F446336

General Info

Members Datasets Scaffolds Average Seq Length
449 209 898 182

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100440034|Ga0068856_1004400342
Length 207
Sequence MEPSGRVVRKSSGVNTESDARTTVQTDRARHPFVMEEAVAILSRTPATLDTLLRSLPQGWIAANEGGETWSAFDVIGHLIHGERTDWVQRARIILEHGEARAFDTFDRLAQFTMSEGRTLASLLDEFATLRRDNLRELAALGLSDADLDRRGRHPQLGVVTLRQLLATWVAHDLDHVVQISRVLAHQYAEEVGPWRSYLRIISGTPG

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
142 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
143 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
144 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
145 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
146 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
147 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
153 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
154 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
155 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
177 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
178 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
179 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
184 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
185 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
186 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
187 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
188 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
199 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
200 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
201 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
202 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
205 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
206 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
207 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.57
Nodule 0
Rhizoplane 2.45
Rhizosphere 91.76
Stem 0
Stem Tuber 0
Unclassified 18.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100440034 3300005614 Bacteria 1324
2 JGI25406J46586_10042803 3300003203 Bacteria 1582
3 Ga0065712_10194883 3300005290 Unclassified 1132
4 Ga0065712_10242104 3300005290 Bacteria 981
5 Ga0070676_10033798 3300005328 Bacteria 2934
6 Ga0070676_10061259 3300005328 Bacteria 2237
7 Ga0070676_10072703 3300005328 Bacteria 2068
8 Ga0070676_10142640 3300005328 Bacteria 1526
9 Ga0070690_100127530 3300005330 Bacteria 1715
10 Ga0070670_100036223 3300005331 Bacteria 4247
11 Ga0070670_100113126 3300005331 Bacteria 2340
12 Ga0070670_100373892 3300005331 Unclassified 1255
13 Ga0070677_10019459 3300005333 Bacteria 2459
14 Ga0070677_10378896 3300005333 Bacteria 740
15 Ga0068869_100006502 3300005334 Bacteria 7419
16 Ga0068869_100363304 3300005334 Bacteria 1183
17 Ga0068869_100503217 3300005334 Bacteria 1012
18 Ga0070666_10025849 3300005335 Bacteria 3830
19 Ga0068868_100406970 3300005338 Bacteria 1175
20 Ga0070660_101079383 3300005339 Bacteria 679
21 Ga0070689_100011567 3300005340 Bacteria 6324
22 Ga0070691_10021931 3300005341 Bacteria 2959
23 Ga0070687_100721793 3300005343 Unclassified 698
24 Ga0070661_100041669 3300005344 Bacteria 3351
25 Ga0070692_10142762 3300005345 Unclassified 1357
26 Ga0070668_100517713 3300005347 Bacteria 1035
27 Ga0070669_100061990 3300005353 Bacteria 2749
28 Ga0070669_100086393 3300005353 Bacteria 2344
29 Ga0070669_100322429 3300005353 Bacteria 1248
30 Ga0070675_100011457 3300005354 Bacteria 6943
31 Ga0070675_100014408 3300005354 Bacteria 6234
32 Ga0070675_100035335 3300005354 Bacteria 4060
33 Ga0070675_100088541 3300005354 Bacteria 2591
34 Ga0070675_100097413 3300005354 Unclassified 2473
35 Ga0070675_100149461 3300005354 Unclassified 2002
36 Ga0070671_100615181 3300005355 Unclassified 939
37 Ga0070674_100005414 3300005356 Bacteria 7371
38 Ga0070674_100050358 3300005356 Bacteria 2867
39 Ga0070674_100066508 3300005356 Bacteria 2533
40 Ga0070674_100252627 3300005356 Bacteria 1385
41 Ga0070674_100353726 3300005356 Bacteria 1187
42 Ga0070674_100605673 3300005356 Bacteria 926
43 Ga0070673_100105427 3300005364 Bacteria 2329
44 Ga0070673_100181630 3300005364 Bacteria 1801
45 Ga0070673_100777297 3300005364 Bacteria 883
46 Ga0070688_100180179 3300005365 Bacteria 1465
47 Ga0070688_100359486 3300005365 Bacteria 1068
48 Ga0070701_10010249 3300005438 Bacteria 4136
49 Ga0070701_10014454 3300005438 Bacteria 3621
50 Ga0070701_10139934 3300005438 Bacteria 1383
51 Ga0070705_100023781 3300005440 Bacteria 3296
52 Ga0070705_100027098 3300005440 Bacteria 3125
53 Ga0070705_100133374 3300005440 Bacteria 1623
54 Ga0070700_100023142 3300005441 Bacteria 3631
55 Ga0070700_100055486 3300005441 Bacteria 2480
56 Ga0070694_100030591 3300005444 Bacteria 3523
57 Ga0070694_100700283 3300005444 Bacteria 824
58 Ga0070708_100061451 3300005445 Unclassified 3356
59 Ga0070708_100091127 3300005445 Bacteria 2776
60 Ga0070708_100514479 3300005445 Bacteria 1129
61 Ga0070708_100834167 3300005445 Bacteria 866
62 Ga0070678_100254356 3300005456 Bacteria 1474
63 Ga0070678_100445012 3300005456 Bacteria 1134
64 Ga0070662_100288419 3300005457 Bacteria 1330
65 Ga0068867_100000666 3300005459 Bacteria 22771
66 Ga0068867_100009895 3300005459 Bacteria 6719
67 Ga0068867_100103989 3300005459 Unclassified 2173
68 Ga0068867_100577801 3300005459 Bacteria 977
69 Ga0070706_100167480 3300005467 Bacteria 2051
70 Ga0070706_100762732 3300005467 Bacteria 896
71 Ga0070707_100129739 3300005468 Bacteria 2451
72 Ga0070698_100021473 3300005471 Bacteria 6762
73 Ga0070698_100228276 3300005471 Unclassified 1795
74 Ga0070699_100036621 3300005518 Bacteria 4244
75 Ga0070699_100055424 3300005518 Bacteria 3432
76 Ga0070699_100631976 3300005518 Unclassified 977
77 Ga0070697_100033397 3300005536 Bacteria 4144
78 Ga0070697_100164859 3300005536 Bacteria 1873
79 Ga0070672_100007689 3300005543 Bacteria 7339
80 Ga0070672_100120937 3300005543 Bacteria 2143
81 Ga0070686_100145049 3300005544 Bacteria 1657
82 Ga0070686_100973779 3300005544 Unclassified 694
83 Ga0070686_101191104 3300005544 Unclassified 632
84 Ga0070695_100000436 3300005545 Bacteria 21672
85 Ga0070696_100000906 3300005546 Bacteria 19268
86 Ga0070696_100084567 3300005546 Bacteria 2251
87 Ga0070696_100484719 3300005546 Viruses 981
88 Ga0070665_100018067 3300005548 Bacteria 7078
89 Ga0070665_100195243 3300005548 Bacteria 2025
90 Ga0070665_100547081 3300005548 Bacteria 1170
91 Ga0070704_100011601 3300005549 Bacteria 5409
92 Ga0070704_100082604 3300005549 Bacteria 2369
93 Ga0070704_100130684 3300005549 Unclassified 1946
94 Ga0070664_100019293 3300005564 Bacteria 5609
95 Ga0070664_100139103 3300005564 Bacteria 2137
96 Ga0070664_100149294 3300005564 Bacteria 2063
97 Ga0070664_100198131 3300005564 Bacteria 1791
98 Ga0068854_100039188 3300005578 Bacteria 3337
99 Ga0068854_100041976 3300005578 Bacteria 3235
100 Ga0070702_100065065 3300005615 Bacteria 2135
101 Ga0070702_100956241 3300005615 Unclassified 675
102 Ga0068859_100080943 3300005617 Unclassified 3289
103 Ga0068859_100680580 3300005617 Bacteria 1120
104 Ga0068859_101321767 3300005617 Unclassified 795
105 Ga0068864_100172194 3300005618 Unclassified 1974
106 Ga0068864_100352930 3300005618 Bacteria 1388
107 Ga0068866_10010708 3300005718 Bacteria 3941
108 Ga0068861_100015427 3300005719 Bacteria 5383
109 Ga0068861_100192210 3300005719 Bacteria 1707
110 Ga0068861_100349881 3300005719 Bacteria 1296
111 Ga0068851_10046088 3300005834 Bacteria 2205
112 Ga0068870_10015212 3300005840 Bacteria 3647
113 Ga0068870_10016205 3300005840 Bacteria 3556
114 Ga0068870_10017205 3300005840 Bacteria 3469
115 Ga0068870_10017982 3300005840 Bacteria 3405
116 Ga0068863_100333120 3300005841 Unclassified 1476
117 Ga0068858_100009479 3300005842 Bacteria 9287
118 Ga0068858_100067317 3300005842 Bacteria 3317
119 Ga0068858_100086999 3300005842 Bacteria 2906
120 Ga0068858_100491767 3300005842 Unclassified 1185
121 Ga0068860_100584904 3300005843 Bacteria 1121
122 Ga0068860_100657743 3300005843 Unclassified 1056
123 Ga0068862_100019082 3300005844 Bacteria 5717
124 Ga0068862_100126910 3300005844 Bacteria 2253
125 Ga0068862_100151554 3300005844 Unclassified 2064
126 Ga0068862_100168072 3300005844 Bacteria 1962
127 Ga0081539_10000071 3300005985 Bacteria 233094
128 Ga0081539_10000184 3300005985 Bacteria 147966
129 Ga0081539_10003876 3300005985 Bacteria 17472
130 Ga0075363_100073230 3300006048 Unclassified 1864
131 Ga0075364_10045607 3300006051 Bacteria 2853
132 Ga0075364_10046851 3300006051 Bacteria 2815
133 Ga0075364_10047958 3300006051 Bacteria 2783
134 Ga0075432_10080850 3300006058 Bacteria 1178
135 Ga0075367_10023876 3300006178 Bacteria 3445
136 Ga0075367_10037909 3300006178 Bacteria 2803
137 Ga0075366_10004581 3300006195 Bacteria 7428
138 Ga0075366_10026701 3300006195 Bacteria 3383
139 Ga0075370_10031582 3300006353 Bacteria 2957
140 Ga0075428_100010625 3300006844 Bacteria 10233
141 Ga0075428_100049467 3300006844 Unclassified 4612
142 Ga0075428_100113787 3300006844 Bacteria 2948
143 Ga0075430_100005500 3300006846 Bacteria 10702
144 Ga0075430_100118797 3300006846 Unclassified 2204
145 Ga0075430_100204322 3300006846 Unclassified 1640
146 Ga0075430_100424297 3300006846 Bacteria 1098
147 Ga0075430_100518424 3300006846 Unclassified 983
148 Ga0075431_100001380 3300006847 Bacteria 22275
149 Ga0075431_100003176 3300006847 Bacteria 15903
150 Ga0075431_100050827 3300006847 Unclassified 4274
151 Ga0075431_100619390 3300006847 Unclassified 1065
152 Ga0075431_100654790 3300006847 Unclassified 1030
153 Ga0075433_10429933 3300006852 Bacteria 1164
154 Ga0075433_10676415 3300006852 Bacteria 904
155 Ga0075434_100006523 3300006871 Bacteria 10701
156 Ga0075434_100007073 3300006871 Bacteria 10359
157 Ga0075434_100407229 3300006871 Bacteria 1381
158 Ga0075429_100000529 3300006880 Bacteria 28983
159 Ga0075429_100002180 3300006880 Bacteria 16360
160 Ga0075429_100028859 3300006880 Bacteria 4819
161 Ga0075429_100056501 3300006880 Unclassified 3416
162 Ga0068865_100023039 3300006881 Bacteria 4071
163 Ga0075436_100378305 3300006914 Archaea 1024
164 Ga0097620_100080943 3300006931 Unclassified 3289
165 Ga0097620_100680603 3300006931 Bacteria 1120
166 Ga0097620_101321800 3300006931 Unclassified 795
167 Ga0075435_100026608 3300007076 Bacteria 4516
168 Ga0075435_100028448 3300007076 Unclassified 4384
169 Ga0075435_100174848 3300007076 Bacteria 1813
170 Ga0075435_100300312 3300007076 Bacteria 1373
171 Ga0105251_10037731 3300009011 Bacteria 2369
172 Ga0111539_10000868 3300009094 Bacteria 39485
173 Ga0111539_10003584 3300009094 Bacteria 20465
174 Ga0111539_10240531 3300009094 Bacteria 2107
175 Ga0111539_10562591 3300009094 Bacteria 1328
176 Ga0105245_12081885 3300009098 Bacteria 621
177 Ga0105247_10008546 3300009101 Bacteria 6238
178 Ga0114129_10002962 3300009147 Bacteria 23764
179 Ga0114129_10008847 3300009147 Bacteria 14367
180 Ga0114129_10014623 3300009147 Bacteria 11183
181 Ga0114129_10022254 3300009147 Bacteria 8998
182 Ga0114129_10033988 3300009147 Bacteria 7202
183 Ga0114129_10048696 3300009147 Bacteria 5955
184 Ga0114129_10150820 3300009147 Bacteria 3181
185 Ga0114129_10190460 3300009147 Bacteria 2786
186 Ga0114129_10204883 3300009147 Bacteria 2669
187 Ga0114129_10455919 3300009147 Bacteria 1676
188 Ga0114129_10767846 3300009147 Bacteria 1232
189 Ga0114129_10778899 3300009147 Unclassified 1222
190 Ga0114129_11139532 3300009147 Unclassified 974
191 Ga0105243_10009518 3300009148 Bacteria 7397
192 Ga0105243_10484844 3300009148 Unclassified 1168
193 Ga0105241_10830604 3300009174 Bacteria 853
194 Ga0105242_10061137 3300009176 Bacteria 3097
195 Ga0105242_10265540 3300009176 Bacteria 1552
196 Ga0105248_10024214 3300009177 Bacteria 6748
197 Ga0105248_10026479 3300009177 Bacteria 6452
198 Ga0105248_10164277 3300009177 Bacteria 2503
199 Ga0105248_10345036 3300009177 Bacteria 1676
200 Ga0105238_10003323 3300009551 Bacteria 16049
201 Ga0105249_10445639 3300009553 Bacteria 1333
202 Ga0105249_11390069 3300009553 Unclassified 774
203 Ga0157378_10510429 3300013297 Bacteria 1202
204 Ga0163163_10135377 3300014325 Bacteria 2505
205 Ga0163163_10175526 3300014325 Bacteria 2189
206 Ga0163163_10196035 3300014325 Unclassified 2068
207 Ga0163163_10505426 3300014325 Bacteria 1270
208 Ga0163163_10630942 3300014325 Bacteria 1135
209 Ga0163163_10704317 3300014325 Bacteria 1073
210 Ga0157380_10053262 3300014326 Unclassified 3207
211 Ga0157380_10064436 3300014326 Bacteria 2942
212 Ga0157380_10173597 3300014326 Bacteria 1886
213 Ga0157380_10200333 3300014326 Bacteria 1771
214 Ga0157380_11031558 3300014326 Bacteria 858
215 Ga0157377_10118907 3300014745 Bacteria 1599
216 Ga0157376_10309317 3300014969 Bacteria 1499
217 Ga0207656_10125561 3300025321 Bacteria 1198
218 Ga0207682_10010447 3300025893 Bacteria 3639
219 Ga0207682_10010844 3300025893 Bacteria 3567
220 Ga0207682_10106005 3300025893 Bacteria 1233
221 Ga0207642_10061401 3300025899 Unclassified 1748
222 Ga0207642_10340343 3300025899 Unclassified 882
223 Ga0207710_10007615 3300025900 Bacteria 4581
224 Ga0207688_10083672 3300025901 Bacteria 1825
225 Ga0207680_10015461 3300025903 Bacteria 3982
226 Ga0207645_10007784 3300025907 Bacteria 7540
227 Ga0207645_10009096 3300025907 Bacteria 6891
228 Ga0207645_10130941 3300025907 Bacteria 1632
229 Ga0207645_10132500 3300025907 Bacteria 1622
230 Ga0207643_10008076 3300025908 Bacteria 5645
231 Ga0207643_10022252 3300025908 Bacteria 3488
232 Ga0207643_10043942 3300025908 Bacteria 2522
233 Ga0207643_10157170 3300025908 Bacteria 1366
234 Ga0207684_10285754 3300025910 Bacteria 1422
235 Ga0207684_10720408 3300025910 Bacteria 847
236 Ga0207660_10724732 3300025917 Bacteria 811
237 Ga0207649_10072600 3300025920 Bacteria 2202
238 Ga0207652_10624552 3300025921 Bacteria 965
239 Ga0207681_10049684 3300025923 Bacteria 2836
240 Ga0207681_10123820 3300025923 Unclassified 1900
241 Ga0207694_10011954 3300025924 Bacteria 6545
242 Ga0207650_10043352 3300025925 Bacteria 3302
243 Ga0207650_10303970 3300025925 Bacteria 1303
244 Ga0207659_10147773 3300025926 Bacteria 1832
245 Ga0207659_10244819 3300025926 Unclassified 1452
246 Ga0207706_10432925 3300025933 Unclassified 1139
247 Ga0207686_10369217 3300025934 Unclassified 1085
248 Ga0207670_10074499 3300025936 Bacteria 2357
249 Ga0207670_10113870 3300025936 Bacteria 1954
250 Ga0207669_10045463 3300025937 Bacteria 2587
251 Ga0207669_10147582 3300025937 Bacteria 1642
252 Ga0207669_10184784 3300025937 Bacteria 1498
253 Ga0207704_10002616 3300025938 Bacteria 8126
254 Ga0207691_10144973 3300025940 Bacteria 2091
255 Ga0207691_10266323 3300025940 Bacteria 1476
256 Ga0207711_10039369 3300025941 Bacteria 4021
257 Ga0207711_10054916 3300025941 Bacteria 3419
258 Ga0207711_10591274 3300025941 Bacteria 1035
259 Ga0207689_10005266 3300025942 Bacteria 11593
260 Ga0207689_10053362 3300025942 Bacteria 3331
261 Ga0207689_10291584 3300025942 Unclassified 1351
262 Ga0207689_10312504 3300025942 Bacteria 1303
263 Ga0207679_10069476 3300025945 Bacteria 2651
264 Ga0207679_10109915 3300025945 Bacteria 2173
265 Ga0207679_10194981 3300025945 Unclassified 1687
266 Ga0207679_10316911 3300025945 Bacteria 1349
267 Ga0207651_10043077 3300025960 Bacteria 3010
268 Ga0207651_10061312 3300025960 Unclassified 2615
269 Ga0207651_10128578 3300025960 Bacteria 1935
270 Ga0207651_10225444 3300025960 Bacteria 1518
271 Ga0207712_10178168 3300025961 Bacteria 1667
272 Ga0207640_10045737 3300025981 Bacteria 2812
273 Ga0207677_10209349 3300026023 Bacteria 1556
274 Ga0207703_10053257 3300026035 Bacteria 3288
275 Ga0207703_10165062 3300026035 Bacteria 1942
276 Ga0207703_10514658 3300026035 Unclassified 1125
277 Ga0207678_10045168 3300026067 Bacteria 3809
278 Ga0207678_10050609 3300026067 Bacteria 3589
279 Ga0207708_10011604 3300026075 Bacteria 6566
280 Ga0207708_10033900 3300026075 Bacteria 3882
281 Ga0207708_10042250 3300026075 Bacteria 3475
282 Ga0207708_10574373 3300026075 Unclassified 953
283 Ga0207641_10054332 3300026088 Bacteria 3398
284 Ga0207641_10107573 3300026088 Bacteria 2467
285 Ga0207648_10002725 3300026089 Bacteria 18771
286 Ga0207648_10007887 3300026089 Bacteria 10387
287 Ga0207648_10068410 3300026089 Bacteria 3094
288 Ga0207648_10294125 3300026089 Unclassified 1455
289 Ga0207648_10949352 3300026089 Bacteria 804
290 Ga0207676_10031034 3300026095 Bacteria 4016
291 Ga0207676_10256942 3300026095 Bacteria 1575
292 Ga0207676_10273555 3300026095 Unclassified 1530
293 Ga0207675_100004375 3300026118 Bacteria 13654
294 Ga0207675_100026632 3300026118 Bacteria 5383
295 Ga0207675_100403884 3300026118 Bacteria 1347
296 Ga0207675_100701006 3300026118 Bacteria 1021
297 Ga0207683_10299000 3300026121 Bacteria 1472
298 Ga0207683_10365289 3300026121 Unclassified 1326
299 Ga0207428_10005794 3300027907 Bacteria 11458
300 Ga0207428_10095490 3300027907 Bacteria 2303
301 Ga0207428_10130414 3300027907 Bacteria 1924
302 Ga0207428_10225556 3300027907 Bacteria 1403
303 Ga0268266_10147843 3300028379 Unclassified 2114
304 Ga0268266_10791160 3300028379 Bacteria 916
305 Ga0268265_10129236 3300028380 Bacteria 2096
306 Ga0268265_10404182 3300028380 Bacteria 1263
307 Ga0268265_10578534 3300028380 Bacteria 1070
308 Ga0268265_10660328 3300028380 Bacteria 1006
309 Ga0268264_10280648 3300028381 Unclassified 1560
310 Ga0307408_100022305 3300031548 Bacteria 4300
311 Ga0307408_100570175 3300031548 Bacteria 1001
312 Ga0307405_10267051 3300031731 Bacteria 1281
313 Ga0307410_10402122 3300031852 Bacteria 1107
314 Ga0307410_10426319 3300031852 Bacteria 1077
315 Ga0307406_10049605 3300031901 Unclassified 2657
316 Ga0307406_10344842 3300031901 Bacteria 1161
317 Ga0307407_10442911 3300031903 Bacteria 941
318 Ga0307412_10024230 3300031911 Bacteria 3745
319 Ga0307412_10076851 3300031911 Bacteria 2295
320 Ga0307412_10365134 3300031911 Bacteria 1164
321 Ga0307409_100906845 3300031995 Bacteria 895
322 Ga0307416_100024967 3300032002 Bacteria 4373
323 Ga0307416_100105027 3300032002 Bacteria 2471
324 Ga0307416_100333724 3300032002 Bacteria 1525
325 Ga0307414_10161012 3300032004 Bacteria 1783
326 Ga0307414_10213888 3300032004 Bacteria 1578
327 Ga0307411_10226102 3300032005 Bacteria 1455
328 Ga0307411_10320671 3300032005 Bacteria 1251
329 Ga0307415_100057409 3300032126 Bacteria 2675
330 Ga0307415_100461199 3300032126 Bacteria 1101
331 Ga0373936_0145788 3300035113 Bacteria 1024
332 Ga0451791_0551253 3300041451 Bacteria 970
333 Ga0439450_007585 3300042008 Bacteria 1993
334 Ga0450891_004905 3300042129 Unclassified 1244
335 Ga0439464_0007469 3300042439 Bacteria 2858
336 Ga0439464_0053785 3300042439 Bacteria 1169
337 Ga0439460_0098399 3300042461 Bacteria 937
338 Ga0450893_0053727 3300042532 Bacteria 759
339 Ga0495603_0151232 3300046455 Bacteria 1348
340 Ga0495580_0326087 3300046472 Bacteria 1043
341 Ga0495664_0089336 3300046477 Bacteria 1852
342 Ga0495586_0203819 3300046535 Bacteria 1122
343 Ga0495621_0001577 3300046539 Bacteria 5942
344 Ga0495622_0286858 3300046557 Bacteria 719
345 Ga0495588_0069582 3300046674 Bacteria 1829
346 Ga0495588_0154004 3300046674 Bacteria 1215
347 Ga0495636_0005650 3300047318 Bacteria 4904
348 Ga0495674_0109041 3300047319 Bacteria 2349
349 Ga0496102_0003709 3300048905 Bacteria 12910
350 Ga0496104_0022085 3300048907 Bacteria 5848
351 Ga0496104_0874579 3300048907 Unclassified 804
352 Ga0496107_0110486 3300048910 Bacteria 2020
353 Ga0496108_0071838 3300048911 Bacteria 2921
354 Ga0496108_0316763 3300048911 Bacteria 1360
355 Ga0496110_0472379 3300048913 Bacteria 1142
356 Ga0496111_0076389 3300048914 Bacteria 2441
357 Ga0496112_0018058 3300048915 Bacteria 6638
358 Ga0496113_0062882 3300048916 Bacteria 2804
359 Ga0496126_0000010 3300048929 Bacteria 744888
360 Ga0501299_001295 3300049522 Bacteria 3181
361 Ga0501031_0138872 3300049568 Bacteria 1588
362 Ga0501036_0087708 3300049572 Bacteria 2630
363 Ga0501036_0795747 3300049572 Bacteria 779
364 Ga0501040_0116860 3300049576 Bacteria 1869
365 Ga0501042_1036687 3300049578 Bacteria 598
366 Ga0501071_0459110 3300049587 Bacteria 975
367 Ga0501072_0121830 3300049588 Bacteria 2078
368 Ga0501072_0719202 3300049588 Unclassified 784
369 Ga0501074_0083111 3300049590 Bacteria 2296
370 Ga0501075_0083144 3300049591 Unclassified 2425
371 Ga0501075_0276441 3300049591 Bacteria 1280
372 Ga0501075_0900545 3300049591 Bacteria 673
373 Ga0501076_0083334 3300049592 Bacteria 2568
374 Ga0501076_0130968 3300049592 Bacteria 2034
375 Ga0501076_0222870 3300049592 Bacteria 1541
376 Ga0501076_0778541 3300049592 Unclassified 789
377 Ga0501077_0142138 3300049593 Bacteria 1522
378 Ga0501077_0576316 3300049593 Bacteria 722
379 Ga0501217_221729 3300049661 Bacteria 598
380 Ga0501235_050502 3300049669 Bacteria 963
381 Ga0501259_068415 3300049688 Bacteria 757
382 Ga0501079_0128443 3300049741 Bacteria 1972
383 Ga0501080_0064987 3300049742 Unclassified 3394
384 Ga0501081_0195713 3300049743 Bacteria 1465
385 nmdc:mga00v17_115107_c1 3300050491 Unclassified 1709
386 nmdc:mga00v17_279755_c1 3300050491 Bacteria 1083
387 nmdc:mga0yw44_5887_c1 3300050492 Bacteria 5858
388 nmdc:mga0k408_389972_c1 3300050493 Bacteria 829
389 nmdc:mga0k408_398539_c1 3300050493 Bacteria 819
390 nmdc:mga0k408_89319_c1 3300050493 Bacteria 1810
391 nmdc:mga06z11_2522_c1 3300050494 Bacteria 6997
392 nmdc:mga06z11_30894_c1 3300050494 Bacteria 2597
393 nmdc:mga06z11_58656_c1 3300050494 Bacteria 1998
394 nmdc:mga04h51_25329_c1 3300050495 Bacteria 1825
395 nmdc:mga07m45_142589_c1 3300050496 Bacteria 1388
396 nmdc:mga05p37_1141464_c1 3300050507 Unclassified 811
397 nmdc:mga05p37_1330265_c1 3300050507 Archaea 730
398 nmdc:mga05p37_134821_c1 3300050507 Bacteria 3029
399 nmdc:mga05p37_27271_c1 3300050507 Bacteria 6955
400 nmdc:mga05p37_31409_c1 3300050507 Bacteria 6486
401 nmdc:mga05p37_34991_c1 3300050507 Bacteria 6157
402 nmdc:mga05p37_425_c1 3300050507 Bacteria 45660
403 nmdc:mga05p37_53590_c1 3300050507 Unclassified 4961
404 nmdc:mga05p37_565862_c1 3300050507 Bacteria 1290
405 nmdc:mga05p37_571221_c1 3300050507 Bacteria 1283
406 nmdc:mga05p37_651381_c1 3300050507 Bacteria 1179
407 nmdc:mga05p37_752514_c1 3300050507 Unclassified 1074
408 nmdc:mga05p37_93234_c1 3300050507 Unclassified 3710
409 nmdc:mga09592_190570_c1 3300050508 Bacteria 1775
410 nmdc:mga09592_34446_c1 3300050508 Bacteria 4233
411 nmdc:mga09592_56098_c1 3300050508 Unclassified 3329
412 nmdc:mga09592_6071_c1 3300050508 Bacteria 5455
413 nmdc:mga0qj67_372062_c1 3300050509 Bacteria 1154
414 nmdc:mga0qj67_40786_c1 3300050509 Bacteria 3649
415 nmdc:mga0qj67_408879_c1 3300050509 Unclassified 1095
416 nmdc:mga0qj67_62774_c1 3300050509 Unclassified 2953
417 nmdc:mga06r32_16095_c1 3300050510 Bacteria 6810
418 nmdc:mga06r32_49253_c1 3300050510 Unclassified 4029
419 nmdc:mga06r32_644748_c1 3300050510 Bacteria 1027
420 nmdc:mga06r32_906627_c1 3300050510 Unclassified 838
421 nmdc:mga06r32_92022_c1 3300050510 Bacteria 2964
422 nmdc:mga08y16_1267049_c1 3300050511 Unclassified 705
423 nmdc:mga08y16_193332_c1 3300050511 Bacteria 2110
424 nmdc:mga08y16_239784_c1 3300050511 Bacteria 1874
425 nmdc:mga08y16_4600_c1 3300050511 Bacteria 14384
426 nmdc:mga08y16_776132_c1 3300050511 Bacteria 953
427 nmdc:mga0n895_160522_c1 3300050512 Unclassified 2280
428 nmdc:mga0n895_182550_c1 3300050512 Unclassified 2130
429 nmdc:mga0n895_53327_c1 3300050512 Archaea 3974
430 nmdc:mga0n895_550694_c1 3300050512 Bacteria 1159
431 nmdc:mga0n895_651912_c1 3300050512 Unclassified 1052
432 nmdc:mga0rr50_4904_c1 3300050513 Bacteria 7917
433 nmdc:mga0rr50_85897_c1 3300050513 Bacteria 2439
434 nmdc:mga08x19_52149_c1 3300050514 Unclassified 2630
435 nmdc:mga0a205_559476_c1 3300050515 Unclassified 998
436 Ga0500651_0341694 3300053093 Bacteria 851
437 Ga0500555_000379 3300053103 Bacteria 18744
438 Ga0500616_0000262 3300053153 Bacteria 80829
439 Ga0500645_000728 3300053730 Bacteria 20297
440 Ga0500609_030959 3300053731 Bacteria 735
441 Ga0501084_0362305 3300054114 Bacteria 1225
442 Ga0501084_0646217 3300054114 Bacteria 893
443 Ga0590071_005148 3300059421 Bacteria 3154
444 Ga0590071_033381 3300059421 Unclassified 1230
445 Ga0590074_044762 3300059423 Bacteria 801
446 Ga0590075_018060 3300059424 Bacteria 1742
447 Ga0590077_002546 3300059426 Bacteria 3864
448 Ga0501082_0872788 3300060353 Unclassified 787
449 Ga0530510_0198946 3300061734 Bacteria 1488
450 Ga0068856_100440034
451 JGI25406J46586_10042803
452 Ga0065712_10194883
453 Ga0065712_10242104
454 Ga0070676_10033798
455 Ga0070676_10061259
456 Ga0070676_10072703
457 Ga0070676_10142640
458 Ga0070690_100127530
459 Ga0070670_100036223
460 Ga0070670_100113126
461 Ga0070670_100373892
462 Ga0070677_10019459
463 Ga0070677_10378896
464 Ga0068869_100006502
465 Ga0068869_100363304
466 Ga0068869_100503217
467 Ga0070666_10025849
468 Ga0068868_100406970
469 Ga0070660_101079383
470 Ga0070689_100011567
471 Ga0070691_10021931
472 Ga0070687_100721793
473 Ga0070661_100041669
474 Ga0070692_10142762
475 Ga0070668_100517713
476 Ga0070669_100061990
477 Ga0070669_100086393
478 Ga0070669_100322429
479 Ga0070675_100011457
480 Ga0070675_100014408
481 Ga0070675_100035335
482 Ga0070675_100088541
483 Ga0070675_100097413
484 Ga0070675_100149461
485 Ga0070671_100615181
486 Ga0070674_100005414
487 Ga0070674_100050358
488 Ga0070674_100066508
489 Ga0070674_100252627
490 Ga0070674_100353726
491 Ga0070674_100605673
492 Ga0070673_100105427
493 Ga0070673_100181630
494 Ga0070673_100777297
495 Ga0070688_100180179
496 Ga0070688_100359486
497 Ga0070701_10010249
498 Ga0070701_10014454
499 Ga0070701_10139934
500 Ga0070705_100023781
501 Ga0070705_100027098
502 Ga0070705_100133374
503 Ga0070700_100023142
504 Ga0070700_100055486
505 Ga0070694_100030591
506 Ga0070694_100700283
507 Ga0070708_100061451
508 Ga0070708_100091127
509 Ga0070708_100514479
510 Ga0070708_100834167
511 Ga0070678_100254356
512 Ga0070678_100445012
513 Ga0070662_100288419
514 Ga0068867_100000666
515 Ga0068867_100009895
516 Ga0068867_100103989
517 Ga0068867_100577801
518 Ga0070706_100167480
519 Ga0070706_100762732
520 Ga0070707_100129739
521 Ga0070698_100021473
522 Ga0070698_100228276
523 Ga0070699_100036621
524 Ga0070699_100055424
525 Ga0070699_100631976
526 Ga0070697_100033397
527 Ga0070697_100164859
528 Ga0070672_100007689
529 Ga0070672_100120937
530 Ga0070686_100145049
531 Ga0070686_100973779
532 Ga0070686_101191104
533 Ga0070695_100000436
534 Ga0070696_100000906
535 Ga0070696_100084567
536 Ga0070696_100484719
537 Ga0070665_100018067
538 Ga0070665_100195243
539 Ga0070665_100547081
540 Ga0070704_100011601
541 Ga0070704_100082604
542 Ga0070704_100130684
543 Ga0070664_100019293
544 Ga0070664_100139103
545 Ga0070664_100149294
546 Ga0070664_100198131
547 Ga0068854_100039188
548 Ga0068854_100041976
549 Ga0070702_100065065
550 Ga0070702_100956241
551 Ga0068859_100080943
552 Ga0068859_100680580
553 Ga0068859_101321767
554 Ga0068864_100172194
555 Ga0068864_100352930
556 Ga0068866_10010708
557 Ga0068861_100015427
558 Ga0068861_100192210
559 Ga0068861_100349881
560 Ga0068851_10046088
561 Ga0068870_10015212
562 Ga0068870_10016205
563 Ga0068870_10017205
564 Ga0068870_10017982
565 Ga0068863_100333120
566 Ga0068858_100009479
567 Ga0068858_100067317
568 Ga0068858_100086999
569 Ga0068858_100491767
570 Ga0068860_100584904
571 Ga0068860_100657743
572 Ga0068862_100019082
573 Ga0068862_100126910
574 Ga0068862_100151554
575 Ga0068862_100168072
576 Ga0081539_10000071
577 Ga0081539_10000184
578 Ga0081539_10003876
579 Ga0075363_100073230
580 Ga0075364_10045607
581 Ga0075364_10046851
582 Ga0075364_10047958
583 Ga0075432_10080850
584 Ga0075367_10023876
585 Ga0075367_10037909
586 Ga0075366_10004581
587 Ga0075366_10026701
588 Ga0075370_10031582
589 Ga0075428_100010625
590 Ga0075428_100049467
591 Ga0075428_100113787
592 Ga0075430_100005500
593 Ga0075430_100118797
594 Ga0075430_100204322
595 Ga0075430_100424297
596 Ga0075430_100518424
597 Ga0075431_100001380
598 Ga0075431_100003176
599 Ga0075431_100050827
600 Ga0075431_100619390
601 Ga0075431_100654790
602 Ga0075433_10429933
603 Ga0075433_10676415
604 Ga0075434_100006523
605 Ga0075434_100007073
606 Ga0075434_100407229
607 Ga0075429_100000529
608 Ga0075429_100002180
609 Ga0075429_100028859
610 Ga0075429_100056501
611 Ga0068865_100023039
612 Ga0075436_100378305
613 Ga0097620_100080943
614 Ga0097620_100680603
615 Ga0097620_101321800
616 Ga0075435_100026608
617 Ga0075435_100028448
618 Ga0075435_100174848
619 Ga0075435_100300312
620 Ga0105251_10037731
621 Ga0111539_10000868
622 Ga0111539_10003584
623 Ga0111539_10240531
624 Ga0111539_10562591
625 Ga0105245_12081885
626 Ga0105247_10008546
627 Ga0114129_10002962
628 Ga0114129_10008847
629 Ga0114129_10014623
630 Ga0114129_10022254
631 Ga0114129_10033988
632 Ga0114129_10048696
633 Ga0114129_10150820
634 Ga0114129_10190460
635 Ga0114129_10204883
636 Ga0114129_10455919
637 Ga0114129_10767846
638 Ga0114129_10778899
639 Ga0114129_11139532
640 Ga0105243_10009518
641 Ga0105243_10484844
642 Ga0105241_10830604
643 Ga0105242_10061137
644 Ga0105242_10265540
645 Ga0105248_10024214
646 Ga0105248_10026479
647 Ga0105248_10164277
648 Ga0105248_10345036
649 Ga0105238_10003323
650 Ga0105249_10445639
651 Ga0105249_11390069
652 Ga0157378_10510429
653 Ga0163163_10135377
654 Ga0163163_10175526
655 Ga0163163_10196035
656 Ga0163163_10505426
657 Ga0163163_10630942
658 Ga0163163_10704317
659 Ga0157380_10053262
660 Ga0157380_10064436
661 Ga0157380_10173597
662 Ga0157380_10200333
663 Ga0157380_11031558
664 Ga0157377_10118907
665 Ga0157376_10309317
666 Ga0207656_10125561
667 Ga0207682_10010447
668 Ga0207682_10010844
669 Ga0207682_10106005
670 Ga0207642_10061401
671 Ga0207642_10340343
672 Ga0207710_10007615
673 Ga0207688_10083672
674 Ga0207680_10015461
675 Ga0207645_10007784
676 Ga0207645_10009096
677 Ga0207645_10130941
678 Ga0207645_10132500
679 Ga0207643_10008076
680 Ga0207643_10022252
681 Ga0207643_10043942
682 Ga0207643_10157170
683 Ga0207684_10285754
684 Ga0207684_10720408
685 Ga0207660_10724732
686 Ga0207649_10072600
687 Ga0207652_10624552
688 Ga0207681_10049684
689 Ga0207681_10123820
690 Ga0207694_10011954
691 Ga0207650_10043352
692 Ga0207650_10303970
693 Ga0207659_10147773
694 Ga0207659_10244819
695 Ga0207706_10432925
696 Ga0207686_10369217
697 Ga0207670_10074499
698 Ga0207670_10113870
699 Ga0207669_10045463
700 Ga0207669_10147582
701 Ga0207669_10184784
702 Ga0207704_10002616
703 Ga0207691_10144973
704 Ga0207691_10266323
705 Ga0207711_10039369
706 Ga0207711_10054916
707 Ga0207711_10591274
708 Ga0207689_10005266
709 Ga0207689_10053362
710 Ga0207689_10291584
711 Ga0207689_10312504
712 Ga0207679_10069476
713 Ga0207679_10109915
714 Ga0207679_10194981
715 Ga0207679_10316911
716 Ga0207651_10043077
717 Ga0207651_10061312
718 Ga0207651_10128578
719 Ga0207651_10225444
720 Ga0207712_10178168
721 Ga0207640_10045737
722 Ga0207677_10209349
723 Ga0207703_10053257
724 Ga0207703_10165062
725 Ga0207703_10514658
726 Ga0207678_10045168
727 Ga0207678_10050609
728 Ga0207708_10011604
729 Ga0207708_10033900
730 Ga0207708_10042250
731 Ga0207708_10574373
732 Ga0207641_10054332
733 Ga0207641_10107573
734 Ga0207648_10002725
735 Ga0207648_10007887
736 Ga0207648_10068410
737 Ga0207648_10294125
738 Ga0207648_10949352
739 Ga0207676_10031034
740 Ga0207676_10256942
741 Ga0207676_10273555
742 Ga0207675_100004375
743 Ga0207675_100026632
744 Ga0207675_100403884
745 Ga0207675_100701006
746 Ga0207683_10299000
747 Ga0207683_10365289
748 Ga0207428_10005794
749 Ga0207428_10095490
750 Ga0207428_10130414
751 Ga0207428_10225556
752 Ga0268266_10147843
753 Ga0268266_10791160
754 Ga0268265_10129236
755 Ga0268265_10404182
756 Ga0268265_10578534
757 Ga0268265_10660328
758 Ga0268264_10280648
759 Ga0307408_100022305
760 Ga0307408_100570175
761 Ga0307405_10267051
762 Ga0307410_10402122
763 Ga0307410_10426319
764 Ga0307406_10049605
765 Ga0307406_10344842
766 Ga0307407_10442911
767 Ga0307412_10024230
768 Ga0307412_10076851
769 Ga0307412_10365134
770 Ga0307409_100906845
771 Ga0307416_100024967
772 Ga0307416_100105027
773 Ga0307416_100333724
774 Ga0307414_10161012
775 Ga0307414_10213888
776 Ga0307411_10226102
777 Ga0307411_10320671
778 Ga0307415_100057409
779 Ga0307415_100461199
780 Ga0373936_0145788
781 Ga0451791_0551253
782 Ga0439450_007585
783 Ga0450891_004905
784 Ga0439464_0007469
785 Ga0439464_0053785
786 Ga0439460_0098399
787 Ga0450893_0053727
788 Ga0495603_0151232
789 Ga0495580_0326087
790 Ga0495664_0089336
791 Ga0495586_0203819
792 Ga0495621_0001577
793 Ga0495622_0286858
794 Ga0495588_0069582
795 Ga0495588_0154004
796 Ga0495636_0005650
797 Ga0495674_0109041
798 Ga0496102_0003709
799 Ga0496104_0022085
800 Ga0496104_0874579
801 Ga0496107_0110486
802 Ga0496108_0071838
803 Ga0496108_0316763
804 Ga0496110_0472379
805 Ga0496111_0076389
806 Ga0496112_0018058
807 Ga0496113_0062882
808 Ga0496126_0000010
809 Ga0501299_001295
810 Ga0501031_0138872
811 Ga0501036_0087708
812 Ga0501036_0795747
813 Ga0501040_0116860
814 Ga0501042_1036687
815 Ga0501071_0459110
816 Ga0501072_0121830
817 Ga0501072_0719202
818 Ga0501074_0083111
819 Ga0501075_0083144
820 Ga0501075_0276441
821 Ga0501075_0900545
822 Ga0501076_0083334
823 Ga0501076_0130968
824 Ga0501076_0222870
825 Ga0501076_0778541
826 Ga0501077_0142138
827 Ga0501077_0576316
828 Ga0501217_221729
829 Ga0501235_050502
830 Ga0501259_068415
831 Ga0501079_0128443
832 Ga0501080_0064987
833 Ga0501081_0195713
834 nmdc:mga00v17_115107_c1
835 nmdc:mga00v17_279755_c1
836 nmdc:mga0yw44_5887_c1
837 nmdc:mga0k408_389972_c1
838 nmdc:mga0k408_398539_c1
839 nmdc:mga0k408_89319_c1
840 nmdc:mga06z11_2522_c1
841 nmdc:mga06z11_30894_c1
842 nmdc:mga06z11_58656_c1
843 nmdc:mga04h51_25329_c1
844 nmdc:mga07m45_142589_c1
845 nmdc:mga05p37_1141464_c1
846 nmdc:mga05p37_1330265_c1
847 nmdc:mga05p37_134821_c1
848 nmdc:mga05p37_27271_c1
849 nmdc:mga05p37_31409_c1
850 nmdc:mga05p37_34991_c1
851 nmdc:mga05p37_425_c1
852 nmdc:mga05p37_53590_c1
853 nmdc:mga05p37_565862_c1
854 nmdc:mga05p37_571221_c1
855 nmdc:mga05p37_651381_c1
856 nmdc:mga05p37_752514_c1
857 nmdc:mga05p37_93234_c1
858 nmdc:mga09592_190570_c1
859 nmdc:mga09592_34446_c1
860 nmdc:mga09592_56098_c1
861 nmdc:mga09592_6071_c1
862 nmdc:mga0qj67_372062_c1
863 nmdc:mga0qj67_40786_c1
864 nmdc:mga0qj67_408879_c1
865 nmdc:mga0qj67_62774_c1
866 nmdc:mga06r32_16095_c1
867 nmdc:mga06r32_49253_c1
868 nmdc:mga06r32_644748_c1
869 nmdc:mga06r32_906627_c1
870 nmdc:mga06r32_92022_c1
871 nmdc:mga08y16_1267049_c1
872 nmdc:mga08y16_193332_c1
873 nmdc:mga08y16_239784_c1
874 nmdc:mga08y16_4600_c1
875 nmdc:mga08y16_776132_c1
876 nmdc:mga0n895_160522_c1
877 nmdc:mga0n895_182550_c1
878 nmdc:mga0n895_53327_c1
879 nmdc:mga0n895_550694_c1
880 nmdc:mga0n895_651912_c1
881 nmdc:mga0rr50_4904_c1
882 nmdc:mga0rr50_85897_c1
883 nmdc:mga08x19_52149_c1
884 nmdc:mga0a205_559476_c1
885 Ga0500651_0341694
886 Ga0500555_000379
887 Ga0500616_0000262
888 Ga0500645_000728
889 Ga0500609_030959
890 Ga0501084_0362305
891 Ga0501084_0646217
892 Ga0590071_005148
893 Ga0590071_033381
894 Ga0590074_044762
895 Ga0590075_018060
896 Ga0590077_002546
897 Ga0501082_0872788
898 Ga0530510_0198946

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

41

180

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rd9-assembly1.cif.gz_A crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.862 1 182
2rd9-assembly3.cif.gz_B crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.8594 1 185
2rd9-assembly3.cif.gz_B crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.8464 1 185
2rd9-assembly1.cif.gz_A crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.828 1 182
2yqy-assembly1.cif.gz_A crystal structure of tt2238, a four-helix bundle protein 0.7985 17 165
ID Description Score Start End Superfamily
2rd9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9048 9 182 1.20.120.450
2rd9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8751 9 182 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8009 3 171 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.788 17 164 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7744 3 171 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A2V9UE62-F1-model_v4 DinB-like domain-containing protein 0.9901 14 155
AF-A0A0S8A273-F1-model_v4 DinB-like domain-containing protein 0.99 14 167
AF-A0A2V8NS09-F1-model_v4 DinB-like domain-containing protein 0.9852 12 168
AF-A0A2D6PQD7-F1-model_v4 DinB-like domain-containing protein 0.9783 18 179
AF-A0A0S8A273-F1-model_v4 DinB-like domain-containing protein 0.9774 14 167

Map