F446318

General Info

Members Datasets Scaffolds Average Seq Length
449 229 898 362

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100144895|Ga0070714_1001448953
Length 397
Sequence VTPRPSSSRHHLVLSRPRGLGRRLWPAAAAVTAGALVTMTLAASGASAAPACSGCGYTQINMVSNQPGHAPLTDPDLVNAWGLSASPGTNSAPGSPLWVSDNGTDVTTLYAGATATTVNKVALTVSIPSGAPTGQVFNSDSNPNDFVVTDSAGHSGRAVFLFDTEAGSIAGWNPGAGTTPPPSTVAEEPVTNFANAVYKGLAIAQASDGNTYLYAANFRSGRVEVYNSKFMPVQLPGGLFLDPKIPAGYAPFNVQELAGQLYVTYAKQDATQHDDVAGQGHGFVDVFTNDGALVRRLVTRGQLNSPWGLALAPADFGQFSGDLLVGNFGDGHINVYDPNNGARLGELRQANGQPIVIDGLWGLRFGNGNAAKTNELLFSAGPDDESNGLLGKIVANS

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
176 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
177 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
178 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
179 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
180 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
181 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
182 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
183 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
184 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
194 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
200 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
207 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.55
Metatranscriptomes 2.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.58
Rhizosphere 86.86
Stem 0
Stem Tuber 0
Unclassified 24.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100144895 3300005435 Bacteria 2136
2 JGI24744J21845_10001678 3300002077 Unclassified 4431
3 JGI24742J22300_10008155 3300002244 Bacteria 1728
4 rootH1_10230569 3300003323 Unclassified 1591
5 Ga0058863_11867850 3300004799 Bacteria 1781
6 Ga0058860_11994708 3300004801 Bacteria 1342
7 Ga0058862_12661883 3300004803 Bacteria 1153
8 Ga0070690_100017768 3300005330 Unclassified 4285
9 Ga0070670_100000828 3300005331 Bacteria 24167
10 Ga0068869_100024854 3300005334 Unclassified 4153
11 Ga0070666_10042174 3300005335 Unclassified 3052
12 Ga0070666_10186193 3300005335 Bacteria 1458
13 Ga0070682_100005060 3300005337 Bacteria 7325
14 Ga0070682_100146171 3300005337 Bacteria 1617
15 Ga0068868_100003764 3300005338 Bacteria 10595
16 Ga0068868_100017699 3300005338 Bacteria 5314
17 Ga0068868_100025045 3300005338 Bacteria 4532
18 Ga0068868_100076861 3300005338 Unclassified 2670
19 Ga0068868_100101631 3300005338 Bacteria 2327
20 Ga0070660_100014259 3300005339 Bacteria 5722
21 Ga0070660_100211590 3300005339 Bacteria 1574
22 Ga0070689_100005116 3300005340 Bacteria 8919
23 Ga0070691_10030889 3300005341 Bacteria 2510
24 Ga0070687_100036763 3300005343 Bacteria 2443
25 Ga0070687_100040177 3300005343 Bacteria 2356
26 Ga0070692_10049858 3300005345 Bacteria 2173
27 Ga0070668_100005856 3300005347 Bacteria 9111
28 Ga0070669_100086749 3300005353 Unclassified 2339
29 Ga0070675_100183023 3300005354 Bacteria 1812
30 Ga0070671_100037578 3300005355 Unclassified 4016
31 Ga0070674_100009668 3300005356 Bacteria 5786
32 Ga0070673_100174378 3300005364 Bacteria 1837
33 Ga0070673_100213501 3300005364 Bacteria 1667
34 Ga0070688_100156708 3300005365 Bacteria 1561
35 Ga0070659_100056451 3300005366 Unclassified 3096
36 Ga0070659_100060112 3300005366 Unclassified 3002
37 Ga0070667_100092382 3300005367 Bacteria 2604
38 Ga0070709_10005752 3300005434 Bacteria 6724
39 Ga0070709_10029069 3300005434 Unclassified 3302
40 Ga0070714_100041992 3300005435 Bacteria 3862
41 Ga0070714_100043577 3300005435 Bacteria 3795
42 Ga0070714_100358637 3300005435 Bacteria 1370
43 Ga0070713_100015141 3300005436 Bacteria 5750
44 Ga0070713_100026404 3300005436 Unclassified 4558
45 Ga0070713_100082863 3300005436 Bacteria 2740
46 Ga0070713_100142844 3300005436 Bacteria 2122
47 Ga0070710_10009150 3300005437 Bacteria 4842
48 Ga0070710_10033703 3300005437 Bacteria 2782
49 Ga0070710_10105259 3300005437 Unclassified 1686
50 Ga0070701_10115590 3300005438 Bacteria 1505
51 Ga0070711_100002059 3300005439 Bacteria 11337
52 Ga0070711_100005131 3300005439 Bacteria 7800
53 Ga0070711_100130716 3300005439 Bacteria 1869
54 Ga0070711_100227869 3300005439 Unclassified 1452
55 Ga0070705_100022466 3300005440 Bacteria 3371
56 Ga0070705_100073448 3300005440 Bacteria 2075
57 Ga0070700_100005089 3300005441 Bacteria 6935
58 Ga0070700_100126096 3300005441 Bacteria 1722
59 Ga0070694_100004977 3300005444 Bacteria 8009
60 Ga0070694_100222047 3300005444 Bacteria 1417
61 Ga0070708_100019742 3300005445 Bacteria 5669
62 Ga0070708_100034712 3300005445 Bacteria 4389
63 Ga0070708_100143369 3300005445 Bacteria 2217
64 Ga0070708_100205932 3300005445 Bacteria 1843
65 Ga0070678_100013728 3300005456 Bacteria 5090
66 Ga0070662_100190875 3300005457 Bacteria 1620
67 Ga0068867_100009768 3300005459 Bacteria 6761
68 Ga0068867_100027303 3300005459 Bacteria 4101
69 Ga0068867_100209645 3300005459 Bacteria 1564
70 Ga0070685_10005273 3300005466 Bacteria 6550
71 Ga0070685_10077386 3300005466 Bacteria 1986
72 Ga0070706_100001300 3300005467 Bacteria 26618
73 Ga0070706_100018986 3300005467 Bacteria 6341
74 Ga0070706_100035868 3300005467 Bacteria 4579
75 Ga0070706_100037438 3300005467 Bacteria 4480
76 Ga0070706_100290309 3300005467 Unclassified 1526
77 Ga0070706_100405242 3300005467 Unclassified 1270
78 Ga0070707_100001905 3300005468 Bacteria 20003
79 Ga0070707_100049908 3300005468 Bacteria 4011
80 Ga0070707_100102962 3300005468 Bacteria 2766
81 Ga0070707_100103187 3300005468 Unclassified 2763
82 Ga0070707_100199441 3300005468 Bacteria 1950
83 Ga0070707_100215601 3300005468 Bacteria 1870
84 Ga0070707_100301065 3300005468 Unclassified 1558
85 Ga0070698_100000239 3300005471 Bacteria 54625
86 Ga0070698_100012083 3300005471 Bacteria 9155
87 Ga0070698_100028065 3300005471 Bacteria 5849
88 Ga0070698_100070935 3300005471 Bacteria 3495
89 Ga0070698_100146069 3300005471 Bacteria 2314
90 Ga0070698_100160322 3300005471 Bacteria 2193
91 Ga0070699_100004008 3300005518 Bacteria 13014
92 Ga0070699_100046177 3300005518 Bacteria 3769
93 Ga0070697_100019426 3300005536 Bacteria 5368
94 Ga0070697_100086638 3300005536 Bacteria 2585
95 Ga0068853_100017285 3300005539 Bacteria 5954
96 Ga0068853_100063711 3300005539 Bacteria 3193
97 Ga0070672_100023990 3300005543 Unclassified 4499
98 Ga0070672_100161684 3300005543 Bacteria 1858
99 Ga0070672_100238847 3300005543 Unclassified 1528
100 Ga0070686_100002779 3300005544 Bacteria 9638
101 Ga0070695_100031236 3300005545 Unclassified 3320
102 Ga0070695_100084216 3300005545 Bacteria 2109
103 Ga0070696_100033244 3300005546 Unclassified 3542
104 Ga0070696_100037763 3300005546 Unclassified 3332
105 Ga0070696_100054462 3300005546 Bacteria 2787
106 Ga0070693_100002060 3300005547 Bacteria 9211
107 Ga0070665_100002304 3300005548 Bacteria 21181
108 Ga0070665_100040766 3300005548 Bacteria 4666
109 Ga0070665_100096549 3300005548 Unclassified 2960
110 Ga0070704_100014677 3300005549 Bacteria 4898
111 Ga0070704_100016787 3300005549 Bacteria 4636
112 Ga0070704_100085923 3300005549 Bacteria 2330
113 Ga0068855_100030046 3300005563 Bacteria 6500
114 Ga0068855_100053954 3300005563 Bacteria 4728
115 Ga0068855_100091246 3300005563 Bacteria 3514
116 Ga0068855_100110545 3300005563 Bacteria 3155
117 Ga0070664_100001803 3300005564 Bacteria 17165
118 Ga0068857_100000041 3300005577 Bacteria 70173
119 Ga0068854_100006073 3300005578 Bacteria 7661
120 Ga0068854_100017947 3300005578 Bacteria 4742
121 Ga0068854_100163587 3300005578 Bacteria 1726
122 Ga0068856_100011760 3300005614 Bacteria 8486
123 Ga0068856_100012252 3300005614 Bacteria 8304
124 Ga0068856_100039974 3300005614 Unclassified 4606
125 Ga0068856_100246609 3300005614 Bacteria 1801
126 Ga0070702_100009333 3300005615 Unclassified 4798
127 Ga0070702_100010000 3300005615 Bacteria 4657
128 Ga0068852_100028014 3300005616 Bacteria 4603
129 Ga0068852_100091590 3300005616 Bacteria 2721
130 Ga0068859_100000959 3300005617 Bacteria 29530
131 Ga0068859_100137744 3300005617 Bacteria 2515
132 Ga0068864_100025719 3300005618 Bacteria 4960
133 Ga0068864_100068953 3300005618 Bacteria 3074
134 Ga0068866_10003504 3300005718 Bacteria 6432
135 Ga0068861_100030937 3300005719 Unclassified 3927
136 Ga0068861_100034357 3300005719 Unclassified 3749
137 Ga0068861_100048522 3300005719 Bacteria 3210
138 Ga0068863_100021599 3300005841 Bacteria 6139
139 Ga0068863_100043414 3300005841 Bacteria 4268
140 Ga0068863_100091614 3300005841 Bacteria 2883
141 Ga0068863_100126933 3300005841 Bacteria 2434
142 Ga0068863_100135457 3300005841 Unclassified 2353
143 Ga0068858_100017037 3300005842 Bacteria 6820
144 Ga0068858_100137378 3300005842 Bacteria 2294
145 Ga0068860_100057361 3300005843 Unclassified 3702
146 Ga0068860_100090520 3300005843 Bacteria 2914
147 Ga0081455_10004747 3300005937 Bacteria 15105
148 Ga0081455_10010527 3300005937 Bacteria 9374
149 Ga0081540_1000896 3300005983 Bacteria 26920
150 Ga0081540_1027811 3300005983 Bacteria 3193
151 Ga0070717_10003258 3300006028 Bacteria 11608
152 Ga0070717_10008288 3300006028 Bacteria 7758
153 Ga0070717_10062486 3300006028 Bacteria 3088
154 Ga0070717_10184565 3300006028 Bacteria 1820
155 Ga0070716_100011996 3300006173 Bacteria 4379
156 Ga0070712_100011650 3300006175 Bacteria 5584
157 Ga0070712_100033746 3300006175 Unclassified 3464
158 Ga0070712_100041058 3300006175 Unclassified 3174
159 Ga0070712_100079239 3300006175 Unclassified 2373
160 Ga0070712_100171018 3300006175 Bacteria 1686
161 Ga0097621_100009809 3300006237 Bacteria 6970
162 Ga0097621_100082066 3300006237 Unclassified 2684
163 Ga0068871_100007730 3300006358 Bacteria 7695
164 Ga0075428_100055081 3300006844 Bacteria 4358
165 Ga0075428_100101189 3300006844 Unclassified 3142
166 Ga0075434_100006165 3300006871 Bacteria 10981
167 Ga0075434_100105600 3300006871 Bacteria 2826
168 Ga0075434_100469192 3300006871 Unclassified 1280
169 Ga0075429_100263762 3300006880 Bacteria 1508
170 Ga0068865_100008136 3300006881 Bacteria 6471
171 Ga0097620_100000959 3300006931 Bacteria 29530
172 Ga0097620_100137743 3300006931 Bacteria 2515
173 Ga0075435_100006327 3300007076 Bacteria 8362
174 Ga0099795_10001811 3300007788 Bacteria 4810
175 Ga0105240_10112414 3300009093 Bacteria 3292
176 Ga0105240_10252614 3300009093 Bacteria 2038
177 Ga0105245_10004444 3300009098 Bacteria 12399
178 Ga0105245_10020779 3300009098 Bacteria 5755
179 Ga0105245_10279761 3300009098 Bacteria 1630
180 Ga0105247_10006588 3300009101 Bacteria 7176
181 Ga0105247_10009294 3300009101 Bacteria 5971
182 Ga0114129_10552153 3300009147 Unclassified 1498
183 Ga0105243_10046288 3300009148 Unclassified 3422
184 Ga0105241_10021311 3300009174 Bacteria 4790
185 Ga0105241_10038045 3300009174 Bacteria 3628
186 Ga0105241_10063226 3300009174 Bacteria 2855
187 Ga0105241_10164039 3300009174 Bacteria 1829
188 Ga0105242_10043342 3300009176 Unclassified 3639
189 Ga0105242_10065392 3300009176 Bacteria 3000
190 Ga0105242_10151999 3300009176 Unclassified 2019
191 Ga0105248_10008537 3300009177 Bacteria 11246
192 Ga0105248_10243549 3300009177 Unclassified 2024
193 Ga0105237_10137986 3300009545 Bacteria 2433
194 Ga0105238_10133575 3300009551 Unclassified 2460
195 Ga0105249_10003016 3300009553 Bacteria 14524
196 Ga0105249_10038843 3300009553 Unclassified 4320
197 Ga0105239_10090309 3300010375 Unclassified 3380
198 Ga0105239_10129770 3300010375 Bacteria 2803
199 Ga0105239_10223855 3300010375 Bacteria 2110
200 Ga0105246_10014160 3300011119 Bacteria 5012
201 Ga0105246_10110399 3300011119 Unclassified 2019
202 Ga0105246_10254756 3300011119 Bacteria 1395
203 Ga0157373_10059122 3300013100 Bacteria 2716
204 Ga0157371_10059027 3300013102 Unclassified 2721
205 Ga0157370_10071401 3300013104 Bacteria 3275
206 Ga0157369_10009253 3300013105 Bacteria 11271
207 Ga0157369_10057978 3300013105 Bacteria 4177
208 Ga0157369_10194887 3300013105 Bacteria 2128
209 Ga0157369_10429169 3300013105 Unclassified 1370
210 Ga0157369_10432423 3300013105 Unclassified 1364
211 Ga0157374_10000533 3300013296 Bacteria 34093
212 Ga0157378_10000182 3300013297 Bacteria 60024
213 Ga0157378_10065104 3300013297 Unclassified 3262
214 Ga0157378_10104223 3300013297 Bacteria 2593
215 Ga0157378_10106269 3300013297 Bacteria 2567
216 Ga0163162_10007309 3300013306 Bacteria 10734
217 Ga0163162_10214102 3300013306 Bacteria 2057
218 Ga0157372_10000620 3300013307 Bacteria 38778
219 Ga0157372_10039831 3300013307 Bacteria 5188
220 Ga0157375_10009205 3300013308 Bacteria 8660
221 Ga0163163_10149630 3300014325 Unclassified 2379
222 Ga0157380_10005955 3300014326 Bacteria 8532
223 Ga0157377_10004639 3300014745 Bacteria 6356
224 Ga0157379_10052681 3300014968 Bacteria 3635
225 Ga0157376_10016784 3300014969 Bacteria 5569
226 Ga0197907_10868466 3300020069 Unclassified 1335
227 Ga0206356_10288849 3300020070 Bacteria 1867
228 Ga0206356_10497075 3300020070 Bacteria 2357
229 Ga0206356_10824424 3300020070 Bacteria 1270
230 Ga0206350_10509265 3300020080 Bacteria 1198
231 Ga0206354_10528051 3300020081 Unclassified 1522
232 Ga0224712_10062223 3300022467 Bacteria 1490
233 Ga0224712_10104752 3300022467 Unclassified 1205
234 Ga0207692_10023378 3300025898 Unclassified 2857
235 Ga0207692_10032500 3300025898 Bacteria 2508
236 Ga0207692_10101920 3300025898 Unclassified 1577
237 Ga0207680_10052952 3300025903 Bacteria 2434
238 Ga0207647_10014894 3300025904 Bacteria 5345
239 Ga0207647_10028516 3300025904 Bacteria 3623
240 Ga0207647_10069922 3300025904 Bacteria 2121
241 Ga0207699_10012254 3300025906 Bacteria 4358
242 Ga0207699_10013419 3300025906 Unclassified 4193
243 Ga0207699_10016211 3300025906 Unclassified 3891
244 Ga0207699_10055641 3300025906 Unclassified 2355
245 Ga0207684_10000756 3300025910 Bacteria 37726
246 Ga0207684_10046996 3300025910 Bacteria 3662
247 Ga0207684_10120981 3300025910 Bacteria 2245
248 Ga0207684_10163999 3300025910 Bacteria 1914
249 Ga0207684_10241123 3300025910 Unclassified 1560
250 Ga0207695_10089127 3300025913 Unclassified 3103
251 Ga0207671_10045812 3300025914 Bacteria 3235
252 Ga0207671_10113866 3300025914 Bacteria 2061
253 Ga0207693_10000912 3300025915 Bacteria 26521
254 Ga0207693_10007497 3300025915 Bacteria 8965
255 Ga0207693_10012946 3300025915 Bacteria 6731
256 Ga0207693_10170943 3300025915 Bacteria 1711
257 Ga0207663_10003101 3300025916 Bacteria 8064
258 Ga0207663_10026787 3300025916 Unclassified 3350
259 Ga0207663_10100982 3300025916 Bacteria 1937
260 Ga0207663_10169660 3300025916 Bacteria 1549
261 Ga0207663_10173609 3300025916 Bacteria 1533
262 Ga0207660_10063396 3300025917 Unclassified 2665
263 Ga0207662_10045304 3300025918 Bacteria 2600
264 Ga0207657_10002613 3300025919 Bacteria 19463
265 Ga0207646_10001898 3300025922 Bacteria 25163
266 Ga0207646_10048310 3300025922 Bacteria 3815
267 Ga0207646_10073181 3300025922 Bacteria 3061
268 Ga0207681_10028281 3300025923 Bacteria 3631
269 Ga0207694_10020149 3300025924 Bacteria 5044
270 Ga0207694_10069921 3300025924 Unclassified 2743
271 Ga0207650_10004491 3300025925 Bacteria 9539
272 Ga0207687_10005325 3300025927 Bacteria 8521
273 Ga0207687_10083567 3300025927 Bacteria 2312
274 Ga0207700_10002481 3300025928 Bacteria 10584
275 Ga0207664_10062444 3300025929 Bacteria 2975
276 Ga0207664_10180639 3300025929 Bacteria 1811
277 Ga0207644_10026066 3300025931 Unclassified 4025
278 Ga0207690_10114074 3300025932 Unclassified 1951
279 Ga0207706_10220100 3300025933 Bacteria 1662
280 Ga0207686_10010344 3300025934 Bacteria 5078
281 Ga0207686_10207834 3300025934 Unclassified 1406
282 Ga0207709_10005164 3300025935 Bacteria 7444
283 Ga0207670_10028553 3300025936 Unclassified 3543
284 Ga0207704_10006296 3300025938 Bacteria 5523
285 Ga0207704_10095416 3300025938 Unclassified 1966
286 Ga0207665_10001731 3300025939 Bacteria 14671
287 Ga0207665_10012122 3300025939 Bacteria 5658
288 Ga0207665_10107554 3300025939 Bacteria 1956
289 Ga0207665_10159576 3300025939 Bacteria 1621
290 Ga0207691_10145191 3300025940 Bacteria 2089
291 Ga0207711_10034543 3300025941 Unclassified 4282
292 Ga0207711_10119282 3300025941 Bacteria 2354
293 Ga0207689_10006686 3300025942 Bacteria 10172
294 Ga0207689_10025032 3300025942 Bacteria 5003
295 Ga0207667_10005364 3300025949 Bacteria 15629
296 Ga0207667_10009962 3300025949 Bacteria 11148
297 Ga0207667_10071850 3300025949 Bacteria 3597
298 Ga0207667_10098770 3300025949 Unclassified 3012
299 Ga0207667_10170689 3300025949 Bacteria 2235
300 Ga0207651_10125199 3300025960 Bacteria 1957
301 Ga0207651_10340110 3300025960 Bacteria 1260
302 Ga0207712_10042717 3300025961 Unclassified 3124
303 Ga0207712_10043642 3300025961 Unclassified 3094
304 Ga0207668_10012924 3300025972 Bacteria 5127
305 Ga0207640_10273018 3300025981 Bacteria 1324
306 Ga0207677_10080626 3300026023 Unclassified 2332
307 Ga0207677_10285854 3300026023 Unclassified 1356
308 Ga0207703_10011953 3300026035 Bacteria 6763
309 Ga0207639_10078675 3300026041 Unclassified 2603
310 Ga0207708_10000064 3300026075 Bacteria 85366
311 Ga0207708_10129953 3300026075 Bacteria 1969
312 Ga0207702_10010816 3300026078 Bacteria 7612
313 Ga0207702_10028118 3300026078 Bacteria 4672
314 Ga0207702_10234798 3300026078 Bacteria 1715
315 Ga0207641_10038077 3300026088 Bacteria 4020
316 Ga0207641_10167688 3300026088 Unclassified 2001
317 Ga0207648_10004903 3300026089 Bacteria 13627
318 Ga0207676_10137801 3300026095 Bacteria 2085
319 Ga0207676_10153924 3300026095 Unclassified 1983
320 Ga0207674_10000309 3300026116 Bacteria 62067
321 Ga0207675_100001857 3300026118 Bacteria 21157
322 Ga0207683_10003207 3300026121 Bacteria 14274
323 Ga0207683_10006985 3300026121 Bacteria 9679
324 Ga0207698_10024254 3300026142 Bacteria 4254
325 Ga0268266_10081559 3300028379 Unclassified 2821
326 Ga0268264_10030035 3300028381 Unclassified 4456
327 Ga0268264_10055627 3300028381 Unclassified 3307
328 Ga0373932_0014920 3300035112 Unclassified 1962
329 Ga0373960_0009472 3300035121 Unclassified 2360
330 Ga0373962_0008743 3300035242 Bacteria 2499
331 Ga0373931_0038366 3300035691 Unclassified 2505
332 Ga0373935_0140478 3300035692 Bacteria 1631
333 Ga0373947_0077345 3300035725 Bacteria 2052
334 Ga0373947_0129973 3300035725 Unclassified 1607
335 Ga0373925_0026512 3300037068 Bacteria 4241
336 Ga0373925_0084138 3300037068 Unclassified 2424
337 Ga0395899_0167877 3300037312 Bacteria 1547
338 Ga0395900_0009967 3300037418 Bacteria 9726
339 Ga0395900_0033562 3300037418 Bacteria 5281
340 Ga0395900_0034743 3300037418 Bacteria 5193
341 Ga0395900_0073732 3300037418 Unclassified 3510
342 Ga0395898_0004053 3300037466 Bacteria 16091
343 Ga0395898_0040803 3300037466 Bacteria 4587
344 Ga0395898_0070162 3300037466 Bacteria 3388
345 Ga0395905_0010383 3300037471 Bacteria 9064
346 Ga0395905_0017133 3300037471 Bacteria 6881
347 Ga0395905_0032374 3300037471 Bacteria 4917
348 Ga0395905_0108010 3300037471 Bacteria 2612
349 Ga0395901_0002362 3300038443 Bacteria 19195
350 Ga0395901_0015503 3300038443 Bacteria 7760
351 Ga0395901_0092564 3300038443 Bacteria 3165
352 Ga0395901_0219588 3300038443 Bacteria 1987
353 Ga0395901_0291520 3300038443 Unclassified 1693
354 Ga0395901_0672811 3300038443 Unclassified 1036
355 Ga0436360_0652752 3300039438 Bacteria 3280
356 Ga0451789_0599083 3300041443 Bacteria 1896
357 Ga0451793_1370971 3300041452 Bacteria 1620
358 Ga0451795_1087450 3300041456 Unclassified 1316
359 Ga0451800_0717957 3300041459 Unclassified 1236
360 Ga0451807_0904316 3300041486 Bacteria 1493
361 Ga0451849_1382262 3300041505 Bacteria 1136
362 Ga0451851_0967257 3300041507 Bacteria 2121
363 Ga0451855_0653716 3300041511 Bacteria 3036
364 Ga0451853_0249444 3300041512 Bacteria 1575
365 Ga0451577_0084526 3300042876 Bacteria 2832
366 Ga0466968_0092192 3300044735 Bacteria 1344
367 Ga0466970_0013227 3300044765 Bacteria 4230
368 Ga0451576_0030377 3300045051 Bacteria 5775
369 Ga0495629_0133357 3300046459 Bacteria 1730
370 Ga0495641_0057247 3300046461 Bacteria 1766
371 Ga0495580_0005631 3300046472 Bacteria 10309
372 Ga0495582_0010345 3300046473 Bacteria 5133
373 Ga0495582_0045315 3300046473 Bacteria 2422
374 Ga0495662_0040551 3300046476 Bacteria 2248
375 Ga0495664_0087003 3300046477 Bacteria 1877
376 Ga0495594_0035928 3300046499 Unclassified 2701
377 Ga0495618_0069862 3300046514 Bacteria 2233
378 Ga0495652_0163677 3300046529 Bacteria 1724
379 Ga0495652_0264834 3300046529 Unclassified 1267
380 Ga0495665_0044127 3300046531 Bacteria 2370
381 Ga0495656_0022321 3300046615 Bacteria 2477
382 Ga0495647_0008122 3300046681 Bacteria 3527
383 Ga0495647_0015178 3300046681 Unclassified 2695
384 Ga0495613_0233446 3300046689 Bacteria 1288
385 Ga0495624_0026460 3300046690 Bacteria 3802
386 Ga0495624_0055141 3300046690 Bacteria 2505
387 Ga0495581_0052759 3300047315 Unclassified 2349
388 Ga0495674_0010040 3300047319 Bacteria 8973
389 Ga0495674_0122986 3300047319 Bacteria 2191
390 Ga0495674_0340880 3300047319 Unclassified 1218
391 Ga0495676_0038665 3300047321 Unclassified 3961
392 Ga0495683_0162710 3300047323 Bacteria 1031
393 Ga0495593_0152392 3300047673 Bacteria 1169
394 Ga0496100_0015614 3300048903 Unclassified 4436
395 Ga0496102_0067480 3300048905 Bacteria 3281
396 Ga0496102_0201813 3300048905 Bacteria 1874
397 Ga0496102_0474270 3300048905 Bacteria 1172
398 Ga0496103_0010117 3300048906 Bacteria 5576
399 Ga0496103_0092817 3300048906 Bacteria 1906
400 Ga0496104_0001810 3300048907 Bacteria 18535
401 Ga0496104_0003607 3300048907 Bacteria 13368
402 Ga0496104_0043926 3300048907 Unclassified 4198
403 Ga0496104_0067418 3300048907 Unclassified 3400
404 Ga0496105_0011910 3300048908 Bacteria 6886
405 Ga0496105_0014199 3300048908 Bacteria 6338
406 Ga0496105_0056564 3300048908 Bacteria 3238
407 Ga0496106_0015910 3300048909 Bacteria 5564
408 Ga0496106_0052562 3300048909 Unclassified 3074
409 Ga0496107_0021452 3300048910 Unclassified 4565
410 Ga0496107_0046803 3300048910 Unclassified 3113
411 Ga0496107_0211836 3300048910 Unclassified 1441
412 Ga0496108_0019466 3300048911 Bacteria 5575
413 Ga0496108_0040316 3300048911 Bacteria 3892
414 Ga0496108_0043623 3300048911 Bacteria 3745
415 Ga0496109_0001215 3300048912 Bacteria 21398
416 Ga0496109_0033740 3300048912 Unclassified 4606
417 Ga0496109_0085849 3300048912 Bacteria 2906
418 Ga0496109_0444382 3300048912 Bacteria 1225
419 Ga0496110_0104599 3300048913 Bacteria 2540
420 Ga0496110_0470657 3300048913 Unclassified 1145
421 Ga0496111_0026122 3300048914 Bacteria 4122
422 Ga0496112_0007752 3300048915 Bacteria 9554
423 Ga0496112_0009556 3300048915 Bacteria 8746
424 Ga0496112_0024220 3300048915 Bacteria 5809
425 Ga0496112_0090281 3300048915 Unclassified 3033
426 Ga0496113_0118510 3300048916 Bacteria 2067
427 Ga0496113_0142594 3300048916 Bacteria 1886
428 Ga0496114_0005388 3300048917 Bacteria 10004
429 Ga0496114_0009634 3300048917 Bacteria 7671
430 Ga0496114_0010820 3300048917 Bacteria 7263
431 Ga0496114_0026942 3300048917 Bacteria 4708
432 Ga0496114_0032879 3300048917 Unclassified 4271
433 Ga0496114_0390826 3300048917 Bacteria 1232
434 Ga0496115_0015820 3300048918 Bacteria 5729
435 Ga0496115_0023007 3300048918 Bacteria 4833
436 Ga0496115_0040648 3300048918 Unclassified 3698
437 Ga0496115_0071528 3300048918 Bacteria 2813
438 Ga0496115_0109096 3300048918 Bacteria 2272
439 Ga0496115_0145174 3300048918 Unclassified 1958
440 Ga0496115_0254104 3300048918 Unclassified 1446
441 Ga0496126_0040336 3300048929 Bacteria 4328
442 nmdc:mga05p37_52522_c1 3300050507 Bacteria 5012
443 nmdc:mga09592_240372_c1 3300050508 Bacteria 1569
444 nmdc:mga08y16_264113_c1 3300050511 Unclassified 1777
445 nmdc:mga0n895_575048_c1 3300050512 Unclassified 1131
446 nmdc:mga0n895_5820_c1 3300050512 Bacteria 10358
447 nmdc:mga0rr50_47547_c1 3300050513 Bacteria 3166
448 nmdc:mga0a205_163087_c1 3300050515 Bacteria 2125
449 nmdc:mga0a205_433500_c1 3300050515 Bacteria 1176
450 Ga0070714_100144895
451 JGI24744J21845_10001678
452 JGI24742J22300_10008155
453 rootH1_10230569
454 Ga0058863_11867850
455 Ga0058860_11994708
456 Ga0058862_12661883
457 Ga0070690_100017768
458 Ga0070670_100000828
459 Ga0068869_100024854
460 Ga0070666_10042174
461 Ga0070666_10186193
462 Ga0070682_100005060
463 Ga0070682_100146171
464 Ga0068868_100003764
465 Ga0068868_100017699
466 Ga0068868_100025045
467 Ga0068868_100076861
468 Ga0068868_100101631
469 Ga0070660_100014259
470 Ga0070660_100211590
471 Ga0070689_100005116
472 Ga0070691_10030889
473 Ga0070687_100036763
474 Ga0070687_100040177
475 Ga0070692_10049858
476 Ga0070668_100005856
477 Ga0070669_100086749
478 Ga0070675_100183023
479 Ga0070671_100037578
480 Ga0070674_100009668
481 Ga0070673_100174378
482 Ga0070673_100213501
483 Ga0070688_100156708
484 Ga0070659_100056451
485 Ga0070659_100060112
486 Ga0070667_100092382
487 Ga0070709_10005752
488 Ga0070709_10029069
489 Ga0070714_100041992
490 Ga0070714_100043577
491 Ga0070714_100358637
492 Ga0070713_100015141
493 Ga0070713_100026404
494 Ga0070713_100082863
495 Ga0070713_100142844
496 Ga0070710_10009150
497 Ga0070710_10033703
498 Ga0070710_10105259
499 Ga0070701_10115590
500 Ga0070711_100002059
501 Ga0070711_100005131
502 Ga0070711_100130716
503 Ga0070711_100227869
504 Ga0070705_100022466
505 Ga0070705_100073448
506 Ga0070700_100005089
507 Ga0070700_100126096
508 Ga0070694_100004977
509 Ga0070694_100222047
510 Ga0070708_100019742
511 Ga0070708_100034712
512 Ga0070708_100143369
513 Ga0070708_100205932
514 Ga0070678_100013728
515 Ga0070662_100190875
516 Ga0068867_100009768
517 Ga0068867_100027303
518 Ga0068867_100209645
519 Ga0070685_10005273
520 Ga0070685_10077386
521 Ga0070706_100001300
522 Ga0070706_100018986
523 Ga0070706_100035868
524 Ga0070706_100037438
525 Ga0070706_100290309
526 Ga0070706_100405242
527 Ga0070707_100001905
528 Ga0070707_100049908
529 Ga0070707_100102962
530 Ga0070707_100103187
531 Ga0070707_100199441
532 Ga0070707_100215601
533 Ga0070707_100301065
534 Ga0070698_100000239
535 Ga0070698_100012083
536 Ga0070698_100028065
537 Ga0070698_100070935
538 Ga0070698_100146069
539 Ga0070698_100160322
540 Ga0070699_100004008
541 Ga0070699_100046177
542 Ga0070697_100019426
543 Ga0070697_100086638
544 Ga0068853_100017285
545 Ga0068853_100063711
546 Ga0070672_100023990
547 Ga0070672_100161684
548 Ga0070672_100238847
549 Ga0070686_100002779
550 Ga0070695_100031236
551 Ga0070695_100084216
552 Ga0070696_100033244
553 Ga0070696_100037763
554 Ga0070696_100054462
555 Ga0070693_100002060
556 Ga0070665_100002304
557 Ga0070665_100040766
558 Ga0070665_100096549
559 Ga0070704_100014677
560 Ga0070704_100016787
561 Ga0070704_100085923
562 Ga0068855_100030046
563 Ga0068855_100053954
564 Ga0068855_100091246
565 Ga0068855_100110545
566 Ga0070664_100001803
567 Ga0068857_100000041
568 Ga0068854_100006073
569 Ga0068854_100017947
570 Ga0068854_100163587
571 Ga0068856_100011760
572 Ga0068856_100012252
573 Ga0068856_100039974
574 Ga0068856_100246609
575 Ga0070702_100009333
576 Ga0070702_100010000
577 Ga0068852_100028014
578 Ga0068852_100091590
579 Ga0068859_100000959
580 Ga0068859_100137744
581 Ga0068864_100025719
582 Ga0068864_100068953
583 Ga0068866_10003504
584 Ga0068861_100030937
585 Ga0068861_100034357
586 Ga0068861_100048522
587 Ga0068863_100021599
588 Ga0068863_100043414
589 Ga0068863_100091614
590 Ga0068863_100126933
591 Ga0068863_100135457
592 Ga0068858_100017037
593 Ga0068858_100137378
594 Ga0068860_100057361
595 Ga0068860_100090520
596 Ga0081455_10004747
597 Ga0081455_10010527
598 Ga0081540_1000896
599 Ga0081540_1027811
600 Ga0070717_10003258
601 Ga0070717_10008288
602 Ga0070717_10062486
603 Ga0070717_10184565
604 Ga0070716_100011996
605 Ga0070712_100011650
606 Ga0070712_100033746
607 Ga0070712_100041058
608 Ga0070712_100079239
609 Ga0070712_100171018
610 Ga0097621_100009809
611 Ga0097621_100082066
612 Ga0068871_100007730
613 Ga0075428_100055081
614 Ga0075428_100101189
615 Ga0075434_100006165
616 Ga0075434_100105600
617 Ga0075434_100469192
618 Ga0075429_100263762
619 Ga0068865_100008136
620 Ga0097620_100000959
621 Ga0097620_100137743
622 Ga0075435_100006327
623 Ga0099795_10001811
624 Ga0105240_10112414
625 Ga0105240_10252614
626 Ga0105245_10004444
627 Ga0105245_10020779
628 Ga0105245_10279761
629 Ga0105247_10006588
630 Ga0105247_10009294
631 Ga0114129_10552153
632 Ga0105243_10046288
633 Ga0105241_10021311
634 Ga0105241_10038045
635 Ga0105241_10063226
636 Ga0105241_10164039
637 Ga0105242_10043342
638 Ga0105242_10065392
639 Ga0105242_10151999
640 Ga0105248_10008537
641 Ga0105248_10243549
642 Ga0105237_10137986
643 Ga0105238_10133575
644 Ga0105249_10003016
645 Ga0105249_10038843
646 Ga0105239_10090309
647 Ga0105239_10129770
648 Ga0105239_10223855
649 Ga0105246_10014160
650 Ga0105246_10110399
651 Ga0105246_10254756
652 Ga0157373_10059122
653 Ga0157371_10059027
654 Ga0157370_10071401
655 Ga0157369_10009253
656 Ga0157369_10057978
657 Ga0157369_10194887
658 Ga0157369_10429169
659 Ga0157369_10432423
660 Ga0157374_10000533
661 Ga0157378_10000182
662 Ga0157378_10065104
663 Ga0157378_10104223
664 Ga0157378_10106269
665 Ga0163162_10007309
666 Ga0163162_10214102
667 Ga0157372_10000620
668 Ga0157372_10039831
669 Ga0157375_10009205
670 Ga0163163_10149630
671 Ga0157380_10005955
672 Ga0157377_10004639
673 Ga0157379_10052681
674 Ga0157376_10016784
675 Ga0197907_10868466
676 Ga0206356_10288849
677 Ga0206356_10497075
678 Ga0206356_10824424
679 Ga0206350_10509265
680 Ga0206354_10528051
681 Ga0224712_10062223
682 Ga0224712_10104752
683 Ga0207692_10023378
684 Ga0207692_10032500
685 Ga0207692_10101920
686 Ga0207680_10052952
687 Ga0207647_10014894
688 Ga0207647_10028516
689 Ga0207647_10069922
690 Ga0207699_10012254
691 Ga0207699_10013419
692 Ga0207699_10016211
693 Ga0207699_10055641
694 Ga0207684_10000756
695 Ga0207684_10046996
696 Ga0207684_10120981
697 Ga0207684_10163999
698 Ga0207684_10241123
699 Ga0207695_10089127
700 Ga0207671_10045812
701 Ga0207671_10113866
702 Ga0207693_10000912
703 Ga0207693_10007497
704 Ga0207693_10012946
705 Ga0207693_10170943
706 Ga0207663_10003101
707 Ga0207663_10026787
708 Ga0207663_10100982
709 Ga0207663_10169660
710 Ga0207663_10173609
711 Ga0207660_10063396
712 Ga0207662_10045304
713 Ga0207657_10002613
714 Ga0207646_10001898
715 Ga0207646_10048310
716 Ga0207646_10073181
717 Ga0207681_10028281
718 Ga0207694_10020149
719 Ga0207694_10069921
720 Ga0207650_10004491
721 Ga0207687_10005325
722 Ga0207687_10083567
723 Ga0207700_10002481
724 Ga0207664_10062444
725 Ga0207664_10180639
726 Ga0207644_10026066
727 Ga0207690_10114074
728 Ga0207706_10220100
729 Ga0207686_10010344
730 Ga0207686_10207834
731 Ga0207709_10005164
732 Ga0207670_10028553
733 Ga0207704_10006296
734 Ga0207704_10095416
735 Ga0207665_10001731
736 Ga0207665_10012122
737 Ga0207665_10107554
738 Ga0207665_10159576
739 Ga0207691_10145191
740 Ga0207711_10034543
741 Ga0207711_10119282
742 Ga0207689_10006686
743 Ga0207689_10025032
744 Ga0207667_10005364
745 Ga0207667_10009962
746 Ga0207667_10071850
747 Ga0207667_10098770
748 Ga0207667_10170689
749 Ga0207651_10125199
750 Ga0207651_10340110
751 Ga0207712_10042717
752 Ga0207712_10043642
753 Ga0207668_10012924
754 Ga0207640_10273018
755 Ga0207677_10080626
756 Ga0207677_10285854
757 Ga0207703_10011953
758 Ga0207639_10078675
759 Ga0207708_10000064
760 Ga0207708_10129953
761 Ga0207702_10010816
762 Ga0207702_10028118
763 Ga0207702_10234798
764 Ga0207641_10038077
765 Ga0207641_10167688
766 Ga0207648_10004903
767 Ga0207676_10137801
768 Ga0207676_10153924
769 Ga0207674_10000309
770 Ga0207675_100001857
771 Ga0207683_10003207
772 Ga0207683_10006985
773 Ga0207698_10024254
774 Ga0268266_10081559
775 Ga0268264_10030035
776 Ga0268264_10055627
777 Ga0373932_0014920
778 Ga0373960_0009472
779 Ga0373962_0008743
780 Ga0373931_0038366
781 Ga0373935_0140478
782 Ga0373947_0077345
783 Ga0373947_0129973
784 Ga0373925_0026512
785 Ga0373925_0084138
786 Ga0395899_0167877
787 Ga0395900_0009967
788 Ga0395900_0033562
789 Ga0395900_0034743
790 Ga0395900_0073732
791 Ga0395898_0004053
792 Ga0395898_0040803
793 Ga0395898_0070162
794 Ga0395905_0010383
795 Ga0395905_0017133
796 Ga0395905_0032374
797 Ga0395905_0108010
798 Ga0395901_0002362
799 Ga0395901_0015503
800 Ga0395901_0092564
801 Ga0395901_0219588
802 Ga0395901_0291520
803 Ga0395901_0672811
804 Ga0436360_0652752
805 Ga0451789_0599083
806 Ga0451793_1370971
807 Ga0451795_1087450
808 Ga0451800_0717957
809 Ga0451807_0904316
810 Ga0451849_1382262
811 Ga0451851_0967257
812 Ga0451855_0653716
813 Ga0451853_0249444
814 Ga0451577_0084526
815 Ga0466968_0092192
816 Ga0466970_0013227
817 Ga0451576_0030377
818 Ga0495629_0133357
819 Ga0495641_0057247
820 Ga0495580_0005631
821 Ga0495582_0010345
822 Ga0495582_0045315
823 Ga0495662_0040551
824 Ga0495664_0087003
825 Ga0495594_0035928
826 Ga0495618_0069862
827 Ga0495652_0163677
828 Ga0495652_0264834
829 Ga0495665_0044127
830 Ga0495656_0022321
831 Ga0495647_0008122
832 Ga0495647_0015178
833 Ga0495613_0233446
834 Ga0495624_0026460
835 Ga0495624_0055141
836 Ga0495581_0052759
837 Ga0495674_0010040
838 Ga0495674_0122986
839 Ga0495674_0340880
840 Ga0495676_0038665
841 Ga0495683_0162710
842 Ga0495593_0152392
843 Ga0496100_0015614
844 Ga0496102_0067480
845 Ga0496102_0201813
846 Ga0496102_0474270
847 Ga0496103_0010117
848 Ga0496103_0092817
849 Ga0496104_0001810
850 Ga0496104_0003607
851 Ga0496104_0043926
852 Ga0496104_0067418
853 Ga0496105_0011910
854 Ga0496105_0014199
855 Ga0496105_0056564
856 Ga0496106_0015910
857 Ga0496106_0052562
858 Ga0496107_0021452
859 Ga0496107_0046803
860 Ga0496107_0211836
861 Ga0496108_0019466
862 Ga0496108_0040316
863 Ga0496108_0043623
864 Ga0496109_0001215
865 Ga0496109_0033740
866 Ga0496109_0085849
867 Ga0496109_0444382
868 Ga0496110_0104599
869 Ga0496110_0470657
870 Ga0496111_0026122
871 Ga0496112_0007752
872 Ga0496112_0009556
873 Ga0496112_0024220
874 Ga0496112_0090281
875 Ga0496113_0118510
876 Ga0496113_0142594
877 Ga0496114_0005388
878 Ga0496114_0009634
879 Ga0496114_0010820
880 Ga0496114_0026942
881 Ga0496114_0032879
882 Ga0496114_0390826
883 Ga0496115_0015820
884 Ga0496115_0023007
885 Ga0496115_0040648
886 Ga0496115_0071528
887 Ga0496115_0109096
888 Ga0496115_0145174
889 Ga0496115_0254104
890 Ga0496126_0040336
891 nmdc:mga05p37_52522_c1
892 nmdc:mga09592_240372_c1
893 nmdc:mga08y16_264113_c1
894 nmdc:mga0n895_575048_c1
895 nmdc:mga0n895_5820_c1
896 nmdc:mga0rr50_47547_c1
897 nmdc:mga0a205_163087_c1
898 nmdc:mga0a205_433500_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zpw-assembly2.cif.gz_D crystal structure of pizza6-tsk-tsh with silicotungstic acid (sta) polyoxometalate 0.7696 31 354
7zpw-assembly2.cif.gz_D crystal structure of pizza6-tsk-tsh with silicotungstic acid (sta) polyoxometalate 0.7641 31 354
7zq2-assembly1.cif.gz_A crystal structure of pizza6-rsh-tsh with silicotungstic acid (sta) polyoxometalate 0.7639 31 354
6qsd-assembly1.cif.gz_A crystal structure of pizza6s 0.7622 31 352
7zq2-assembly1.cif.gz_A crystal structure of pizza6-rsh-tsh with silicotungstic acid (sta) polyoxometalate 0.7584 31 354
ID Description Score Start End Superfamily
af_K7KIW4_183_318_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.791 58 183 2.40.128.630
af_A0A0P0XWT1_154_468_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7432 52 214 2.130.10.10
af_P98164_709_1014_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7389 89 341 2.120.10.30
af_D3Z7A8_250_401_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.7342 65 194 2.40.128.630
af_F1M443_376_637_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7308 55 324 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A534JXD1-F1-model_v4 TIGR03118 family protein 0.9995 241 356
AF-A0A534KWZ3-F1-model_v4 TIGR03118 family protein 0.9919 212 356
AF-A0A536QXC9-F1-model_v4 TIGR03118 family protein 0.9892 190 356
AF-A0A538D0J0-F1-model_v4 TIGR03118 family protein 0.9856 151 356
AF-A0A538D0J0-F1-model_v4 TIGR03118 family protein 0.9808 151 356

Map