 Bacteria 5386
367 Ga0496100_0016322 3300048903 Bacteria 4358
368 Ga0496100_0099723 3300048903 Bacteria 1999
369 Ga0496100_0751854 3300048903 Bacteria 762
370 Ga0496101_0009513 3300048904 Bacteria 6387
371 Ga0496101_0389835 3300048904 Bacteria 1096
372 Ga0496101_1567468 3300048904 Bacteria 512
373 Ga0496102_0104057 3300048905 Bacteria 2640
374 Ga0496102_0132595 3300048905 Bacteria 2333
375 Ga0496102_0186010 3300048905 Bacteria 1958
376 Ga0496103_0028802 3300048906 Bacteria 3373
377 Ga0496104_0001506 3300048907 Bacteria 20100
378 Ga0496104_0118518 3300048907 Bacteria 2541
379 Ga0496104_0698105 3300048907 Bacteria 922
380 Ga0496105_0000338 3300048908 Bacteria 30721
381 Ga0496105_0000721 3300048908 Bacteria 22383
382 Ga0496106_0039801 3300048909 Bacteria 3520
383 Ga0496106_0066610 3300048909 Bacteria 2743
384 Ga0496106_0543215 3300048909 Bacteria 933
385 Ga0496107_0068256 3300048910 Bacteria 2580
386 Ga0496107_0110883 3300048910 Bacteria 2016
387 Ga0496108_0002826 3300048911 Bacteria 13932
388 Ga0496108_1111271 3300048911 Unclassified 671
389 Ga0496109_0000392 3300048912 Bacteria 39781
390 Ga0496109_0164088 3300048912 Bacteria 2082
391 Ga0496111_0020456 3300048914 Bacteria 4607
392 Ga0496112_0009684 3300048915 Bacteria 8695
393 Ga0496112_0561622 3300048915 Unclassified 1075
394 Ga0496113_0000243 3300048916 Bacteria 25711
395 Ga0496114_0181837 3300048917 Bacteria 1836
396 Ga0496115_0072867 3300048918 Bacteria 2787
397 Ga0496115_0079700 3300048918 Bacteria 2665
398 Ga0496115_0100459 3300048918 Bacteria 2371
399 Ga0496115_0512690 3300048918 Bacteria 962
400 Ga0501297_032078 3300049520 Bacteria 704
401 Ga0501031_0218025 3300049568 Bacteria 1243
402 Ga0501040_1042724 3300049576 Unclassified 593
403 Ga0501067_0414607 3300049583 Unclassified 751
404 Ga0501079_0535473 3300049741 Bacteria 921
405 nmdc:mga03683_534803_c1 3300050489 Bacteria 570
406 nmdc:mga03n38_110886_c1 3300050490 Bacteria 1336
407 nmdc:mga03n38_181393_c1 3300050490 Bacteria 1079
408 nmdc:mga03n38_471480_c1 3300050490 Unclassified 701
409 nmdc:mga00v17_36376_c1 3300050491 Bacteria 2934
410 nmdc:mga00v17_650699_c1 3300050491 Bacteria 678
411 nmdc:mga0yw44_231418_c1 3300050492 Bacteria 1227
412 nmdc:mga0yw44_699817_c1 3300050492 Bacteria 688
413 nmdc:mga0yw44_89690_c1 3300050492 Bacteria 1941
414 nmdc:mga06z11_126113_c1 3300050494 Bacteria 1433
415 nmdc:mga06z11_273291_c1 3300050494 Bacteria 1000
416 nmdc:mga04h51_103246_c1 3300050495 Bacteria 1042
417 nmdc:mga07m45_262998_c1 3300050496 Bacteria 1004
418 nmdc:mga07m45_377178_c1 3300050496 Bacteria 824
419 nmdc:mga07m45_785330_c1 3300050496 Bacteria 546
420 nmdc:mga05p37_1774130_c1 3300050507 Bacteria 597
421 nmdc:mga05p37_279409_c1 3300050507 Bacteria 1992
422 nmdc:mga05p37_402467_c1 3300050507 Bacteria 1598
423 nmdc:mga05p37_597824_c1 3300050507 Bacteria 1246
424 nmdc:mga06r32_33517_c1 3300050510 Bacteria 4837
425 nmdc:mga08y16_32126_c1 3300050511 Bacteria 5520
426 nmdc:mga0n895_280006_c1 3300050512 Bacteria 1691
427 nmdc:mga0n895_340708_c1 3300050512 Bacteria 1518
428 nmdc:mga0n895_88886_c1 3300050512 Bacteria 3090
429 nmdc:mga0rr50_11298_c1 3300050513 Bacteria 5709
430 nmdc:mga0rr50_605185_c1 3300050513 Bacteria 934
431 nmdc:mga0rr50_958321_c1 3300050513 Bacteria 729
432 nmdc:mga0a205_7173_c1 3300050515 Bacteria 10072
433 nmdc:mga0a205_89706_c1 3300050515 Bacteria 2971
434 nmdc:mga0sz30_152379_c1 3300050516 Bacteria 1023
435 nmdc:mga0sz30_29948_c1 3300050516 Bacteria 2247
436 nmdc:mga0sz30_65765_c1 3300050516 Bacteria 1555
437 Ga0495601_0001930 3300053077 Bacteria 11602
438 Ga0495601_0035524 3300053077 Bacteria 3111
439 Ga0495612_0003207 3300053078 Bacteria 6780
440 Ga0495612_0014197 3300053078 Bacteria 3204
441 Ga0495612_0277655 3300053078 Unclassified 748
442 Ga0495595_0004619 3300053084 Bacteria 5533
443 Ga0495595_0340682 3300053084 Bacteria 756
444 Ga0495619_0005358 3300053085 Bacteria 8124
445 Ga0495619_0013143 3300053085 Bacteria 5217
446 Ga0500562_023594 3300053108 Bacteria 1606
447 Ga0500562_160898 3300053108 Unclassified 611
448 Ga0466962_0591137 3300061719 Bacteria 565
449 Ga0530510_0295516 3300061734 Unclassified 1212
450 Ga0114129_10972946
451 JGI25406J46586_10000500
452 JGI25406J46586_10000930
453 Ga0065704_10426764
454 Ga0065707_10113852
455 Ga0070676_10021493
456 Ga0070676_11031989
457 Ga0070676_11221700
458 Ga0070683_101840735
459 Ga0070670_100127515
460 Ga0070677_10180564
461 Ga0068869_100313014
462 Ga0070666_10065542
463 Ga0070666_10094443
464 Ga0070680_100185615
465 Ga0070680_100216354
466 Ga0070660_100601739
467 Ga0070689_101133629
468 Ga0070689_101236039
469 Ga0070691_10132965
470 Ga0070691_10859693
471 Ga0070687_100117517
472 Ga0070661_100451929
473 Ga0070661_100904209
474 Ga0070661_100981725
475 Ga0070692_10868052
476 Ga0070668_100358708
477 Ga0070668_100747988
478 Ga0070669_100013120
479 Ga0070675_101051423
480 Ga0070675_101193081
481 Ga0070671_100232478
482 Ga0070674_100480605
483 Ga0070674_101203501
484 Ga0070673_100124781
485 Ga0070673_101518800
486 Ga0070688_101327262
487 Ga0070659_100305870
488 Ga0070667_100244368
489 Ga0070709_10353372
490 Ga0070709_10435831
491 Ga0070714_100268714
492 Ga0070714_100362739
493 Ga0070714_101093624
494 Ga0070713_100094207
495 Ga0070713_100317284
496 Ga0070713_100492934
497 Ga0070710_10008120
498 Ga0070710_10023366
499 Ga0070710_10831928
500 Ga0070701_11065963
501 Ga0070711_100062295
502 Ga0070711_100359720
503 Ga0070711_100380341
504 Ga0070705_100013693
505 Ga0070700_100647410
506 Ga0070694_100450108
507 Ga0070694_100637655
508 Ga0070708_101422943
509 Ga0070663_100042635
510 Ga0070678_100020960
511 Ga0070678_100104153
512 Ga0070678_100426708
513 Ga0070678_100634810
514 Ga0070662_100108786
515 Ga0070662_100142465
516 Ga0070662_100465382
517 Ga0070681_10023881
518 Ga0070681_10041055
519 Ga0070681_10137357
520 Ga0070681_11141229
521 Ga0068867_100121969
522 Ga0070706_101721647
523 Ga0070698_100138387
524 Ga0070699_100020305
525 Ga0070699_100603853
526 Ga0070679_100047848
527 Ga0070679_100882653
528 Ga0068853_100532961
529 Ga0070686_100509445
530 Ga0070695_100185254
531 Ga0070695_101273395
532 Ga0070693_100021177
533 Ga0070693_100187073
534 Ga0070665_101833395
535 Ga0070704_100763620
536 Ga0070664_100104635
537 Ga0070664_101869123
538 Ga0068857_100048364
539 Ga0068857_101843605
540 Ga0068856_100071462
541 Ga0068856_100436341
542 Ga0070702_100203577
543 Ga0068861_100119525
544 Ga0068858_100270577
545 Ga0068862_100088179
546 Ga0081455_10002969
547 Ga0081455_10566399
548 Ga0081455_10736980
549 Ga0081538_10034538
550 Ga0081540_1012422
551 Ga0081539_10000313
552 Ga0081539_10000561
553 Ga0070717_10142588
554 Ga0070717_10729525
555 Ga0070717_10996734
556 Ga0070717_11485740
557 Ga0075365_10123590
558 Ga0075365_10322224
559 Ga0075368_10060005
560 Ga0075363_100058449
561 Ga0075363_100094045
562 Ga0075363_100333734
563 Ga0075364_10284723
564 Ga0070715_10002777
565 Ga0075367_10213679
566 Ga0075367_10277956
567 Ga0075367_10292234
568 Ga0075367_10981791
569 Ga0075369_10054256
570 Ga0075369_10128019
571 Ga0075366_10067524
572 Ga0075366_11009085
573 Ga0097621_100068441
574 Ga0097621_100252706
575 Ga0075370_10246492
576 Ga0075370_10291125
577 Ga0075370_10440646
578 Ga0075370_10603189
579 Ga0075370_10787648
580 Ga0068871_100084989
581 Ga0068871_100470289
582 Ga0075428_100269768
583 Ga0075428_100720432
584 Ga0075431_100820717
585 Ga0075433_10010985
586 Ga0075433_10142203
587 Ga0075434_100019126
588 Ga0075434_100317213
589 Ga0068865_100577769
590 Ga0075435_100128916
591 Ga0111539_10035592
592 Ga0111539_10125621
593 Ga0111539_10152186
594 Ga0111539_10231031
595 Ga0111539_11667382
596 Ga0105245_10055669
597 Ga0105247_11439376
598 Ga0114129_10048999
599 Ga0114129_10276835
600 Ga0114129_10522042
601 Ga0114129_12658191
602 Ga0114129_12978891
603 Ga0105241_10156661
604 Ga0105242_10157675
605 Ga0105248_10069536
606 Ga0105248_11631432
607 Ga0105237_10527600
608 Ga0105237_10567647
609 Ga0105249_10114719
610 Ga0105249_12240683
611 Ga0105239_10393119
612 Ga0105239_12014554
613 Ga0105246_10027788
614 Ga0157374_10560123
615 Ga0157374_11513679
616 Ga0157378_10454330
617 Ga0157378_10973907
618 Ga0163162_10041621
619 Ga0163162_10220778
620 Ga0157372_12674163
621 Ga0157375_11760348
622 Ga0163163_10001366
623 Ga0163163_11927969
624 Ga0157379_10084733
625 Ga0157376_10248209
626 Ga0157376_10310979
627 Ga0207692_10025899
628 Ga0207692_10252109
629 Ga0207710_10103865
630 Ga0207680_10398711
631 Ga0207685_10532164
632 Ga0207699_10698947
633 Ga0207645_10026899
634 Ga0207654_10030454
635 Ga0207654_10440065
636 Ga0207707_10004648
637 Ga0207707_10062658
638 Ga0207707_10097475
639 Ga0207671_10122795
640 Ga0207693_10016708
641 Ga0207663_10150291
642 Ga0207663_10477407
643 Ga0207660_10075820
644 Ga0207657_10496437
645 Ga0207649_10144725
646 Ga0207649_10404630
647 Ga0207649_11405248
648 Ga0207652_10051468
649 Ga0207646_10164466
650 Ga0207687_10017125
651 Ga0207687_10351792
652 Ga0207700_10523235
653 Ga0207700_10630346
654 Ga0207664_10270491
655 Ga0207664_10360067
656 Ga0207664_11476853
657 Ga0207644_10354377
658 Ga0207690_10919204
659 Ga0207706_10002877
660 Ga0207706_10043004
661 Ga0207706_10068027
662 Ga0207706_10720009
663 Ga0207686_10597105
664 Ga0207709_10118201
665 Ga0207670_11174859
666 Ga0207669_10477353
667 Ga0207669_10529222
668 Ga0207669_10701310
669 Ga0207669_10826272
670 Ga0207669_11666122
671 Ga0207704_11216516
672 Ga0207665_10064079
673 Ga0207711_11187135
674 Ga0207711_12137262
675 Ga0207689_10266835
676 Ga0207689_10729367
677 Ga0207689_11536814
678 Ga0207679_10207055
679 Ga0207651_10420633
680 Ga0207712_10071037
681 Ga0207668_10040821
682 Ga0207668_10611671
683 Ga0207640_11043765
684 Ga0207658_10383107
685 Ga0207703_10208888
686 Ga0207703_11116968
687 Ga0207678_10025181
688 Ga0207678_10120273
689 Ga0207708_10044601
690 Ga0207708_10718620
691 Ga0207702_10246234
692 Ga0207648_10268091
693 Ga0207674_10052231
694 Ga0207675_100101506
695 Ga0207675_100224353
696 Ga0207675_100706785
697 Ga0207683_10034896
698 Ga0207683_10049813
699 Ga0207683_10289690
700 Ga0207428_10017780
701 Ga0207428_10097738
702 Ga0268266_11434153
703 Ga0268265_10000839
704 Ga0268264_10428310
705 Ga0307408_100250113
706 Ga0307408_100866269
707 Ga0307508_10011619
708 Ga0307405_10123273
709 Ga0307406_10072013
710 Ga0307412_10751078
711 Ga0307412_11581442
712 Ga0307416_100152816
713 Ga0307416_100885769
714 Ga0307411_10302031
715 Ga0307415_100212381
716 Ga0307415_100396434
717 Ga0307510_10306452
718 Ga0373958_0006628
719 Ga0373929_0029669
720 Ga0373929_0170257
721 Ga0373934_0067579
722 Ga0373940_0011863
723 Ga0373944_0083723
724 Ga0373951_0050296
725 Ga0373951_0094282
726 Ga0373952_0147760
727 Ga0373923_0464645
728 Ga0373932_0048617
729 Ga0373932_0160061
730 Ga0373936_0080368
731 Ga0373939_0044712
732 Ga0373939_0045279
733 Ga0373945_0067755
734 Ga0373945_0311029
735 Ga0373953_0003098
736 Ga0373954_0009233
737 Ga0373956_0117469
738 Ga0373957_0034612
739 Ga0373960_0008674
740 Ga0373943_0263188
741 Ga0373943_0381503
742 Ga0373955_0032654
743 Ga0373942_0038388
744 Ga0373942_0119493
745 Ga0373962_0001840
746 Ga0373931_0001210
747 Ga0373931_0011646
748 Ga0373935_0115973
749 Ga0373935_0504720
750 Ga0373927_0106752
751 Ga0373927_0619268
752 Ga0373933_0007484
753 Ga0373947_0099273
754 Ga0373947_0364837
755 Ga0373947_0375492
756 Ga0373937_0014197
757 Ga0373925_0250705
758 Ga0395900_0130377
759 Ga0395905_0538820
760 Ga0395901_0398998
761 Ga0436365_0599385
762 Ga0439434_0163375
763 Ga0439435_0037381
764 Ga0466970_0382213
765 Ga0466960_0828555
766 Ga0466967_2380722
767 Ga0495592_0046113
768 Ga0495629_0037625
769 Ga0495651_0005425
770 Ga0495653_0015217
771 Ga0495653_0154300
772 Ga0495605_0185212
773 Ga0495664_0008910
774 Ga0495664_0023970
775 Ga0495584_0201121
776 Ga0495594_0090849
777 Ga0495608_0012848
778 Ga0495618_0001803
779 Ga0495618_0103406
780 Ga0495628_0049448
781 Ga0495628_0953691
782 Ga0495630_0493968
783 Ga0495630_0518908
784 Ga0495652_0028165
785 Ga0495665_0129049
786 Ga0495640_0022048
787 Ga0495640_0039558
788 Ga0495587_0009277
789 Ga0495645_0034568
790 Ga0495645_0107214
791 Ga0495667_0020664
792 Ga0495634_0807632
793 Ga0495635_0001915
794 Ga0495657_0004654
795 Ga0495599_0050771
796 Ga0495623_0026238
797 Ga0495646_0013533
798 Ga0495647_0196435
799 Ga0495613_0384304
800 Ga0495624_0314051
801 Ga0495624_0637145
802 Ga0495600_0007883
803 Ga0495581_0245402
804 Ga0495604_0005141
805 Ga0495674_0004849
806 Ga0495674_0022676
807 Ga0495672_0000808
808 Ga0495676_0191509
809 Ga0495676_0206631
810 Ga0495676_0362161
811 Ga0495680_0016455
812 Ga0495675_0049619
813 Ga0495684_0018050
814 Ga0495593_0285343
815 Ga0495602_0028120
816 Ga0496100_0016322
817 Ga0496100_0099723
818 Ga0496100_0751854
819 Ga0496101_0009513
820 Ga0496101_0389835
821 Ga0496101_1567468
822 Ga0496102_0104057
823 Ga0496102_0132595
824 Ga0496102_0186010
825 Ga0496103_0028802
826 Ga0496104_0001506
827 Ga0496104_0118518
828 Ga0496104_0698105
829 Ga0496105_0000338
830 Ga0496105_0000721
831 Ga0496106_0039801
832 Ga0496106_0066610
833 Ga0496106_0543215
834 Ga0496107_0068256
835 Ga0496107_0110883
836 Ga0496108_0002826
837 Ga0496108_1111271
838 Ga0496109_0000392
839 Ga0496109_0164088
840 Ga0496111_0020456
841 Ga0496112_0009684
842 Ga0496112_0561622
843 Ga0496113_0000243
844 Ga0496114_0181837
845 Ga0496115_0072867
846 Ga0496115_0079700
847 Ga0496115_0100459
848 Ga0496115_0512690
849 Ga0501297_032078
850 Ga0501031_0218025
851 Ga0501040_1042724
852 Ga0501067_0414607
853 Ga0501079_0535473
854 nmdc:mga03683_534803_c1
855 nmdc:mga03n38_110886_c1
856 nmdc:mga03n38_181393_c1
857 nmdc:mga03n38_471480_c1
858 nmdc:mga00v17_36376_c1
859 nmdc:mga00v17_650699_c1
860 nmdc:mga0yw44_231418_c1
861 nmdc:mga0yw44_699817_c1
862 nmdc:mga0yw44_89690_c1
863 nmdc:mga06z11_126113_c1
864 nmdc:mga06z11_273291_c1
865 nmdc:mga04h51_103246_c1
866 nmdc:mga07m45_262998_c1
867 nmdc:mga07m45_377178_c1
868 nmdc:mga07m45_785330_c1
869 nmdc:mga05p37_1774130_c1
870 nmdc:mga05p37_279409_c1
871 nmdc:mga05p37_402467_c1
872 nmdc:mga05p37_597824_c1
873 nmdc:mga06r32_33517_c1
874 nmdc:mga08y16_32126_c1
875 nmdc:mga0n895_280006_c1
876 nmdc:mga0n895_340708_c1
877 nmdc:mga0n895_88886_c1
878 nmdc:mga0rr50_11298_c1
879 nmdc:mga0rr50_605185_c1
880 nmdc:mga0rr50_958321_c1
881 nmdc:mga0a205_7173_c1
882 nmdc:mga0a205_89706_c1
883 nmdc:mga0sz30_152379_c1
884 nmdc:mga0sz30_29948_c1
885 nmdc:mga0sz30_65765_c1
886 Ga0495601_0001930
887 Ga0495601_0035524
888 Ga0495612_0003207
889 Ga0495612_0014197
890 Ga0495612_0277655
891 Ga0495595_0004619
892 Ga0495595_0340682
893 Ga0495619_0005358
894 Ga0495619_0013143
895 Ga0500562_023594
896 Ga0500562_160898
897 Ga0466962_0591137
898 Ga0530510_0295516

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14534

DUF4440

Domain of unknown function (DUF4440)

28

136

0.94

PF12680

SnoaL_2

SnoaL-like domain

32

137

0.88

PF13577

SnoaL_4

SnoaL-like domain

20

138

0.86

PF13474

SnoaL_3

SnoaL-like domain

28

139

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rob-assembly2.cif.gz_D the crystal structure of a conserved protein from planctomyces limnophilus dsm 3776 0.9645 4 126
3rob-assembly2.cif.gz_D the crystal structure of a conserved protein from planctomyces limnophilus dsm 3776 0.9278 4 126
3ef8-assembly1.cif.gz_A crystal structure of putative scytalone dehydratase (yp_496742.1) from novosphingobium aromaticivorans dsm 12444 at 1.50 a resolution 0.8771 4 127
5aii-assembly1.cif.gz_H discovery and characterization of thermophilic limonene-1,2-epoxide hydrolases from hot spring metagenomic libraries. ch55-sample-peg complex 0.8639 10 124
5ien-assembly2.cif.gz_B structure of cdl2.2, a computationally designed vitamin-d3 binder 0.8616 3 125
ID Description Score Start End Superfamily
3robD00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9471 4 126 3.10.450.50
3robD00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9175 4 126 3.10.450.50
af_O07237_11_153_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8743 4 127 3.10.450.50
af_O07237_11_153_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8488 4 127 3.10.450.50
5iepA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8453 1 125 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A3S1GAW5-F1-model_v4 SgcJ/EcaC family oxidoreductase 1 1 127
AF-A0A441YPR9-F1-model_v4 SgcJ/EcaC family oxidoreductase 1 1 97
AF-A0A7C2LRC3-F1-model_v4 SgcJ/EcaC family oxidoreductase 0.9996 1 127
AF-A0A554U268-F1-model_v4 deleted 0.9991 1 126
AF-A0A7R6XUT6-F1-model_v4 Ketosteroid isomerase 0.9974 1 126 GO:0016853

Map