F446308

General Info

Members Datasets Scaffolds Average Seq Length
449 260 898 202

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100193743|Ga0068869_1001937432
Length 205
Sequence MPAILAKKLGMTQRFLEDGRVERVTVLEAGPCPVTAIRSDDADGYTAVQLGFGAVREKALTRPELGHLKKASAPPVRHLVEFRDEAAELVVGDTVTVEAFEVGQTVKVSGTSKGKGFQGTIKRHNFAAGPKSHGSHNVRAPGSVGASATPSRVLPGLKGPGQMGNKRVTQRGLRIVELLPDRNLMLVRGSVPGPKGGTVEVRTDA

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
70 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
135 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
138 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
139 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
151 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
180 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
189 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
200 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
209 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
245 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
255 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
256 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
257 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.11
Metatranscriptomes 0.89
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 16.93
Rhizosphere 81.51
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100193743 3300005334 Bacteria 1599
2 Ga0070683_100004183 3300005329 Bacteria 11830
3 Ga0070683_100084204 3300005329 Bacteria 2979
4 Ga0070683_100274925 3300005329 Bacteria 1602
5 Ga0070683_100363809 3300005329 Bacteria 1378
6 Ga0068869_100080462 3300005334 Bacteria 2430
7 Ga0068869_100120900 3300005334 Bacteria 2003
8 Ga0070682_100021035 3300005337 Bacteria 3845
9 Ga0068868_100016031 3300005338 Bacteria 5557
10 Ga0068868_100189361 3300005338 Bacteria 1710
11 Ga0068868_100286185 3300005338 Bacteria 1396
12 Ga0068868_100399510 3300005338 Bacteria 1186
13 Ga0070660_100003497 3300005339 Bacteria 10822
14 Ga0070660_100140606 3300005339 Bacteria 1936
15 Ga0070660_100241734 3300005339 Bacteria 1471
16 Ga0070689_100109774 3300005340 Bacteria 2193
17 Ga0070661_100219931 3300005344 Bacteria 1456
18 Ga0070692_10066933 3300005345 Bacteria 1905
19 Ga0070692_10425864 3300005345 Bacteria 844
20 Ga0070675_100361124 3300005354 Bacteria 1289
21 Ga0070671_100097360 3300005355 Bacteria 2467
22 Ga0070674_100129035 3300005356 Bacteria 1882
23 Ga0070674_100138367 3300005356 Bacteria 1824
24 Ga0070674_100154150 3300005356 Bacteria 1737
25 Ga0070659_100116328 3300005366 Bacteria 2161
26 Ga0070703_10076194 3300005406 Bacteria 1132
27 Ga0070709_10157118 3300005434 Bacteria 1577
28 Ga0070714_100128633 3300005435 Bacteria 2261
29 Ga0070714_100816543 3300005435 Bacteria 903
30 Ga0070713_100025130 3300005436 Bacteria 4652
31 Ga0070710_10032394 3300005437 Bacteria 2831
32 Ga0070701_10078277 3300005438 Bacteria 1784
33 Ga0070700_100084563 3300005441 Bacteria 2056
34 Ga0070700_100093552 3300005441 Bacteria 1966
35 Ga0070700_100232438 3300005441 Bacteria 1313
36 Ga0070663_100201236 3300005455 Bacteria 1554
37 Ga0070663_100624520 3300005455 Bacteria 908
38 Ga0070678_100689343 3300005456 Bacteria 919
39 Ga0070662_100251961 3300005457 Bacteria 1420
40 Ga0068867_100155496 3300005459 Bacteria 1799
41 Ga0068867_100240284 3300005459 Bacteria 1468
42 Ga0068867_100777440 3300005459 Bacteria 852
43 Ga0070679_100067285 3300005530 Bacteria 3572
44 Ga0070684_100014493 3300005535 Bacteria 6389
45 Ga0070684_100341081 3300005535 Bacteria 1377
46 Ga0070684_100419931 3300005535 Bacteria 1234
47 Ga0070697_100381547 3300005536 Bacteria 1221
48 Ga0070672_100379592 3300005543 Bacteria 1209
49 Ga0070686_100274170 3300005544 Bacteria 1241
50 Ga0070693_100027469 3300005547 Bacteria 3085
51 Ga0070693_100245928 3300005547 Bacteria 1183
52 Ga0070665_100343750 3300005548 Bacteria 1497
53 Ga0070665_100371773 3300005548 Bacteria 1436
54 Ga0070704_100277602 3300005549 Bacteria 1387
55 Ga0068855_100021337 3300005563 Bacteria 7766
56 Ga0070664_100059320 3300005564 Bacteria 3255
57 Ga0070664_100179270 3300005564 Bacteria 1882
58 Ga0070664_100349987 3300005564 Bacteria 1344
59 Ga0070664_100808288 3300005564 Bacteria 877
60 Ga0068857_100016416 3300005577 Bacteria 6489
61 Ga0068857_100243592 3300005577 Bacteria 1647
62 Ga0068854_100086716 3300005578 Bacteria 2321
63 Ga0068854_100151099 3300005578 Bacteria 1791
64 Ga0068854_100190026 3300005578 Bacteria 1608
65 Ga0068854_100750455 3300005578 Bacteria 847
66 Ga0068856_100090930 3300005614 Bacteria 3037
67 Ga0068856_101002419 3300005614 Bacteria 853
68 Ga0070702_100005631 3300005615 Bacteria 5858
69 Ga0068852_100349914 3300005616 Bacteria 1442
70 Ga0068859_100053777 3300005617 Bacteria 4049
71 Ga0068864_100373041 3300005618 Bacteria 1351
72 Ga0068870_10062303 3300005840 Bacteria 2008
73 Ga0068870_10062874 3300005840 Bacteria 2001
74 Ga0068870_10094077 3300005840 Bacteria 1682
75 Ga0068863_100355149 3300005841 Bacteria 1428
76 Ga0068858_100115450 3300005842 Bacteria 2509
77 Ga0068858_100124218 3300005842 Bacteria 2416
78 Ga0068860_100219544 3300005843 Bacteria 1846
79 Ga0068862_101202114 3300005844 Bacteria 757
80 Ga0081455_10079314 3300005937 Bacteria 2696
81 Ga0081538_10030998 3300005981 Bacteria 3617
82 Ga0081538_10034025 3300005981 Bacteria 3379
83 Ga0081538_10055855 3300005981 Bacteria 2320
84 Ga0081540_1005439 3300005983 Bacteria 9504
85 Ga0081540_1016802 3300005983 Bacteria 4561
86 Ga0081539_10026514 3300005985 Bacteria 3696
87 Ga0081539_10141972 3300005985 Bacteria 1166
88 Ga0070717_10050198 3300006028 Bacteria 3427
89 Ga0097621_100042670 3300006237 Bacteria 3654
90 Ga0075433_10390162 3300006852 Bacteria 1229
91 Ga0075434_100003285 3300006871 Bacteria 14454
92 Ga0068865_100184110 3300006881 Bacteria 1610
93 Ga0068865_100496664 3300006881 Bacteria 1017
94 Ga0097620_100053778 3300006931 Bacteria 4049
95 Ga0075435_100210506 3300007076 Bacteria 1649
96 Ga0111539_11051411 3300009094 Bacteria 946
97 Ga0111539_11511192 3300009094 Bacteria 779
98 Ga0105245_10033445 3300009098 Bacteria 4558
99 Ga0105245_10091016 3300009098 Bacteria 2807
100 Ga0105245_10112902 3300009098 Bacteria 2530
101 Ga0105245_10959792 3300009098 Bacteria 898
102 Ga0105245_11525325 3300009098 Bacteria 719
103 Ga0105247_10050635 3300009101 Bacteria 2556
104 Ga0105243_10054900 3300009148 Bacteria 3164
105 Ga0105243_10085476 3300009148 Bacteria 2586
106 Ga0105243_10348847 3300009148 Bacteria 1358
107 Ga0105241_10953000 3300009174 Bacteria 800
108 Ga0105242_10210934 3300009176 Bacteria 1731
109 Ga0105248_10361030 3300009177 Bacteria 1635
110 Ga0105248_10547028 3300009177 Bacteria 1306
111 Ga0105237_10054556 3300009545 Bacteria 4005
112 Ga0105238_10137715 3300009551 Bacteria 2419
113 Ga0105238_11714928 3300009551 Bacteria 659
114 Ga0105249_10105719 3300009553 Bacteria 2654
115 Ga0105249_10587380 3300009553 Bacteria 1167
116 Ga0105239_10042546 3300010375 Bacteria 4977
117 Ga0105239_10285442 3300010375 Bacteria 1859
118 Ga0105239_11176937 3300010375 Bacteria 883
119 Ga0105246_10017497 3300011119 Bacteria 4556
120 Ga0105246_10070709 3300011119 Bacteria 2455
121 Ga0105246_10085113 3300011119 Bacteria 2263
122 Ga0157343_1003852 3300012488 Bacteria 902
123 Ga0157315_1005545 3300012508 Bacteria 951
124 Ga0157371_10251962 3300013102 Bacteria 1271
125 Ga0157369_10171847 3300013105 Bacteria 2283
126 Ga0157374_10054496 3300013296 Bacteria 3730
127 Ga0157374_10116465 3300013296 Bacteria 2575
128 Ga0157372_10193904 3300013307 Bacteria 2353
129 Ga0157372_10588271 3300013307 Bacteria 1297
130 Ga0157375_10409094 3300013308 Bacteria 1523
131 Ga0157375_10693432 3300013308 Bacteria 1172
132 Ga0157375_11888572 3300013308 Bacteria 709
133 Ga0163163_10278476 3300014325 Bacteria 1724
134 Ga0163163_10581280 3300014325 Bacteria 1183
135 Ga0163163_10810243 3300014325 Bacteria 1000
136 Ga0157380_10885038 3300014326 Bacteria 918
137 Ga0157380_11410881 3300014326 Bacteria 747
138 Ga0157377_10040620 3300014745 Bacteria 2577
139 Ga0157377_10426514 3300014745 Bacteria 910
140 Ga0157379_10115783 3300014968 Bacteria 2410
141 Ga0157379_10144875 3300014968 Bacteria 2142
142 Ga0163161_10963557 3300017792 Bacteria 726
143 Ga0213876_10050742 3300021384 Bacteria 2192
144 Ga0207653_10051127 3300025885 Bacteria 1375
145 Ga0207692_10572413 3300025898 Bacteria 724
146 Ga0207642_10015664 3300025899 Bacteria 2833
147 Ga0207642_10241513 3300025899 Bacteria 1020
148 Ga0207710_10016771 3300025900 Bacteria 3101
149 Ga0207688_10101440 3300025901 Bacteria 1662
150 Ga0207688_10356673 3300025901 Bacteria 902
151 Ga0207688_10511565 3300025901 Bacteria 753
152 Ga0207647_10366532 3300025904 Bacteria 815
153 Ga0207685_10027754 3300025905 Bacteria 1985
154 Ga0207645_10026553 3300025907 Bacteria 3742
155 Ga0207643_10306632 3300025908 Bacteria 989
156 Ga0207705_10348423 3300025909 Bacteria 1141
157 Ga0207695_10135218 3300025913 Bacteria 2419
158 Ga0207671_10045123 3300025914 Bacteria 3259
159 Ga0207693_10100434 3300025915 Bacteria 2268
160 Ga0207657_10001826 3300025919 Bacteria 22969
161 Ga0207657_10194708 3300025919 Bacteria 1633
162 Ga0207652_10064741 3300025921 Bacteria 3164
163 Ga0207694_10197423 3300025924 Bacteria 1636
164 Ga0207659_10264803 3300025926 Bacteria 1400
165 Ga0207687_10000332 3300025927 Bacteria 31692
166 Ga0207687_10030470 3300025927 Bacteria 3638
167 Ga0207687_10561991 3300025927 Bacteria 958
168 Ga0207700_10048985 3300025928 Bacteria 3140
169 Ga0207644_10106681 3300025931 Bacteria 2112
170 Ga0207690_10124078 3300025932 Bacteria 1880
171 Ga0207690_10216793 3300025932 Bacteria 1462
172 Ga0207690_10240364 3300025932 Bacteria 1394
173 Ga0207706_10190608 3300025933 Bacteria 1800
174 Ga0207709_10022767 3300025935 Bacteria 3557
175 Ga0207709_10431915 3300025935 Bacteria 1014
176 Ga0207670_10039010 3300025936 Bacteria 3107
177 Ga0207704_10051212 3300025938 Bacteria 2495
178 Ga0207704_10229992 3300025938 Bacteria 1378
179 Ga0207704_10423836 3300025938 Bacteria 1056
180 Ga0207665_10036183 3300025939 Bacteria 3281
181 Ga0207691_10279154 3300025940 Bacteria 1437
182 Ga0207711_11142872 3300025941 Bacteria 720
183 Ga0207689_10055881 3300025942 Bacteria 3248
184 Ga0207689_10091239 3300025942 Bacteria 2503
185 Ga0207661_10002864 3300025944 Bacteria 11918
186 Ga0207661_10066894 3300025944 Bacteria 2920
187 Ga0207679_10287825 3300025945 Bacteria 1411
188 Ga0207679_10613484 3300025945 Bacteria 981
189 Ga0207667_10032942 3300025949 Bacteria 5577
190 Ga0207651_10433078 3300025960 Bacteria 1125
191 Ga0207712_10881881 3300025961 Bacteria 790
192 Ga0207668_10542381 3300025972 Bacteria 1006
193 Ga0207640_10101129 3300025981 Bacteria 2022
194 Ga0207677_10006957 3300026023 Bacteria 6220
195 Ga0207677_10085311 3300026023 Bacteria 2279
196 Ga0207677_10229486 3300026023 Bacteria 1494
197 Ga0207703_10065761 3300026035 Bacteria 2980
198 Ga0207703_10084750 3300026035 Bacteria 2651
199 Ga0207703_10262778 3300026035 Bacteria 1561
200 Ga0207639_10335734 3300026041 Bacteria 1346
201 Ga0207639_10677388 3300026041 Bacteria 955
202 Ga0207639_10822924 3300026041 Bacteria 866
203 Ga0207678_10069148 3300026067 Bacteria 3028
204 Ga0207678_10100762 3300026067 Bacteria 2467
205 Ga0207678_10547073 3300026067 Bacteria 1012
206 Ga0207708_10048605 3300026075 Bacteria 3229
207 Ga0207708_10087705 3300026075 Bacteria 2396
208 Ga0207702_10028787 3300026078 Bacteria 4620
209 Ga0207702_10893050 3300026078 Bacteria 880
210 Ga0207641_10280559 3300026088 Bacteria 1567
211 Ga0207641_10430768 3300026088 Bacteria 1272
212 Ga0207648_10216546 3300026089 Bacteria 1701
213 Ga0207648_10689379 3300026089 Bacteria 946
214 Ga0207676_10054566 3300026095 Bacteria 3133
215 Ga0207676_10516736 3300026095 Bacteria 1136
216 Ga0207674_10006903 3300026116 Bacteria 13305
217 Ga0207683_10057952 3300026121 Bacteria 3400
218 Ga0207683_10215107 3300026121 Bacteria 1750
219 Ga0207683_10798593 3300026121 Bacteria 876
220 Ga0207698_10373123 3300026142 Bacteria 1355
221 Ga0207698_10485489 3300026142 Bacteria 1199
222 Ga0207428_10500070 3300027907 Bacteria 883
223 Ga0268266_10089913 3300028379 Bacteria 2690
224 Ga0268266_10202451 3300028379 Bacteria 1817
225 Ga0268266_10530074 3300028379 Bacteria 1127
226 Ga0268265_10805956 3300028380 Bacteria 916
227 Ga0268264_10070200 3300028381 Bacteria 2965
228 Ga0265319_1000006 3300028563 Bacteria 228868
229 Ga0265319_1005558 3300028563 Bacteria 6010
230 Ga0265319_1079777 3300028563 Bacteria 1040
231 Ga0265318_10002149 3300028577 Bacteria 10711
232 Ga0265338_10040390 3300028800 Bacteria 4383
233 Ga0265330_10293317 3300031235 Bacteria 685
234 Ga0265320_10012505 3300031240 Bacteria 4935
235 Ga0265331_10144782 3300031250 Bacteria 1080
236 Ga0265316_10029887 3300031344 Bacteria 4474
237 Ga0265314_10021653 3300031711 Bacteria 4937
238 Ga0307405_10096705 3300031731 Bacteria 1970
239 Ga0307405_10402701 3300031731 Bacteria 1072
240 Ga0307405_10688134 3300031731 Bacteria 845
241 Ga0307413_10349902 3300031824 Bacteria 1140
242 Ga0307413_10555439 3300031824 Bacteria 932
243 Ga0307410_10325375 3300031852 Bacteria 1221
244 Ga0307410_10722307 3300031852 Bacteria 841
245 Ga0307406_10090045 3300031901 Bacteria 2063
246 Ga0307409_100110133 3300031995 Bacteria 2307
247 Ga0307409_100427510 3300031995 Bacteria 1272
248 Ga0307416_100600943 3300032002 Bacteria 1180
249 Ga0307411_10693979 3300032005 Bacteria 886
250 Ga0307415_100137774 3300032126 Bacteria 1859
251 Ga0373944_0025103 3300035089 Bacteria 1752
252 Ga0373923_0045036 3300035111 Bacteria 1831
253 Ga0373936_0051014 3300035113 Bacteria 1674
254 Ga0373941_0028645 3300035115 Bacteria 1637
255 Ga0373945_0033527 3300035116 Bacteria 1825
256 Ga0373953_0158896 3300035117 Bacteria 971
257 Ga0373954_0129049 3300035118 Bacteria 1230
258 Ga0373943_0094084 3300035170 Bacteria 1557
259 Ga0373946_0015043 3300035171 Bacteria 2927
260 Ga0373955_0056438 3300035172 Bacteria 2154
261 Ga0373924_0014628 3300035410 Bacteria 2968
262 Ga0373933_0122511 3300035724 Bacteria 1629
263 Ga0373947_0011741 3300035725 Bacteria 5019
264 Ga0373937_0029439 3300036401 Bacteria 4973
265 Ga0373925_0018772 3300037068 Bacteria 5026
266 Ga0395900_0003484 3300037418 Bacteria 16983
267 Ga0395900_0597007 3300037418 Bacteria 1045
268 Ga0395898_0004042 3300037466 Bacteria 16132
269 Ga0395898_0522050 3300037466 Bacteria 1129
270 Ga0395898_0558093 3300037466 Bacteria 1087
271 Ga0395905_0311297 3300037471 Bacteria 1463
272 Ga0436364_0012596 3300037853 Bacteria 3992
273 Ga0436364_0474529 3300037853 Bacteria 2985
274 Ga0395901_0394024 3300038443 Bacteria 1423
275 Ga0395901_0507956 3300038443 Bacteria 1226
276 Ga0436365_1934402 3300039437 Bacteria 2562
277 Ga0451802_0868571 3300041460 Bacteria 1015
278 Ga0451853_0284597 3300041512 Bacteria 657
279 Ga0439460_0124688 3300042461 Bacteria 845
280 Ga0466972_0099543 3300044658 Bacteria 1376
281 Ga0466972_0150477 3300044658 Bacteria 1094
282 Ga0466965_0082890 3300044683 Bacteria 1623
283 Ga0466965_0382911 3300044683 Bacteria 775
284 Ga0466966_0198223 3300044684 Bacteria 1215
285 Ga0466961_0054610 3300044693 Bacteria 2548
286 Ga0466961_0346936 3300044693 Bacteria 904
287 Ga0466963_0252358 3300044694 Bacteria 1238
288 Ga0466963_0287469 3300044694 Bacteria 1156
289 Ga0466964_0707517 3300044706 Bacteria 562
290 Ga0466971_0090009 3300044719 Bacteria 1405
291 Ga0466971_0157452 3300044719 Bacteria 1062
292 Ga0466970_0127816 3300044765 Bacteria 1394
293 Ga0466957_0062514 3300044842 Bacteria 2287
294 Ga0466957_0232740 3300044842 Bacteria 1220
295 Ga0466960_0001761 3300044901 Bacteria 7943
296 Ga0466960_0255659 3300044901 Bacteria 974
297 Ga0466960_0297644 3300044901 Bacteria 908
298 Ga0466959_0302756 3300045049 Bacteria 1094
299 Ga0466958_0210432 3300045836 Bacteria 1239
300 Ga0466967_0083950 3300045976 Bacteria 2881
301 Ga0466967_0137285 3300045976 Bacteria 2274
302 Ga0466967_0173018 3300045976 Bacteria 2033
303 Ga0466967_0222275 3300045976 Bacteria 1795
304 Ga0466967_0251562 3300045976 Bacteria 1688
305 Ga0466967_0569664 3300045976 Bacteria 1116
306 Ga0495603_0036748 3300046455 Bacteria 2940
307 Ga0495590_0154612 3300046457 Bacteria 832
308 Ga0495641_0099917 3300046461 Bacteria 1294
309 Ga0495651_0423876 3300046462 Bacteria 864
310 Ga0495653_0115654 3300046463 Bacteria 1919
311 Ga0495650_0000121 3300046471 Bacteria 183055
312 Ga0495580_0191454 3300046472 Bacteria 1410
313 Ga0495582_0062051 3300046473 Bacteria 2064
314 Ga0495662_0047990 3300046476 Bacteria 2061
315 Ga0495664_0116577 3300046477 Bacteria 1614
316 Ga0495594_0008773 3300046499 Bacteria 5212
317 Ga0495594_0201063 3300046499 Bacteria 1136
318 Ga0495608_0041143 3300046511 Bacteria 3094
319 Ga0495618_0043754 3300046514 Bacteria 2825
320 Ga0495663_0028842 3300046525 Bacteria 1636
321 Ga0495652_0149926 3300046529 Bacteria 1823
322 Ga0495640_0016816 3300046533 Bacteria 5468
323 Ga0495587_0066487 3300046536 Bacteria 2102
324 Ga0495609_0091252 3300046538 Bacteria 1325
325 Ga0495645_0103708 3300046543 Bacteria 2020
326 Ga0495668_0185721 3300046616 Bacteria 1139
327 Ga0495668_0315913 3300046616 Bacteria 857
328 Ga0495635_0009523 3300046663 Bacteria 6791
329 Ga0495588_0032224 3300046674 Bacteria 2640
330 Ga0495647_0020129 3300046681 Bacteria 2393
331 Ga0495658_0001182 3300046683 Bacteria 13746
332 Ga0495581_0005995 3300047315 Bacteria 7042
333 Ga0495581_0066133 3300047315 Bacteria 2090
334 Ga0495676_0028080 3300047321 Bacteria 4814
335 Ga0495680_0021643 3300047322 Bacteria 5378
336 Ga0495602_0078977 3300048088 Bacteria 2777
337 Ga0495614_0058535 3300048089 Bacteria 1654
338 Ga0496100_0027989 3300048903 Bacteria 3472
339 Ga0496100_0037073 3300048903 Bacteria 3079
340 Ga0496100_0111501 3300048903 Bacteria 1901
341 Ga0496100_0209779 3300048903 Bacteria 1424
342 Ga0496100_0327305 3300048903 Bacteria 1152
343 Ga0496101_0013189 3300048904 Bacteria 5532
344 Ga0496101_0128503 3300048904 Bacteria 1922
345 Ga0496101_0279173 3300048904 Bacteria 1305
346 Ga0496101_0528705 3300048904 Bacteria 932
347 Ga0496101_1178773 3300048904 Bacteria 600
348 Ga0496102_0124096 3300048905 Bacteria 2413
349 Ga0496102_0141314 3300048905 Bacteria 2257
350 Ga0496102_0243282 3300048905 Bacteria 1696
351 Ga0496102_0336377 3300048905 Bacteria 1422
352 Ga0496102_0486900 3300048905 Bacteria 1155
353 Ga0496102_0502879 3300048905 Bacteria 1134
354 Ga0496103_0263968 3300048906 Bacteria 1108
355 Ga0496104_0033793 3300048907 Bacteria 4766
356 Ga0496104_0035323 3300048907 Bacteria 4667
357 Ga0496104_0042732 3300048907 Bacteria 4255
358 Ga0496104_0082568 3300048907 Bacteria 3064
359 Ga0496104_0200315 3300048907 Bacteria 1908
360 Ga0496104_0230506 3300048907 Bacteria 1764
361 Ga0496104_0750478 3300048907 Bacteria 883
362 Ga0496105_0077758 3300048908 Bacteria 2740
363 Ga0496105_0157707 3300048908 Bacteria 1863
364 Ga0496105_0206458 3300048908 Bacteria 1602
365 Ga0496105_0218626 3300048908 Bacteria 1551
366 Ga0496105_0240576 3300048908 Bacteria 1469
367 Ga0496106_0034831 3300048909 Bacteria 3763
368 Ga0496106_0036589 3300048909 Bacteria 3671
369 Ga0496106_0081618 3300048909 Bacteria 2484
370 Ga0496106_0546606 3300048909 Bacteria 929
371 Ga0496107_0014335 3300048910 Bacteria 5550
372 Ga0496107_0026183 3300048910 Bacteria 4133
373 Ga0496107_0142443 3300048910 Bacteria 1772
374 Ga0496108_0004123 3300048911 Bacteria 11675
375 Ga0496108_0007474 3300048911 Bacteria 8858
376 Ga0496108_0009780 3300048911 Bacteria 7768
377 Ga0496108_0072435 3300048911 Bacteria 2908
378 Ga0496108_0140200 3300048911 Bacteria 2083
379 Ga0496108_0504096 3300048911 Bacteria 1057
380 Ga0496109_0003257 3300048912 Bacteria 13535
381 Ga0496109_0008282 3300048912 Bacteria 8828
382 Ga0496109_0056340 3300048912 Bacteria 3587
383 Ga0496109_0100489 3300048912 Bacteria 2683
384 Ga0496109_0196116 3300048912 Bacteria 1898
385 Ga0496109_0623992 3300048912 Bacteria 1014
386 Ga0496109_0899267 3300048912 Bacteria 823
387 Ga0496110_0003959 3300048913 Bacteria 11394
388 Ga0496110_0011245 3300048913 Bacteria 7316
389 Ga0496110_0071712 3300048913 Bacteria 3072
390 Ga0496110_0133073 3300048913 Bacteria 2246
391 Ga0496110_0234646 3300048913 Bacteria 1669
392 Ga0496110_0382014 3300048913 Bacteria 1283
393 Ga0496111_0001798 3300048914 Bacteria 12586
394 Ga0496111_0022568 3300048914 Bacteria 4408
395 Ga0496111_0052512 3300048914 Bacteria 2943
396 Ga0496111_0117258 3300048914 Bacteria 1964
397 Ga0496112_0001810 3300048915 Bacteria 16828
398 Ga0496112_0004519 3300048915 Bacteria 11815
399 Ga0496112_0075755 3300048915 Bacteria 3327
400 Ga0496112_0143413 3300048915 Bacteria 2357
401 Ga0496112_0236944 3300048915 Bacteria 1778
402 Ga0496112_0262300 3300048915 Bacteria 1677
403 Ga0496112_0269358 3300048915 Bacteria 1651
404 Ga0496113_0004972 3300048916 Bacteria 8240
405 Ga0496113_0005548 3300048916 Bacteria 7881
406 Ga0496113_0026590 3300048916 Bacteria 4139
407 Ga0496113_0028766 3300048916 Bacteria 4002
408 Ga0496113_0103682 3300048916 Bacteria 2206
409 Ga0496114_0099364 3300048917 Bacteria 2482
410 Ga0496114_0316095 3300048917 Bacteria 1380
411 Ga0496114_0842957 3300048917 Bacteria 796
412 Ga0496115_0185577 3300048918 Bacteria 1718
413 Ga0496121_0027878 3300048924 Bacteria 5274
414 Ga0496124_0321279 3300048927 Bacteria 1108
415 Ga0501306_011181 3300049127 Bacteria 1141
416 Ga0501306_027757 3300049127 Bacteria 826
417 Ga0501317_004658 3300049533 Bacteria 1437
418 Ga0501317_024489 3300049533 Bacteria 840
419 Ga0501031_0311718 3300049568 Bacteria 1019
420 Ga0501036_0206921 3300049572 Bacteria 1649
421 Ga0501037_0414753 3300049573 Bacteria 922
422 Ga0501039_0085650 3300049575 Bacteria 2454
423 Ga0501042_0191231 3300049578 Bacteria 1476
424 Ga0501042_0449806 3300049578 Bacteria 934
425 Ga0501043_0104683 3300049579 Bacteria 2224
426 Ga0501046_0067313 3300049580 Bacteria 2789
427 Ga0501048_0091640 3300049582 Bacteria 2144
428 Ga0501048_0296385 3300049582 Bacteria 1150
429 Ga0501068_0267326 3300049584 Bacteria 1091
430 Ga0501068_0278403 3300049584 Bacteria 1069
431 Ga0501071_0260998 3300049587 Bacteria 1308
432 Ga0501074_0168409 3300049590 Bacteria 1564
433 Ga0501076_0063287 3300049592 Bacteria 2947
434 Ga0501079_0119065 3300049741 Bacteria 2053
435 Ga0501080_0611782 3300049742 Bacteria 966
436 Ga0501083_0307832 3300049744 Bacteria 1030
437 Ga0501044_0213150 3300049823 Bacteria 1885
438 Ga0501044_0290328 3300049823 Bacteria 1567
439 nmdc:mga08y16_778695_c1 3300050511 Bacteria 951
440 nmdc:mga0n895_23680_c1 3300050512 Bacteria 5775
441 Ga0495601_0133665 3300053077 Bacteria 1616
442 Ga0495612_0121121 3300053078 Bacteria 1125
443 Ga0495595_0032195 3300053084 Bacteria 2360
444 Ga0590074_028044 3300059423 Bacteria 988
445 Ga0501082_0297446 3300060353 Bacteria 1405
446 Ga0501082_0485635 3300060353 Bacteria 1080
447 Ga0466962_0056496 3300061719 Bacteria 1874
448 Ga0466962_0144528 3300061719 Bacteria 1153
449 Ga0530510_0083464 3300061734 Bacteria 2326
450 Ga0068869_100193743
451 Ga0070683_100004183
452 Ga0070683_100084204
453 Ga0070683_100274925
454 Ga0070683_100363809
455 Ga0068869_100080462
456 Ga0068869_100120900
457 Ga0070682_100021035
458 Ga0068868_100016031
459 Ga0068868_100189361
460 Ga0068868_100286185
461 Ga0068868_100399510
462 Ga0070660_100003497
463 Ga0070660_100140606
464 Ga0070660_100241734
465 Ga0070689_100109774
466 Ga0070661_100219931
467 Ga0070692_10066933
468 Ga0070692_10425864
469 Ga0070675_100361124
470 Ga0070671_100097360
471 Ga0070674_100129035
472 Ga0070674_100138367
473 Ga0070674_100154150
474 Ga0070659_100116328
475 Ga0070703_10076194
476 Ga0070709_10157118
477 Ga0070714_100128633
478 Ga0070714_100816543
479 Ga0070713_100025130
480 Ga0070710_10032394
481 Ga0070701_10078277
482 Ga0070700_100084563
483 Ga0070700_100093552
484 Ga0070700_100232438
485 Ga0070663_100201236
486 Ga0070663_100624520
487 Ga0070678_100689343
488 Ga0070662_100251961
489 Ga0068867_100155496
490 Ga0068867_100240284
491 Ga0068867_100777440
492 Ga0070679_100067285
493 Ga0070684_100014493
494 Ga0070684_100341081
495 Ga0070684_100419931
496 Ga0070697_100381547
497 Ga0070672_100379592
498 Ga0070686_100274170
499 Ga0070693_100027469
500 Ga0070693_100245928
501 Ga0070665_100343750
502 Ga0070665_100371773
503 Ga0070704_100277602
504 Ga0068855_100021337
505 Ga0070664_100059320
506 Ga0070664_100179270
507 Ga0070664_100349987
508 Ga0070664_100808288
509 Ga0068857_100016416
510 Ga0068857_100243592
511 Ga0068854_100086716
512 Ga0068854_100151099
513 Ga0068854_100190026
514 Ga0068854_100750455
515 Ga0068856_100090930
516 Ga0068856_101002419
517 Ga0070702_100005631
518 Ga0068852_100349914
519 Ga0068859_100053777
520 Ga0068864_100373041
521 Ga0068870_10062303
522 Ga0068870_10062874
523 Ga0068870_10094077
524 Ga0068863_100355149
525 Ga0068858_100115450
526 Ga0068858_100124218
527 Ga0068860_100219544
528 Ga0068862_101202114
529 Ga0081455_10079314
530 Ga0081538_10030998
531 Ga0081538_10034025
532 Ga0081538_10055855
533 Ga0081540_1005439
534 Ga0081540_1016802
535 Ga0081539_10026514
536 Ga0081539_10141972
537 Ga0070717_10050198
538 Ga0097621_100042670
539 Ga0075433_10390162
540 Ga0075434_100003285
541 Ga0068865_100184110
542 Ga0068865_100496664
543 Ga0097620_100053778
544 Ga0075435_100210506
545 Ga0111539_11051411
546 Ga0111539_11511192
547 Ga0105245_10033445
548 Ga0105245_10091016
549 Ga0105245_10112902
550 Ga0105245_10959792
551 Ga0105245_11525325
552 Ga0105247_10050635
553 Ga0105243_10054900
554 Ga0105243_10085476
555 Ga0105243_10348847
556 Ga0105241_10953000
557 Ga0105242_10210934
558 Ga0105248_10361030
559 Ga0105248_10547028
560 Ga0105237_10054556
561 Ga0105238_10137715
562 Ga0105238_11714928
563 Ga0105249_10105719
564 Ga0105249_10587380
565 Ga0105239_10042546
566 Ga0105239_10285442
567 Ga0105239_11176937
568 Ga0105246_10017497
569 Ga0105246_10070709
570 Ga0105246_10085113
571 Ga0157343_1003852
572 Ga0157315_1005545
573 Ga0157371_10251962
574 Ga0157369_10171847
575 Ga0157374_10054496
576 Ga0157374_10116465
577 Ga0157372_10193904
578 Ga0157372_10588271
579 Ga0157375_10409094
580 Ga0157375_10693432
581 Ga0157375_11888572
582 Ga0163163_10278476
583 Ga0163163_10581280
584 Ga0163163_10810243
585 Ga0157380_10885038
586 Ga0157380_11410881
587 Ga0157377_10040620
588 Ga0157377_10426514
589 Ga0157379_10115783
590 Ga0157379_10144875
591 Ga0163161_10963557
592 Ga0213876_10050742
593 Ga0207653_10051127
594 Ga0207692_10572413
595 Ga0207642_10015664
596 Ga0207642_10241513
597 Ga0207710_10016771
598 Ga0207688_10101440
599 Ga0207688_10356673
600 Ga0207688_10511565
601 Ga0207647_10366532
602 Ga0207685_10027754
603 Ga0207645_10026553
604 Ga0207643_10306632
605 Ga0207705_10348423
606 Ga0207695_10135218
607 Ga0207671_10045123
608 Ga0207693_10100434
609 Ga0207657_10001826
610 Ga0207657_10194708
611 Ga0207652_10064741
612 Ga0207694_10197423
613 Ga0207659_10264803
614 Ga0207687_10000332
615 Ga0207687_10030470
616 Ga0207687_10561991
617 Ga0207700_10048985
618 Ga0207644_10106681
619 Ga0207690_10124078
620 Ga0207690_10216793
621 Ga0207690_10240364
622 Ga0207706_10190608
623 Ga0207709_10022767
624 Ga0207709_10431915
625 Ga0207670_10039010
626 Ga0207704_10051212
627 Ga0207704_10229992
628 Ga0207704_10423836
629 Ga0207665_10036183
630 Ga0207691_10279154
631 Ga0207711_11142872
632 Ga0207689_10055881
633 Ga0207689_10091239
634 Ga0207661_10002864
635 Ga0207661_10066894
636 Ga0207679_10287825
637 Ga0207679_10613484
638 Ga0207667_10032942
639 Ga0207651_10433078
640 Ga0207712_10881881
641 Ga0207668_10542381
642 Ga0207640_10101129
643 Ga0207677_10006957
644 Ga0207677_10085311
645 Ga0207677_10229486
646 Ga0207703_10065761
647 Ga0207703_10084750
648 Ga0207703_10262778
649 Ga0207639_10335734
650 Ga0207639_10677388
651 Ga0207639_10822924
652 Ga0207678_10069148
653 Ga0207678_10100762
654 Ga0207678_10547073
655 Ga0207708_10048605
656 Ga0207708_10087705
657 Ga0207702_10028787
658 Ga0207702_10893050
659 Ga0207641_10280559
660 Ga0207641_10430768
661 Ga0207648_10216546
662 Ga0207648_10689379
663 Ga0207676_10054566
664 Ga0207676_10516736
665 Ga0207674_10006903
666 Ga0207683_10057952
667 Ga0207683_10215107
668 Ga0207683_10798593
669 Ga0207698_10373123
670 Ga0207698_10485489
671 Ga0207428_10500070
672 Ga0268266_10089913
673 Ga0268266_10202451
674 Ga0268266_10530074
675 Ga0268265_10805956
676 Ga0268264_10070200
677 Ga0265319_1000006
678 Ga0265319_1005558
679 Ga0265319_1079777
680 Ga0265318_10002149
681 Ga0265338_10040390
682 Ga0265330_10293317
683 Ga0265320_10012505
684 Ga0265331_10144782
685 Ga0265316_10029887
686 Ga0265314_10021653
687 Ga0307405_10096705
688 Ga0307405_10402701
689 Ga0307405_10688134
690 Ga0307413_10349902
691 Ga0307413_10555439
692 Ga0307410_10325375
693 Ga0307410_10722307
694 Ga0307406_10090045
695 Ga0307409_100110133
696 Ga0307409_100427510
697 Ga0307416_100600943
698 Ga0307411_10693979
699 Ga0307415_100137774
700 Ga0373944_0025103
701 Ga0373923_0045036
702 Ga0373936_0051014
703 Ga0373941_0028645
704 Ga0373945_0033527
705 Ga0373953_0158896
706 Ga0373954_0129049
707 Ga0373943_0094084
708 Ga0373946_0015043
709 Ga0373955_0056438
710 Ga0373924_0014628
711 Ga0373933_0122511
712 Ga0373947_0011741
713 Ga0373937_0029439
714 Ga0373925_0018772
715 Ga0395900_0003484
716 Ga0395900_0597007
717 Ga0395898_0004042
718 Ga0395898_0522050
719 Ga0395898_0558093
720 Ga0395905_0311297
721 Ga0436364_0012596
722 Ga0436364_0474529
723 Ga0395901_0394024
724 Ga0395901_0507956
725 Ga0436365_1934402
726 Ga0451802_0868571
727 Ga0451853_0284597
728 Ga0439460_0124688
729 Ga0466972_0099543
730 Ga0466972_0150477
731 Ga0466965_0082890
732 Ga0466965_0382911
733 Ga0466966_0198223
734 Ga0466961_0054610
735 Ga0466961_0346936
736 Ga0466963_0252358
737 Ga0466963_0287469
738 Ga0466964_0707517
739 Ga0466971_0090009
740 Ga0466971_0157452
741 Ga0466970_0127816
742 Ga0466957_0062514
743 Ga0466957_0232740
744 Ga0466960_0001761
745 Ga0466960_0255659
746 Ga0466960_0297644
747 Ga0466959_0302756
748 Ga0466958_0210432
749 Ga0466967_0083950
750 Ga0466967_0137285
751 Ga0466967_0173018
752 Ga0466967_0222275
753 Ga0466967_0251562
754 Ga0466967_0569664
755 Ga0495603_0036748
756 Ga0495590_0154612
757 Ga0495641_0099917
758 Ga0495651_0423876
759 Ga0495653_0115654
760 Ga0495650_0000121
761 Ga0495580_0191454
762 Ga0495582_0062051
763 Ga0495662_0047990
764 Ga0495664_0116577
765 Ga0495594_0008773
766 Ga0495594_0201063
767 Ga0495608_0041143
768 Ga0495618_0043754
769 Ga0495663_0028842
770 Ga0495652_0149926
771 Ga0495640_0016816
772 Ga0495587_0066487
773 Ga0495609_0091252
774 Ga0495645_0103708
775 Ga0495668_0185721
776 Ga0495668_0315913
777 Ga0495635_0009523
778 Ga0495588_0032224
779 Ga0495647_0020129
780 Ga0495658_0001182
781 Ga0495581_0005995
782 Ga0495581_0066133
783 Ga0495676_0028080
784 Ga0495680_0021643
785 Ga0495602_0078977
786 Ga0495614_0058535
787 Ga0496100_0027989
788 Ga0496100_0037073
789 Ga0496100_0111501
790 Ga0496100_0209779
791 Ga0496100_0327305
792 Ga0496101_0013189
793 Ga0496101_0128503
794 Ga0496101_0279173
795 Ga0496101_0528705
796 Ga0496101_1178773
797 Ga0496102_0124096
798 Ga0496102_0141314
799 Ga0496102_0243282
800 Ga0496102_0336377
801 Ga0496102_0486900
802 Ga0496102_0502879
803 Ga0496103_0263968
804 Ga0496104_0033793
805 Ga0496104_0035323
806 Ga0496104_0042732
807 Ga0496104_0082568
808 Ga0496104_0200315
809 Ga0496104_0230506
810 Ga0496104_0750478
811 Ga0496105_0077758
812 Ga0496105_0157707
813 Ga0496105_0206458
814 Ga0496105_0218626
815 Ga0496105_0240576
816 Ga0496106_0034831
817 Ga0496106_0036589
818 Ga0496106_0081618
819 Ga0496106_0546606
820 Ga0496107_0014335
821 Ga0496107_0026183
822 Ga0496107_0142443
823 Ga0496108_0004123
824 Ga0496108_0007474
825 Ga0496108_0009780
826 Ga0496108_0072435
827 Ga0496108_0140200
828 Ga0496108_0504096
829 Ga0496109_0003257
830 Ga0496109_0008282
831 Ga0496109_0056340
832 Ga0496109_0100489
833 Ga0496109_0196116
834 Ga0496109_0623992
835 Ga0496109_0899267
836 Ga0496110_0003959
837 Ga0496110_0011245
838 Ga0496110_0071712
839 Ga0496110_0133073
840 Ga0496110_0234646
841 Ga0496110_0382014
842 Ga0496111_0001798
843 Ga0496111_0022568
844 Ga0496111_0052512
845 Ga0496111_0117258
846 Ga0496112_0001810
847 Ga0496112_0004519
848 Ga0496112_0075755
849 Ga0496112_0143413
850 Ga0496112_0236944
851 Ga0496112_0262300
852 Ga0496112_0269358
853 Ga0496113_0004972
854 Ga0496113_0005548
855 Ga0496113_0026590
856 Ga0496113_0028766
857 Ga0496113_0103682
858 Ga0496114_0099364
859 Ga0496114_0316095
860 Ga0496114_0842957
861 Ga0496115_0185577
862 Ga0496121_0027878
863 Ga0496124_0321279
864 Ga0501306_011181
865 Ga0501306_027757
866 Ga0501317_004658
867 Ga0501317_024489
868 Ga0501031_0311718
869 Ga0501036_0206921
870 Ga0501037_0414753
871 Ga0501039_0085650
872 Ga0501042_0191231
873 Ga0501042_0449806
874 Ga0501043_0104683
875 Ga0501046_0067313
876 Ga0501048_0091640
877 Ga0501048_0296385
878 Ga0501068_0267326
879 Ga0501068_0278403
880 Ga0501071_0260998
881 Ga0501074_0168409
882 Ga0501076_0063287
883 Ga0501079_0119065
884 Ga0501080_0611782
885 Ga0501083_0307832
886 Ga0501044_0213150
887 Ga0501044_0290328
888 nmdc:mga08y16_778695_c1
889 nmdc:mga0n895_23680_c1
890 Ga0495601_0133665
891 Ga0495612_0121121
892 Ga0495595_0032195
893 Ga0590074_028044
894 Ga0501082_0297446
895 Ga0501082_0485635
896 Ga0466962_0056496
897 Ga0466962_0144528
898 Ga0530510_0083464

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00297

Ribosomal_L3

Ribosomal protein L3

74

183

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9178 9 209
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.912 8 207
6hix-assembly1.cif.gz_AE cryo-em structure of the trypanosoma brucei mitochondrial ribosome - this entry contains the large mitoribosomal subunit 0.903 10 209
6pvk-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class a 0.8835 8 209
6ppf-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class b 0.8819 8 209
ID Description Score Start End Superfamily
1vw3C01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9622 9 209 2.40.30.10
af_Q9SKX4_88_148_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8991 41 90 3.30.160.810
af_Q9LIT4_106_169_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8822 41 101 3.30.160.810
1vw3C02 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8767 39 90 3.30.160.810
af_P9WH87_35_101_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8622 41 101 3.30.160.810
ID Description Score Start End GO Terms
AF-A0A7K0RZX3-F1-model_v4 50S ribosomal protein L3 0.9419 10 102 GO:0003735
GO:0006412
GO:0022625
AF-X0Z1Y0-F1-model_v4 50S ribosomal protein L3 0.9113 10 106 GO:0003735
GO:0006412
GO:0022625
AF-A0A845Y1H4-F1-model_v4 50S ribosomal protein L3 0.8977 10 107 GO:0003735
GO:0006412
GO:0022625
AF-A0A382PF23-F1-model_v4 50S ribosomal protein L3 0.8895 12 107 GO:0003735
GO:0006412
GO:0022625
AF-A0A356M6X3-F1-model_v4 50S ribosomal protein L3 0.8878 10 107 GO:0003735
GO:0006412
GO:0022625

Map